SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.5.57534 Live (hotfix 2024-11-14/57534, git build 9abb449df1)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Vauquelin : 992,548 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
992,548.1992,548.1589.4 / 0.059%118,837.3 / 12.0%1,018,005.7
Resource Out In Waiting APM Active
Holy Power1.01.07.80%53.4100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/vauquelin
TalentCYEA5ba6OK14IUITjS1kSUVJcBAAAYAAassNzstsNGbjZ22mZDAAAAAAjmmhhZGbzgZbYMLzYbYwMmhlF2AAAIzMtNLz2MAgNgBAjxMMD
Set Bonus
Scale Factors for Vauquelin Damage Per Second
Wdps Mastery Str Crit Haste Vers
Scale Factors 85.55 16.54 15.75 13.73 12.54 11.24
Normalized 5.43 1.05 1.00 0.87 0.80 0.71
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.40 0.37 0.37 0.37 0.36 0.36
Ranking
  • Wdps > Mastery > Str > Crit > Haste > Vers
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, Strength=15.75, CritRating=13.73, HasteRating=12.54, MasteryRating=16.54, Versatility=11.24, Dps=85.55 )

Scale Factors for other metrics

Scale Factors for Vauquelin Priority Target Damage Per Second
Wdps Mastery Str Crit Haste Vers
Scale Factors 85.55 16.54 15.75 13.73 12.54 11.24
Normalized 5.43 1.05 1.00 0.87 0.80 0.71
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.40 0.37 0.37 0.37 0.36 0.36
Ranking
  • Wdps > Mastery > Str > Crit > Haste > Vers
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, Strength=15.75, CritRating=13.73, HasteRating=12.54, MasteryRating=16.54, Versatility=11.24, Dps=85.55 )
Scale Factors for Vauquelin Damage Per Second (Effective)
Wdps Mastery Str Crit Haste Vers
Scale Factors 85.55 16.54 15.75 13.73 12.54 11.24
Normalized 5.43 1.05 1.00 0.87 0.80 0.71
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Mastery > Str > Crit > Haste > Vers
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, Strength=15.75, CritRating=13.73, HasteRating=12.54, MasteryRating=16.54, Versatility=11.24, Dps=85.55 )
Scale Factors for Vauquelin Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Vauquelin Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Vauquelin Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Vauquelin Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Vauquelin Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Vauquelin Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Vauquelin Fight Length
Crit Wdps Haste Vers Str Mastery
Scale Factors 0.00 0.00 0.00 0.00 0.00 0.00
Normalized 84.11 64.59 61.90 42.93 1.00 0.54
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Crit > Wdps > Haste > Vers > Str > Mastery
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, Strength=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=0.00, Versatility=0.00, Dps=0.00 )
Scale Factors for Raid Damage Per Second
Wdps Mastery Str Crit Haste Vers
Scale Factors 85.55 16.54 15.75 13.73 12.54 11.24
Normalized 5.43 1.05 1.00 0.87 0.80 0.71
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.40 0.37 0.37 0.37 0.36 0.36
Ranking
  • Wdps > Mastery > Str > Crit > Haste > Vers
Pawn string ( Pawn: v1: "Vauquelin-Retribution": Class=Paladin, Spec=Retribution, Strength=15.75, CritRating=13.73, HasteRating=12.54, MasteryRating=16.54, Versatility=11.24, Dps=85.55 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Vauquelin992,548
Blade of Justice 69,8067.0%64.24.66s325,747314,967Direct64.2250,538514,400325,75328.5%

Stats Details: Blade Of Justice

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage64.2464.240.000.000.001.03420.000020,924,529.9720,924,529.970.00%314,967.19314,967.19
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.50%45.932470250,537.85180,582324,557250,525.59231,577269,42011,506,16411,506,1640.00%
crit28.50%18.31537514,399.93384,634665,342514,532.97460,252578,7179,418,3669,418,3660.00%

Action Details: Blade Of Justice

  • id:184575
  • school:holy
  • range:12.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:184575
  • name:Blade of Justice
  • school:holy
  • tooltip:
  • description:{$?s403826=false}[Pierce enemies][Pierce an enemy] with a blade of light, dealing {$s1=0} Holy damage{$?s403826=false}[ to your target and {$404358s1=0} Holy damage to nearby enemies.][.] |cFFFFFFFFGenerates {$s2=1} Holy Power.|r

Action Priority List

    generators
    [K]:6.75
  • if_expr:!dot.expurgation.ticking&talent.holy_flames
    generators
    [Q]:57.49
  • if_expr:holy_power<=3|!talent.holy_blade

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Cooldown DurationRetribution Paladin1370273SET1.000
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370276SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin13702719SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Spell Direct AmountPaladin Retribution 11.0 Class Set 2pc4536551PCT15.0%
(blade_of_justice_) Consecration 0 (12,834)0.0% (1.3%)22.813.49s168,9750

Stats Details: Blade Of Justice Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.770.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Blade Of Justice Consecration

  • id:26573
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=false}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=true}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
    (blade_of_justice_) Consecration 12,8341.3%0.00.00s00Periodic386.77,65015,7079,94928.5%0.0%

Stats Details: Blade Of Justice Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00386.720.000.00000.00003,847,566.543,847,566.540.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.46%276.361893787,650.265,7619,9657,650.327,3368,0792,114,2512,114,2510.00%
crit28.54%110.356216815,706.8611,81020,42815,709.4214,81516,8961,733,3151,733,3150.00%

Action Details: Blade Of Justice Consecration Tick

  • id:81297
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:11.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Divine Arbiter 25,2122.5%13.322.40s569,2240Direct13.3569,4910569,4910.0%

Stats Details: Divine Arbiter

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.2913.280.000.000.000.00000.00007,565,291.767,565,291.760.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%13.281017569,490.90425,967736,840569,381.40503,818614,7127,565,2927,565,2920.00%

Action Details: Divine Arbiter

  • id:406983
  • school:holystrike
  • range:50000.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:406983
  • name:Divine Arbiter
  • school:holystrike
  • tooltip:
  • description:{$@spelldesc404306=Highlord's Judgment and Holystrike damage abilities grant you a stack of Divine Arbiter. At {$s3=25} stacks your next damaging single target Holy Power ability causes {$406983s1=0} Holystrike damage to your primary target and {$406983s2=0} Holystrike damage to enemies within 6 yds.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Divine Storm 16,732 (18,745)1.7% (1.9%)13.422.77s420,1340Direct13.4 (26.8)288,251591,576374,94328.6% (28.6%)

Stats Details: Divine Storm

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.3813.380.000.000.000.00000.00005,017,861.405,017,861.400.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.41%9.55316288,251.15180,241405,952288,264.05247,963332,9392,754,3662,754,3660.00%
crit28.59%3.83011591,576.27385,170830,550584,458.190811,3842,263,4962,263,4960.00%

Action Details: Divine Storm

  • id:53385
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Unleashes a whirl of divine energy, dealing {$?s405289=false}[{$=}{{$s1=0}*1.05} Radiant][{$s1=0} Holy] damage to all nearby enemies. Deals reduced damage beyond {$s2=5} targets.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Divine Storm (_tempest) 2,0140.2%13.422.77s45,1310Direct13.434,71871,20945,12628.5%

Stats Details: Divine Storm Tempest

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.3813.380.000.000.000.00000.0000603,889.37603,889.370.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.47%9.5621634,717.7625,94244,87534,720.4429,76839,812332,043332,0430.00%
crit28.53%3.8201171,209.0353,18291,99470,263.90091,703271,847271,8470.00%

Action Details: Divine Storm Tempest

  • id:224239
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:224239
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:{$@spelldesc53385=Unleashes a whirl of divine energy, dealing {$?s405289=false}[{$=}{{$s1=0}*1.05} Radiant][{$s1=0} Holy] damage to all nearby enemies. Deals reduced damage beyond {$s2=5} targets.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Divine Toll 0 (19,004)0.0% (1.9%)5.361.88s1,066,743922,238

Stats Details: Divine Toll

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.340.000.000.000.001.15680.00000.000.000.00%922,237.66922,237.66

Action Details: Divine Toll

  • id:375576
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:375576
  • name:Divine Toll
  • school:holy
  • tooltip:
  • description:Instantly cast {$?a137029=false}[Holy Shock]?a137028[Avenger's Shield]?a137027[Judgment][Holy Shock, Avenger's Shield, or Judgment] on up to {$s1=5} targets within {$=}A2 yds.{$?=}c3[ Divine Toll's Judgment deals {$326011s1=100}% increased damage.][]{$?=}c2[ Generates {$s5=1} Holy Power per target hit.][]

Action Priority List

    generators
    [M]:5.34
  • if_expr:holy_power<=2&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)&(cooldown.avenging_wrath.remains>15|cooldown.crusade.remains>15|talent.radiant_glory|fight_remains<8)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Global CooldownPaladin1370268SET1.000
    (divine_toll_) Judgment 7,2540.7%5.361.88s407,0960Direct5.3314,955644,483407,24328.0%

Stats Details: Divine Toll Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.345.340.000.000.000.00000.00002,175,043.882,175,043.880.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.01%3.8506314,955.40253,207434,735314,403.070432,4981,211,3621,211,3620.00%
crit27.99%1.5006644,483.22517,299891,207531,838.820886,621963,682963,6820.00%

Action Details: Divine Toll Judgment

  • id:20271
  • school:holystrike
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.671596
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.11
  • base_multiplier:3.15

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    (divine_resonance_) Judgment 11,7501.2%15.518.72s226,8620Direct15.5173,896358,141226,95828.8%

Stats Details: Divine Resonance Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.5415.530.000.000.000.00000.00003,524,384.833,524,384.830.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.20%11.06318173,896.30125,278228,236173,972.51144,511208,5521,922,7571,922,7570.00%
crit28.80%4.47013358,141.29256,820467,884356,680.410466,4011,601,6281,601,6280.00%

Action Details: Divine Resonance Judgment

  • id:20271
  • school:holystrike
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.671596
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.11
  • base_multiplier:1.58

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Empyrean Hammer 189,66019.1%402.60.74s141,3380Direct402.6 (402.6)108,715223,389141,33828.4% (28.4%)

Stats Details: Empyrean Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage402.55402.550.000.000.000.00000.000056,895,991.1356,895,991.130.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.55%288.03194376108,715.4658,055205,289108,728.48101,580116,81931,312,84531,312,8450.00%
crit28.45%114.5258172223,388.77119,013420,842223,460.75198,220252,12625,583,14725,583,1470.00%

Action Details: Empyrean Hammer

  • id:431398
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:431398
  • name:Empyrean Hammer
  • school:holy
  • tooltip:
  • description:A Holy Hammer called down from the skies to deal {$s1=0} Holy damage to its target.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Execution Sentence 109,75611.1%9.531.75s3,461,0374,587,599Direct9.53,461,20103,461,2010.0%

Stats Details: Execution Sentence

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.519.510.000.000.000.75450.000032,897,673.5332,897,673.530.00%4,587,599.154,587,599.15
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%9.517123,461,201.361,109,7596,615,8293,463,239.032,587,3784,184,87432,897,67432,897,6740.00%

Action Details: Execution Sentence

  • id:387113
  • school:holy
  • range:150.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:387113
  • name:Execution Sentence
  • school:holy
  • tooltip:
  • description:{$@spelldesc343527=A hammer slowly falls from the sky upon the target, after {$d=8 seconds}, they suffer {$s2=20}% of the damage taken from your abilities as Holy damage during that time. {$?s406158=false} [|cFFFFFFFFGenerates {$406158s1=3} Holy Power.][]}

Action Priority List

    cooldowns
    [G]:9.50
  • if_expr:(!buff.crusade.up&cooldown.crusade.remains>15|buff.crusade.stack=10|cooldown.avenging_wrath.remains<0.75|cooldown.avenging_wrath.remains>15|talent.radiant_glory)&(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(target.time_to_die>8&!talent.executioners_will|target.time_to_die>12)&cooldown.wake_of_ashes.remains<gcd

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Expurgation 56,2845.7%64.24.66s262,4960Periodic143.090,470186,865117,94028.5%97.7%

Stats Details: Expurgation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage64.240.00142.97142.9757.450.00002.049516,861,568.2316,861,568.230.00%57,544.480.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.50%102.236513890,470.4718379,49790,518.5769,040115,3479,248,6289,248,6280.00%
crit28.50%40.741667186,865.0666726,660187,022.80130,346262,5457,612,9417,612,9410.00%

Action Details: Expurgation

  • id:383346
  • school:holyfire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.229500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.11
  • base_multiplier:1.21
  • dot_duration:9.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:383346
  • name:Expurgation
  • school:holyfire
  • tooltip:Suffering {$=}w1 {$?s403665=false}[Holy][Radiant] damage every {$t1=3} sec.{$?s406545=true}[ Holy damage taken from {$@=}auracaster increased by {$=}w2%.][]
  • description:{$@spelldesc383344=Your Blade of Justice causes the target to burn for {$383346=}o1 {$?s403665=false}[Holy][Radiant] damage over {$383346d=9 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Final Verdict 151,11215.2%91.83.21s493,793466,184Direct91.8379,898779,691493,80928.5%

Stats Details: Final Verdict

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage91.7891.780.000.000.001.05920.000045,320,037.4745,320,037.470.00%466,183.59466,183.59
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.51%65.633793379,898.03213,249676,865379,891.97353,167407,89624,933,75824,933,7580.00%
crit28.49%26.15946779,691.30452,3951,383,176779,837.30675,760887,78520,386,28020,386,2800.00%

Action Details: Final Verdict

  • id:383328
  • school:holystrike
  • range:12.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:383328
  • name:Final Verdict
  • school:holy
  • tooltip:
  • description:Unleashes a powerful weapon strike that deals {$s1=0} {$?s403664=true}[Holystrike][Holy] damage to an enemy target, Final Verdict has a {$s2=15}% chance to reset the cooldown of Hammer of Wrath and make it usable on any target, regardless of their health.

Action Priority List

    finishers
    [I]:91.78
  • if_expr:(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hammer of Light 110,43711.1%17.317.56s1,919,7141,682,740Direct17.21,484,4543,041,0211,921,77628.1%

Stats Details: Hammer Of Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage17.2717.250.000.000.001.14080.000033,146,608.5533,146,608.550.00%1,682,739.801,682,739.80
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.91%12.404211,484,453.74819,0482,441,7491,484,549.381,151,1601,702,68318,412,32718,412,3270.00%
crit28.09%4.840123,041,021.031,740,8314,916,6473,027,724.6604,102,20414,734,28114,734,2810.00%

Action Details: Hammer Of Light

  • id:427453
  • school:holy
  • range:14.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:427453
  • name:Hammer of Light
  • school:holy
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$429826s1=0} Holy damage and {$=}{{$429826s1=0}/2} Holy damage up to 4 nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.

Action Priority List

    finishers
    [H]:17.27

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Global CooldownPaladin1370268SET1.000
Hammer of Wrath 22,3512.3%19.314.97s346,939327,156Direct19.3 (19.3)267,555547,250347,32628.5% (28.5%)

Stats Details: Hammer Of Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.3519.330.000.000.001.06050.00006,711,934.166,711,934.160.00%327,156.08327,156.08
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.48%13.81327267,554.83144,037397,038268,102.17208,749354,7653,696,2433,696,2430.00%
crit28.52%5.51015547,250.33307,847813,927546,900.330791,0053,015,6913,015,6910.00%

Action Details: Hammer Of Wrath

  • id:24275
  • school:holystrike
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$=}<damage> {$?s403664=true}[Holystrike][Holy] damage. Only usable on enemies that have less than 20% health{$?s326730=true}[, or during Avenging Wrath][]. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    generators
    [O]:12.09
  • if_expr:(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)&(target.health.pct<35&talent.vengeful_wrath|buff.blessing_of_anshe.up)
    generators
    [R]:7.26
  • if_expr:(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Cooldown DurationRetribution Paladin1370273SET1.000
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin4123147PCT16.0%
Spell Direct AmountRetribution Paladin4123148PCT-14.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Cooldown Duration (Category)Paladin1370266SET1.000
Highlord's Judgment 19,5802.0%30.99.73s190,0560Direct30.9147,787295,996190,05728.5%

Stats Details: Highlords Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage30.9330.930.000.000.000.00000.00005,878,352.645,878,352.640.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.48%22.11542147,786.97122,083167,850147,725.46141,141156,5723,267,4403,267,4400.00%
crit28.52%8.82023295,995.78252,289335,700295,906.220332,9122,610,9132,610,9130.00%

Action Details: Highlords Judgment

  • id:383921
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383921
  • name:Highlord's Judgment
  • school:holy
  • tooltip:
  • description:Blasts the target with the Light, dealing {$s1=0} Holy damage.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Judgment 30,4663.1%40.67.36s225,064218,350Direct40.6173,198355,250225,15428.5%

Stats Details: Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage40.5840.570.000.000.001.03080.00009,134,016.439,134,016.430.00%218,349.98218,349.98
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.46%28.991443173,198.43125,278228,236173,221.71157,629190,5455,020,6665,020,6660.00%
crit28.54%11.58124355,250.21256,820467,884355,387.90296,162428,3754,113,3514,113,3510.00%

Action Details: Judgment

  • id:20271
  • school:holystrike
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.671596
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.11
  • base_multiplier:1.58

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Action Priority List

    generators
    [P]:40.59
  • if_expr:holy_power<=3|!talent.boundless_judgment

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
melee 0 (52,456)0.0% (5.3%)167.31.79s93,99452,527

Stats Details: Melee

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.350.000.000.000.001.78940.00000.000.000.00%52,526.9452,526.94

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
    Crusading Strikes (crusading_strike) 52,4565.3%167.31.79s93,9940Direct167.372,293148,33993,99228.5%

Stats Details: Crusading Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.35167.350.000.000.000.00000.000015,729,770.2715,729,770.270.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.46%119.598216072,293.2354,69494,61072,287.3669,12975,4768,645,8178,645,8170.00%
crit28.54%47.762377148,339.20112,123193,951148,362.28136,467160,2507,083,9547,083,9540.00%

Action Details: Crusading Strike

  • id:408385
  • school:holystrike
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:408385
  • name:Crusading Strikes
  • school:physical
  • tooltip:
  • description:Strike the target for {$=}<damage> {$?s403664=true} [Holystrike][Physical] damage. |cFFFFFFFFGenerates {$s2=1} Holy Power every other attack.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Shield of Vengeance (_proc) 32,4893.3%4.964.55s1,986,1280Direct4.91,986,12701,986,1270.0%

Stats Details: Shield Of Vengeance Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.914.910.000.000.000.00000.00009,756,437.319,756,437.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%4.91461,986,127.461,880,5082,113,2911,985,751.341,931,1242,054,9099,756,4379,756,4370.00%

Action Details: Shield Of Vengeance Proc

  • id:184689
  • school:holy
  • range:8.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2018970.20
  • base_dd_max:2018970.20
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:184689
  • name:Shield of Vengeance
  • school:holy
  • tooltip:
  • description:{$@spelldesc184662=Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.}
Wake of Ashes 17,874 (72,355)1.8% (7.3%)9.831.88s2,205,9041,835,737Direct9.8 (100.3)420,987862,970545,36928.1% (28.2%)

Stats Details: Wake Of Ashes

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.839.830.000.000.001.20170.00005,362,409.585,362,409.580.00%1,835,736.561,835,736.56
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.87%7.07112420,986.98359,821585,930420,936.54395,055463,1252,975,0442,975,0440.00%
crit28.13%2.7709862,970.31737,6341,185,149828,290.3201,107,6422,387,3652,387,3650.00%

Action Details: Wake Of Ashes

  • id:255937
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:3.0

Spelldata

  • id:255937
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.

Action Priority List

    generators
    [L]:9.83
  • if_expr:(!talent.lights_guidance|holy_power>=2&talent.lights_guidance)&(cooldown.avenging_wrath.remains>6|cooldown.crusade.remains>6|talent.radiant_glory)&(!talent.execution_sentence|cooldown.execution_sentence.remains>4|target.time_to_die<8)&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Spell Direct AmountPaladin Retribution 11.0 Class Set 2pc4536552PCT10.0%
Spell Periodic AmountPaladin Retribution 11.0 Class Set 2pc4536553PCT10.0%
    Truth's Wake 30,5773.1%9.831.88s931,4340Periodic70.999,246203,764129,19128.7%40.5%

Stats Details: Truths Wake

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.830.0070.8970.890.010.00001.71309,158,959.039,158,959.030.00%75,422.110.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.34%50.58366799,245.8431126,87499,308.7089,551110,5675,019,6595,019,6590.00%
crit28.66%20.32547203,763.7164260,092203,608.05152,084236,7544,139,3004,139,3000.00%

Action Details: Truths Wake

  • id:403695
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.544000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.22
  • base_multiplier:1.10
  • dot_duration:9.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:403695
  • name:Truth's Wake
  • school:holyfire
  • tooltip:{$?=}(s403696)[Burning for {$=}w2 damage every {$t2=3} sec and movement speed reduced by {$s1=50}%.] [Movement speed reduced by {$s1=50}%.]
  • description:Burns the targets for an additional {$=}o2 Radiant damage over {$d=9 seconds}, and slows them by {$s1=50}%.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Spell Direct AmountPaladin Retribution 11.0 Class Set 2pc4536552PCT10.0%
Spell Periodic AmountPaladin Retribution 11.0 Class Set 2pc4536553PCT10.0%
    Wake of Ashes (seething_flames_0) 11,8241.2%9.831.88s361,3350Direct9.8279,083571,928361,33828.1%

Stats Details: Seething Flames 0

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.829.820.000.000.000.00000.00003,547,110.453,547,110.450.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.91%7.06112279,083.42239,788379,096279,053.07263,268303,8441,970,2301,970,2300.00%
crit28.09%2.7608571,927.99489,953729,382549,763.080687,4241,576,8811,576,8810.00%

Action Details: Seething Flames 0

  • id:405345
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:405345
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:{$@spelldesc255937=Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Spell Direct AmountPaladin Retribution 11.0 Class Set 2pc4536552PCT10.0%
Spell Periodic AmountPaladin Retribution 11.0 Class Set 2pc4536553PCT10.0%
    Wake of Ashes (seething_flames_1) 12,0811.2%9.831.88s369,6600Direct9.8284,355584,010369,71728.5%

Stats Details: Seething Flames 1

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.809.800.000.000.000.00000.00003,622,584.203,622,584.200.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.53%7.01112284,354.84229,242379,096284,350.49260,852338,0021,993,3711,993,3710.00%
crit28.47%2.7909584,010.15489,953779,622559,791.710748,1771,629,2131,629,2130.00%

Action Details: Seething Flames 1

  • id:405350
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:405350
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:{$@spelldesc255937=Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Spell Direct AmountPaladin Retribution 11.0 Class Set 2pc4536552PCT10.0%
Spell Periodic AmountPaladin Retribution 11.0 Class Set 2pc4536553PCT10.0%
Simple Action Stats Execute Interval
Vauquelin
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vauquelin
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vauquelin
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
The Sushi Special 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457302
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vauquelin
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5301.74s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.470.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [D]:1.47
  • if_expr:buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up|fight_remains<30
Sacrosanct Crusade (_heal) 17.317.56s

Stats Details: Sacrosanct Crusade Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal17.270.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sacrosanct Crusade Heal

  • id:461885
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vauquelin
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:341234.40
  • base_dd_max:341234.40
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461885
  • name:Sacrosanct Crusade
  • school:holy
  • tooltip:
  • description:{$@spelldesc431730={$?a137028=false}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=false}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=false}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=false}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
Shield of Vengeance 4.964.39s

Stats Details: Shield Of Vengeance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb4.914.910.000.000.000.60090.00000.000.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%4.91460.00000.0000000.00%

Action Details: Shield Of Vengeance

  • id:184662
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.7500
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:62.999
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vauquelin
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs {$=}w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.

Action Priority List

    cooldowns
    [F]:3.91
  • if_expr:fight_remains>15&(!talent.execution_sentence|!debuff.execution_sentence.up)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blessing of Dawn74.54.64.0s3.8s1.5s37.97%68.68%0.0 (0.0)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_blessing_of_dawn
  • max_stacks:2
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 15.2s
  • trigger_min/max:0.8s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.3s
  • uptime_min/max:28.13% / 47.37%

Stack Uptimes

  • blessing_of_dawn_1:36.59%
  • blessing_of_dawn_2:1.38%

Spelldata

  • id:385127
  • name:Blessing of Dawn
  • tooltip:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing.
  • description:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing. This effect stacks.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blessing of Dusk1.672.5119.1s4.0s184.4s98.46%0.00%72.5 (72.5)0.6

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_blessing_of_dusk
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 350.7s
  • trigger_min/max:0.5s / 15.2s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 356.1s
  • uptime_min/max:96.30% / 98.92%

Stack Uptimes

  • blessing_of_dusk_1:98.46%

Spelldata

  • id:385126
  • name:Blessing of Dusk
  • tooltip:Damage taken reduced by {$=}w1%{$?s385129=false}[, armor increased by {$=}w2%, and Holy Power generating abilities cool down {$=}w3% faster.][.]
  • description:Damage taken reduced by {$s1=4}%{$?s385129=false}&c2[, armor increased by {$s2=10}%, and Holy Power generating abilities cool down {$s3=10}% faster]?s385129[ and your Holy Power generating abilities also grant an absorb shield for {$s9=10}% of damage or healing dealt.][] For {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crusade15.662.119.6s3.8s10.0s52.28%61.26%34.5 (94.5)15.1

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_crusade
  • max_stacks:10
  • base duration:27.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 44.8s
  • trigger_min/max:0.2s / 32.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:46.38% / 59.06%

Stack Uptimes

  • crusade_1:9.75%
  • crusade_4:3.97%
  • crusade_6:7.62%
  • crusade_7:0.85%
  • crusade_9:7.14%
  • crusade_10:22.95%

Spelldata

  • id:231895
  • name:Crusade
  • tooltip:Damage done and haste increased by {$=}<damage>%.{$?=}{$=}w4>0[ Hammer of Wrath may be cast on any target.][]{$?s53376=false}[ Exploding with Holy light for {$326731s1=0} damage to nearby enemies.][]
  • description:Call upon the Light and begin a crusade, increasing your haste {$?s384376=true}[and damage ][]by {$=}{{$s5=30}/10}% for {$d=27 seconds}. Each Holy Power spent during Crusade increases haste and damage by an additional {$=}{{$s5=30}/10}%. Maximum {$u=10} stacks.{$?s53376=false}[ While active, each Holy Power spent causes you to explode with Holy light for {$326731s1=0} damage to nearby enemies.][]{$?s384376=true}[ Hammer of Wrath may be cast on any target.][]
  • max_stacks:10
  • duration:27.00
  • cooldown:120.00
  • default_chance:100.00%
Divine Arbiter14.3356.621.7s0.8s20.9s99.65%100.00%25.0 (25.0)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_divine_arbiter
  • max_stacks:25
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.3s / 38.4s
  • trigger_min/max:0.0s / 2.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.4s
  • uptime_min/max:99.56% / 99.72%

Stack Uptimes

  • divine_arbiter_1:4.06%
  • divine_arbiter_2:4.65%
  • divine_arbiter_3:3.91%
  • divine_arbiter_4:3.65%
  • divine_arbiter_5:3.51%
  • divine_arbiter_6:3.66%
  • divine_arbiter_7:3.60%
  • divine_arbiter_8:3.69%
  • divine_arbiter_9:3.81%
  • divine_arbiter_10:3.82%
  • divine_arbiter_11:3.70%
  • divine_arbiter_12:3.62%
  • divine_arbiter_13:3.63%
  • divine_arbiter_14:3.64%
  • divine_arbiter_15:3.68%
  • divine_arbiter_16:3.70%
  • divine_arbiter_17:3.68%
  • divine_arbiter_18:3.64%
  • divine_arbiter_19:3.64%
  • divine_arbiter_20:3.63%
  • divine_arbiter_21:3.65%
  • divine_arbiter_22:3.65%
  • divine_arbiter_23:3.67%
  • divine_arbiter_24:3.71%
  • divine_arbiter_25:10.07%

Spelldata

  • id:406975
  • name:Divine Arbiter
  • tooltip:Building up Divine strength, at 25 stacks your next single target Holy Power ability causes {$=}{{$406983s1=0}/25} Holystrike damage to your primary target and {$=}{{$406983s2=0}/25} Holystrike damage to enemies within 8 yds.
  • description:{$@spelldesc404306=Highlord's Judgment and Holystrike damage abilities grant you a stack of Divine Arbiter. At {$s3=25} stacks your next damaging single target Holy Power ability causes {$406983s1=0} Holystrike damage to your primary target and {$406983s2=0} Holystrike damage to enemies within 6 yds.}
  • max_stacks:25
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Purpose10.90.024.9s24.9s2.2s8.13%9.89%0.0 (0.0)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 292.4s
  • trigger_min/max:0.8s / 292.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.7s
  • uptime_min/max:0.00% / 21.01%

Stack Uptimes

  • divine_purpose_1:8.13%

Spelldata

  • id:408458
  • name:Divine Purpose
  • tooltip:Your next Holy Power spending ability is free and deals {$s2=10}% increased damage and healing.
  • description:{$@spelldesc408459=Holy Power spending abilities have a {$s1=10}% chance to make your next Holy Power spending ability free and deal {$408458s2=10}% increased damage and healing.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Resonance5.30.061.8s61.8s14.7s26.12%0.00%10.4 (10.4)5.1

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_divine_resonance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:60.0s / 77.8s
  • trigger_min/max:60.0s / 77.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:22.55% / 29.27%

Stack Uptimes

  • divine_resonance_1:26.12%

Spelldata

  • id:355455
  • name:Divine Resonance
  • tooltip:Casting {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$t1=5} sec for {$s2=15} sec.
  • description:{$@spelldesc355098=After casting Divine Toll, you instantly cast {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$355455t1=5} sec. This effect lasts {$355455s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Empyrean Legacy13.40.023.1s23.1s2.0s8.90%14.60%0.0 (0.0)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_empyrean_legacy
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 42.1s
  • trigger_min/max:20.0s / 42.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.2s
  • uptime_min/max:5.32% / 16.57%

Stack Uptimes

  • empyrean_legacy_1:8.90%

Spelldata

  • id:387178
  • name:Empyrean Legacy
  • tooltip:Your next {$?=}c3[Single target Holy Power ability automatically triggers Divine Storm][Word of Glory automatically triggers Light of Dawn] with {$387170s2=25}% increased effectiveness.
  • description:{$@spelldesc387170=Judgment empowers your next {$?=}c3[Single target Holy Power ability to automatically activate Divine Storm][Word of Glory to automatically activate Light of Dawn] with {$s2=25}% increased effectiveness. This effect can only occur every {$387441d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Empyrean Legacy (_cooldown)13.40.023.1s23.1s19.4s86.80%78.11%0.0 (0.0)12.6

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_empyrean_legacy_cooldown
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 42.1s
  • trigger_min/max:20.0s / 42.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:77.23% / 93.96%

Stack Uptimes

  • empyrean_legacy_cooldown_1:86.80%

Spelldata

  • id:387441
  • name:Empyrean Legacy
  • tooltip:Cannot benefit from Empyrean Legacy.
  • description:{$@spelldesc387170=Judgment empowers your next {$?=}c3[Single target Holy Power ability to automatically activate Divine Storm][Word of Glory to automatically activate Light of Dawn] with {$s2=25}% increased effectiveness. This effect can only occur every {$387441d=20 seconds}.}
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Final Verdict12.21.523.3s20.5s3.6s14.58%9.01%1.5 (1.5)0.3

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_final_verdict
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 237.2s
  • trigger_min/max:0.8s / 237.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.8s
  • uptime_min/max:0.28% / 38.25%

Stack Uptimes

  • final_verdict_1:14.58%

Spelldata

  • id:337228
  • name:Final Verdict
  • tooltip:Hammer of Wrath can be used on any target.
  • description:{$@spelldesc336872=Unleashes a powerful weapon strike that deals {$s1=0} Holy damage to an enemy target. Has a {$s2=15}% chance to activate Hammer of Wrath and reset its cooldown.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of Alchemical Chaos (Crit)2.10.6111.8s76.9s35.3s25.17%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 350.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 81.24%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.17%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6111.5s76.5s35.2s24.90%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 349.3s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 80.39%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.90%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6112.1s77.0s35.2s24.81%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 355.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 81.21%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.81%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.5s76.4s35.4s25.12%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 347.2s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 220.6s
  • uptime_min/max:0.00% / 80.37%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.12%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance (hammer_of_light_free)7.50.037.6s37.6s1.6s4.09%2.20%0.0 (0.0)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_hammer_of_light_free
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • hammer_of_light_free_1:4.09%

Spelldata

  • id:433732
  • name:Light's Deliverance
  • tooltip:
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=false}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hammer of Light (_ready)9.80.031.9s31.9s1.2s3.93%11.27%0.0 (0.0)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_hammer_of_light_ready
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.0s / 45.3s
  • trigger_min/max:30.0s / 45.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.1s
  • uptime_min/max:3.33% / 4.48%

Stack Uptimes

  • hammer_of_light_ready_1:3.93%

Spelldata

  • id:427453
  • name:Hammer of Light
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$429826s1=0} Holy damage and {$=}{{$429826s1=0}/2} Holy damage up to 4 nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Keen Prowess5.71.548.2s36.7s13.8s26.33%0.00%1.5 (1.5)5.5

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_keen_prowess
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3910.00

Trigger Details

  • interval_min/max:15.6s / 163.0s
  • trigger_min/max:5.1s / 147.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 74.9s
  • uptime_min/max:8.04% / 56.93%

Stack Uptimes

  • keen_prowess_1:26.33%

Spelldata

  • id:449091
  • name:Keen Prowess
  • tooltip:Your mind is sharpened, granting {$=}w1 Critical Strike rating.
  • description:{$@spelldesc445379=|cnNORMAL_FONT_COLOR:Earthen Enhancements - Wondrous Weapons|R Permanently enchants a weapon to sometimes grant you Keen Prowess, bestowing {$=}ec1s1 Critical Strike to you for {$449091d=12 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance8.5394.037.1s0.7s34.3s97.18%0.00%0.2 (0.2)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_lights_deliverance
  • max_stacks:50
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:28.4s / 58.7s
  • trigger_min/max:0.0s / 9.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.7s
  • uptime_min/max:94.33% / 98.63%

Stack Uptimes

  • lights_deliverance_1:1.48%
  • lights_deliverance_2:1.62%
  • lights_deliverance_3:0.99%
  • lights_deliverance_4:0.86%
  • lights_deliverance_5:1.04%
  • lights_deliverance_6:0.99%
  • lights_deliverance_7:0.85%
  • lights_deliverance_8:1.85%
  • lights_deliverance_9:1.80%
  • lights_deliverance_10:1.81%
  • lights_deliverance_11:2.39%
  • lights_deliverance_12:2.03%
  • lights_deliverance_13:1.94%
  • lights_deliverance_14:2.32%
  • lights_deliverance_15:2.06%
  • lights_deliverance_16:2.01%
  • lights_deliverance_17:2.38%
  • lights_deliverance_18:2.10%
  • lights_deliverance_19:2.10%
  • lights_deliverance_20:2.43%
  • lights_deliverance_21:2.14%
  • lights_deliverance_22:2.14%
  • lights_deliverance_23:2.37%
  • lights_deliverance_24:2.13%
  • lights_deliverance_25:2.11%
  • lights_deliverance_26:2.29%
  • lights_deliverance_27:2.15%
  • lights_deliverance_28:2.12%
  • lights_deliverance_29:2.29%
  • lights_deliverance_30:2.20%
  • lights_deliverance_31:2.12%
  • lights_deliverance_32:2.22%
  • lights_deliverance_33:2.21%
  • lights_deliverance_34:2.11%
  • lights_deliverance_35:2.17%
  • lights_deliverance_36:2.19%
  • lights_deliverance_37:2.14%
  • lights_deliverance_38:2.08%
  • lights_deliverance_39:2.14%
  • lights_deliverance_40:2.11%
  • lights_deliverance_41:2.10%
  • lights_deliverance_42:2.08%
  • lights_deliverance_43:2.14%
  • lights_deliverance_44:2.04%
  • lights_deliverance_45:2.03%
  • lights_deliverance_46:2.04%
  • lights_deliverance_47:2.02%
  • lights_deliverance_48:2.05%
  • lights_deliverance_49:2.04%
  • lights_deliverance_50:0.15%

Spelldata

  • id:433674
  • name:Light's Deliverance
  • tooltip:{$?=}{$=}W1=={$=}U[Ready to deliver Light's justice.][Building up Light's Deliverance. At {$u=60} stacks, your next Hammer of Light cast will activate another Hammer of Light for free.]
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=false}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:60
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Quickwick's Quick Trick Wick Walk2.90.0126.2s126.2s19.4s18.94%0.00%0.0 (0.0)2.7

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_quickwicks_quick_trick_wick_walk
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Quickwick Candlestick

Stat Details

  • stat:haste_rating
  • amount:6217.41

Trigger Details

  • interval_min/max:120.0s / 141.6s
  • trigger_min/max:120.0s / 141.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:15.54% / 22.56%

Stack Uptimes

  • quickwicks_quick_trick_wick_walk_1:18.94%

Spelldata

  • id:455451
  • name:Quickwick's Quick Trick Wick Walk
  • tooltip:Increased movement speed and haste.
  • description:{$@=}class be nimble, {$@=}class be quick. {$@=}class invoke the power of the candlestick to increase movement speed by {$s1=20}% and Haste by {$s2=9192} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Rush of Light10.920.127.6s9.5s18.2s66.28%64.60%20.1 (20.1)10.2

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_rush_of_light
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 140.2s
  • trigger_min/max:0.8s / 117.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 138.7s
  • uptime_min/max:26.64% / 93.39%

Stack Uptimes

  • rush_of_light_1:66.28%

Spelldata

  • id:407065
  • name:Rush of Light
  • tooltip:Haste increased by {$s1=5}%.
  • description:{$@spelldesc407067=The critical strikes of your damaging single target Holy Power abilities grant you {$s1=5}% Haste for {$407065d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sacrosanct Crusade12.314.825.2s11.0s12.7s52.03%54.80%14.8 (14.8)11.7

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_sacrosanct_crusade
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.0s / 50.1s
  • trigger_min/max:0.8s / 42.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.4s
  • uptime_min/max:43.92% / 59.45%

Stack Uptimes

  • sacrosanct_crusade_1:52.03%

Spelldata

  • id:461867
  • name:Sacrosanct Crusade
  • tooltip:Absorbs {$=}w1 damage.
  • description:{$@spelldesc431730={$?a137028=false}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=false}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=false}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=false}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sanctification61.40.0120.7s4.9s185.9s99.34%99.55%0.0 (0.0)0.6

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_sanctification
  • max_stacks:20
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 358.7s
  • trigger_min/max:0.0s / 25.1s
  • trigger_pct:99.87%
  • duration_min/max:0.0s / 358.9s
  • uptime_min/max:93.89% / 99.71%

Stack Uptimes

  • sanctification_1:20.86%
  • sanctification_2:40.49%
  • sanctification_3:18.89%
  • sanctification_4:13.27%
  • sanctification_5:5.24%
  • sanctification_6:0.58%
  • sanctification_7:0.02%

Spelldata

  • id:433671
  • name:Sanctification
  • tooltip:Empyrean Hammer damage increased by {$=}w1%
  • description:{$@spelldesc432977=Casting Judgment increases the damage of Empyrean Hammer by {$433671s1=10}% for {$433671d=10 seconds}. Multiple applications may overlap.}
  • max_stacks:20
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Shadow-Binding Ritual Knife (Crit)0.60.0101.5s94.0s9.9s2.13%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_shadowbinding_ritual_knife_Crit
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:-3588.75

Trigger Details

  • interval_min/max:10.0s / 317.3s
  • trigger_min/max:0.8s / 317.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.9s
  • uptime_min/max:0.00% / 22.39%

Stack Uptimes

  • shadowbinding_ritual_knife_Crit_1:2.13%

Spelldata

  • id:440389
  • name:Shadow-Binding Ritual Knife
  • tooltip:{$?=}{$=}w2!=0[Haste decreased by {$=}w2. ][]{$?=}{$=}w3!=0[Critical Strike decreased by {$=}w3.][]{$?=}{$=}w4!=0[Versatility decreased by {$=}w4.][]{$?=}{$=}w5!=0[Mastery decreased by {$=}w5.][]
  • description:{$@spelldesc435502=Engrave a ritual seal into your skin binding you to the shadows, granting yourself {$s1=2182} {$=}pri. Your spells and abilities have a low chance to reduce one of your secondary stats by {$s2=5306} for {$440389d=10 seconds} during combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow-Binding Ritual Knife (Haste)0.70.099.7s93.4s9.9s2.15%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_shadowbinding_ritual_knife_Haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:-3588.75

Trigger Details

  • interval_min/max:10.0s / 347.6s
  • trigger_min/max:0.8s / 347.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.8s
  • uptime_min/max:0.00% / 16.54%

Stack Uptimes

  • shadowbinding_ritual_knife_Haste_1:2.15%

Spelldata

  • id:440389
  • name:Shadow-Binding Ritual Knife
  • tooltip:{$?=}{$=}w2!=0[Haste decreased by {$=}w2. ][]{$?=}{$=}w3!=0[Critical Strike decreased by {$=}w3.][]{$?=}{$=}w4!=0[Versatility decreased by {$=}w4.][]{$?=}{$=}w5!=0[Mastery decreased by {$=}w5.][]
  • description:{$@spelldesc435502=Engrave a ritual seal into your skin binding you to the shadows, granting yourself {$s1=2182} {$=}pri. Your spells and abilities have a low chance to reduce one of your secondary stats by {$s2=5306} for {$440389d=10 seconds} during combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow-Binding Ritual Knife (Mastery)0.60.0104.2s95.8s9.9s2.10%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_shadowbinding_ritual_knife_Mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:-3588.75

Trigger Details

  • interval_min/max:10.0s / 347.5s
  • trigger_min/max:0.3s / 347.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.1s
  • uptime_min/max:0.00% / 17.74%

Stack Uptimes

  • shadowbinding_ritual_knife_Mastery_1:2.11%

Spelldata

  • id:440389
  • name:Shadow-Binding Ritual Knife
  • tooltip:{$?=}{$=}w2!=0[Haste decreased by {$=}w2. ][]{$?=}{$=}w3!=0[Critical Strike decreased by {$=}w3.][]{$?=}{$=}w4!=0[Versatility decreased by {$=}w4.][]{$?=}{$=}w5!=0[Mastery decreased by {$=}w5.][]
  • description:{$@spelldesc435502=Engrave a ritual seal into your skin binding you to the shadows, granting yourself {$s1=2182} {$=}pri. Your spells and abilities have a low chance to reduce one of your secondary stats by {$s2=5306} for {$440389d=10 seconds} during combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow-Binding Ritual Knife (Vers)0.60.0103.0s95.6s9.9s2.09%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_shadowbinding_ritual_knife_Vers
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:-3588.75

Trigger Details

  • interval_min/max:10.0s / 315.9s
  • trigger_min/max:0.8s / 315.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.2s
  • uptime_min/max:0.00% / 15.95%

Stack Uptimes

  • shadowbinding_ritual_knife_Vers_1:2.09%

Spelldata

  • id:440389
  • name:Shadow-Binding Ritual Knife
  • tooltip:{$?=}{$=}w2!=0[Haste decreased by {$=}w2. ][]{$?=}{$=}w3!=0[Critical Strike decreased by {$=}w3.][]{$?=}{$=}w4!=0[Versatility decreased by {$=}w4.][]{$?=}{$=}w5!=0[Mastery decreased by {$=}w5.][]
  • description:{$@spelldesc435502=Engrave a ritual seal into your skin binding you to the shadows, granting yourself {$s1=2182} {$=}pri. Your spells and abilities have a low chance to reduce one of your secondary stats by {$s2=5306} for {$440389d=10 seconds} during combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Shake the Heavens4.312.967.4s67.4s66.5s94.84%95.49%153.1 (140.2)3.3

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_shake_the_heavens
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • shake_the_heavens_1:94.84%

Spelldata

  • id:431536
  • name:Shake the Heavens
  • tooltip:Casting Empyrean Hammer on a nearby target every $t sec.
  • description:{$@spelldesc431533=After casting Hammer of Light, you call down an Empyrean Hammer on a nearby target every {$431536=}T sec, for {$431536d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Shield of Vengeance4.94.964.6s27.5s10.0s16.36%0.00%4.9 (4.9)4.9

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:63.0s / 75.9s
  • trigger_min/max:0.0s / 75.9s
  • trigger_pct:100.00%
  • duration_min/max:10.0s / 10.0s
  • uptime_min/max:13.90% / 18.69%

Stack Uptimes

  • shield_of_vengeance_1:16.36%

Spelldata

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs {$=}w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Tempered Potion1.50.0301.9s301.9s27.4s13.23%0.00%0.0 (0.0)1.2

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 319.6s
  • trigger_min/max:300.0s / 319.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.87% / 18.03%

Stack Uptimes

  • tempered_potion_1:13.23%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Undisputed Ruling13.34.023.1s17.6s9.1s40.31%44.25%4.0 (4.0)12.8

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_undisputed_ruling
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • undisputed_ruling_1:40.31%

Spelldata

  • id:432629
  • name:Undisputed Ruling
  • tooltip:Haste increased by {$=}w1%
  • description:{$@spelldesc432626=Hammer of Light applies Judgment to its targets, and increases your Haste by {$432629s1=12}% for {$432629d=6 seconds}.{$?a137028=false}[ Additionally, Eye of Tyr grants {$s2=3} Holy Power.][]}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow-Binding Ritual Knife (_primary)

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_shadowbinding_ritual_knife_primary
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:3318.75

Spelldata

  • id:435502
  • name:Shadow-Binding Ritual Knife
  • tooltip:
  • description:Engrave a ritual seal into your skin binding you to the shadows, granting yourself {$s1=2182} {$=}pri. Your spells and abilities have a low chance to reduce one of your secondary stats by {$s2=5306} for {$440389d=10 seconds} during combat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
The Sushi Special

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_the_sushi_special
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:470.00

Spelldata

  • id:461957
  • name:Well Fed
  • tooltip:Mastery increased by {$=}w9.
  • description:Increases Mastery by {$s1=0} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Art of War38.218.066.07.7s1.0s108.2s
Divine Purpose10.90.027.024.9s0.8s292.4s
Uptime Avg % Min Max Avg Dur Min Max
Holy Power Cap16.09%9.23%25.66%1.1s0.0s7.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
(blade_of_justice_) Consecration0.0190.0007.9950.4380.0009.208
Shield of Vengeance1.2580.00012.9148.3350.00039.857
Execution Sentence1.7790.00317.48419.7974.10643.410
Blade of Justice0.3870.00013.35025.2751.51669.341
Wake of Ashes1.9680.00015.34919.4114.86138.151
Divine Toll1.6890.00017.7549.0951.05729.520
Hammer of Wrath2.8110.000194.54854.5938.444220.811
Judgment1.1730.00026.57648.07620.73987.091

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Vauquelin
Blade of JusticeHoly Power64.2464.2121.75%1.000.030.04%
Crusading StrikesHoly Power83.4372.5824.59%0.8710.8413.00%
Hammer of WrathHoly Power19.3419.336.55%1.000.010.06%
JudgmentHoly Power61.46116.2539.38%1.896.675.43%
Wake of AshesHoly Power9.8322.857.74%2.326.6522.56%
Usage Type Count Total Tot% Avg RPE APR
Vauquelin
Final VerdictHoly Power91.78246.9784.46%2.692.69183,505.06
Hammer of LightHoly Power17.2745.4515.54%2.632.63729,338.90
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Holy Power0.00.980.9724.22.80.05.0

Statistics & Data Analysis

Fight Length
Vauquelin Fight Length
Count 9999
Mean 299.98
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Vauquelin Damage Per Second
Count 9999
Mean 992548.15
Minimum 877086.38
Maximum 1112709.59
Spread ( max - min ) 235623.22
Range [ ( max - min ) / 2 * 100% ] 11.87%
Standard Deviation 30069.4843
5th Percentile 943871.20
95th Percentile 1042405.62
( 95th Percentile - 5th Percentile ) 98534.42
Mean Distribution
Standard Deviation 300.7099
95.00% Confidence Interval ( 991958.77 - 993137.53 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3526
0.1 Scale Factor Error with Delta=300 7718549
0.05 Scale Factor Error with Delta=300 30874194
0.01 Scale Factor Error with Delta=300 771854834
Priority Target DPS
Vauquelin Priority Target Damage Per Second
Count 9999
Mean 992548.15
Minimum 877086.38
Maximum 1112709.59
Spread ( max - min ) 235623.22
Range [ ( max - min ) / 2 * 100% ] 11.87%
Standard Deviation 30069.4843
5th Percentile 943871.20
95th Percentile 1042405.62
( 95th Percentile - 5th Percentile ) 98534.42
Mean Distribution
Standard Deviation 300.7099
95.00% Confidence Interval ( 991958.77 - 993137.53 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3526
0.1 Scale Factor Error with Delta=300 7718549
0.05 Scale Factor Error with Delta=300 30874194
0.01 Scale Factor Error with Delta=300 771854834
DPS(e)
Vauquelin Damage Per Second (Effective)
Count 9999
Mean 992548.15
Minimum 877086.38
Maximum 1112709.59
Spread ( max - min ) 235623.22
Range [ ( max - min ) / 2 * 100% ] 11.87%
Damage
Vauquelin Damage
Count 9999
Mean 297682020.73
Minimum 220542908.55
Maximum 383441429.48
Spread ( max - min ) 162898520.93
Range [ ( max - min ) / 2 * 100% ] 27.36%
DTPS
Vauquelin Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Vauquelin Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Vauquelin Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Vauquelin Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Vauquelin Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 shield_of_vengeance
5 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
6 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
7 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%cooldown.crusade.duration=0|cooldown.crusade.duration%%trinket.1.cooldown.duration=0|trinket.1.cooldown.duration%%cooldown.avenging_wrath.duration=0|cooldown.avenging_wrath.duration%%trinket.1.cooldown.duration=0)
8 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%cooldown.crusade.duration=0|cooldown.crusade.duration%%trinket.2.cooldown.duration=0|trinket.2.cooldown.duration%%cooldown.avenging_wrath.duration=0|cooldown.avenging_wrath.duration%%trinket.2.cooldown.duration=0)
9 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 auto_attack
0.00 rebuke
B 0.00 call_action_list,name=cooldowns
C 0.00 call_action_list,name=generators
actions.cooldowns
# count action,conditions
D 1.47 potion,if=buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up|fight_remains<30
0.00 invoke_external_buff,name=power_infusion,if=buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up
0.00 lights_judgment,if=spell_targets.lights_judgment>=2|!raid_event.adds.exists|raid_event.adds.in>75|raid_event.adds.up
0.00 fireblood,if=buff.avenging_wrath.up|buff.crusade.up&buff.crusade.stack=10|debuff.execution_sentence.up
0.00 use_item,slot=trinket1,if=((buff.avenging_wrath.up&cooldown.avenging_wrath.remains>40|buff.crusade.up&buff.crusade.stack=10)&!talent.radiant_glory|talent.radiant_glory&(!talent.execution_sentence&cooldown.wake_of_ashes.remains=0|debuff.execution_sentence.up))&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
E 2.92 use_item,slot=trinket2,if=((buff.avenging_wrath.up&cooldown.avenging_wrath.remains>40|buff.crusade.up&buff.crusade.stack=10)&!talent.radiant_glory|talent.radiant_glory&(!talent.execution_sentence&cooldown.wake_of_ashes.remains=0|debuff.execution_sentence.up))&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!buff.crusade.up&cooldown.crusade.remains>20|!buff.avenging_wrath.up&cooldown.avenging_wrath.remains>20)
0.00 use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!buff.crusade.up&cooldown.crusade.remains>20|!buff.avenging_wrath.up&cooldown.avenging_wrath.remains>20)
F 3.91 shield_of_vengeance,if=fight_remains>15&(!talent.execution_sentence|!debuff.execution_sentence.up)
G 9.50 execution_sentence,if=(!buff.crusade.up&cooldown.crusade.remains>15|buff.crusade.stack=10|cooldown.avenging_wrath.remains<0.75|cooldown.avenging_wrath.remains>15|talent.radiant_glory)&(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(target.time_to_die>8&!talent.executioners_will|target.time_to_die>12)&cooldown.wake_of_ashes.remains<gcd
0.00 avenging_wrath,if=(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&talent.divine_auxiliary&(cooldown.execution_sentence.remains=0|cooldown.final_reckoning.remains=0))&(!raid_event.adds.up|target.time_to_die>10)
0.00 crusade,if=holy_power>=5&time<5|holy_power>=3&time>5
0.00 final_reckoning,if=(holy_power>=4&time<8|holy_power>=3&time>=8|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(cooldown.avenging_wrath.remains>10|cooldown.crusade.remains&(!buff.crusade.up|buff.crusade.stack>=10)|talent.radiant_glory&(buff.avenging_wrath.up|talent.crusade&cooldown.wake_of_ashes.remains<gcd))&(!raid_event.adds.exists|raid_event.adds.up|raid_event.adds.in>40)
actions.finishers
# count action,conditions
0.00 variable,name=ds_castable,value=(spell_targets.divine_storm>=2|buff.empyrean_power.up|!talent.final_verdict&talent.tempest_of_the_lightbringer)&!buff.empyrean_legacy.up&!(buff.divine_arbiter.up&buff.divine_arbiter.stack>24)
H 17.27 hammer_of_light
0.00 divine_hammer,if=holy_power=5
0.00 divine_storm,if=variable.ds_castable&!buff.hammer_of_light_ready.up&(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
0.00 justicars_vengeance,if=(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
I 91.78 templars_verdict,if=(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
actions.generators
# count action,conditions
J 0.00 call_action_list,name=finishers,if=holy_power=5|holy_power=4&buff.divine_resonance.up
0.00 templar_slash,if=buff.templar_strikes.remains<gcd*2
K 6.75 blade_of_justice,if=!dot.expurgation.ticking&talent.holy_flames
L 9.83 wake_of_ashes,if=(!talent.lights_guidance|holy_power>=2&talent.lights_guidance)&(cooldown.avenging_wrath.remains>6|cooldown.crusade.remains>6|talent.radiant_glory)&(!talent.execution_sentence|cooldown.execution_sentence.remains>4|target.time_to_die<8)&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)
M 5.34 divine_toll,if=holy_power<=2&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)&(cooldown.avenging_wrath.remains>15|cooldown.crusade.remains>15|talent.radiant_glory|fight_remains<8)
N 0.00 call_action_list,name=finishers,if=holy_power>=3&buff.crusade.up&buff.crusade.stack<10
0.00 templar_slash,if=buff.templar_strikes.remains<gcd&spell_targets.divine_storm>=2
0.00 blade_of_justice,if=(holy_power<=3|!talent.holy_blade)&(spell_targets.divine_storm>=2&talent.blade_of_vengeance)
O 12.09 hammer_of_wrath,if=(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)&(target.health.pct<35&talent.vengeful_wrath|buff.blessing_of_anshe.up)
0.00 templar_strike
P 40.59 judgment,if=holy_power<=3|!talent.boundless_judgment
Q 57.49 blade_of_justice,if=holy_power<=3|!talent.holy_blade
R 7.26 hammer_of_wrath,if=(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)
0.00 templar_slash
S 0.00 call_action_list,name=finishers,if=(target.health.pct<=20|buff.avenging_wrath.up|buff.crusade.up|buff.empyrean_power.up)
0.00 crusader_strike,if=cooldown.crusader_strike.charges_fractional>=1.75&(holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2)
T 0.00 call_action_list,name=finishers
0.00 hammer_of_wrath,if=holy_power<=3|target.health.pct>20|!talent.vanguards_momentum
0.00 crusader_strike
0.00 arcane_torrent

Sample Sequence

012456789AKMGDELHPQIQIPQIQIPIQQIIPIIQQIPRIQIQPIQRIGLHPIQHQIPQIPIQRIRIPIQPIFGLHKMIPIQRIQPHIIQQIPIQRIQPIIGLHPKIQQIPIRQIPIQHIIPQIGELHMIKPIRIQIPFIIPKIIHPIQGLHPIQQIQPRIRQIPIQQRIPIQQGLHMPHIQIQIIIOPIFQIIOPIQIIOPIQGLHPQHIQIPQIQPIQIIOIPQIOGELHMOIPIKHIOPIQIOFIOPIQQIOIPIOGKLHOPIQQIOPIHOQIPI

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0flask
[precombat]
Vauquelin 0.0/5 0% HoPo
Pre1food
[precombat]
Vauquelin 0.0/5 0% HoPo
Pre2augmentation
[precombat]
Vauquelin 0.0/5 0% HoPo
Pre4shield_of_vengeance
[precombat]
Vauquelin 0.0/5 0% HoPo
Pre5trinket_1_buffs
[precombat]
Vauquelin 0.0/5 0% HoPo shield_of_vengeance
Pre6trinket_2_buffs
[precombat]
Vauquelin 0.0/5 0% HoPo shield_of_vengeance
Pre7trinket_1_sync
[precombat]
Vauquelin 0.0/5 0% HoPo shield_of_vengeance
Pre8trinket_2_sync
[precombat]
Vauquelin 0.0/5 0% HoPo shield_of_vengeance
Pre9trinket_priority
[precombat]
Vauquelin 0.0/5 0% HoPo shield_of_vengeance
0:00.000Aauto_attack
[default]
Fluffy_Pillow 0.0/5 0% HoPo shield_of_vengeance
0:00.000Kblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, shield_of_vengeance
0:01.063Mdivine_toll
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, shield_of_vengeance
0:02.127Gexecution_sentence
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, divine_arbiter(2), empyrean_legacy, empyrean_legacy_cooldown, shield_of_vengeance, divine_resonance, sanctification
0:02.880Dpotion
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, divine_arbiter(2), empyrean_legacy, empyrean_legacy_cooldown, shield_of_vengeance, divine_resonance, sanctification
0:02.880Euse_item_quickwick_candlestick
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, divine_arbiter(2), empyrean_legacy, empyrean_legacy_cooldown, shield_of_vengeance, divine_resonance, sanctification, tempered_potion
0:02.880Lwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, divine_arbiter(2), empyrean_legacy, empyrean_legacy_cooldown, shield_of_vengeance, divine_resonance, sanctification, quickwicks_quick_trick_wick_walk, tempered_potion
0:03.824Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade, divine_arbiter(3), empyrean_legacy, empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, divine_resonance, hammer_of_light_ready, sanctification, sacrosanct_crusade, quickwicks_quick_trick_wick_walk, tempered_potion
0:04.742Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, crusade(6), divine_arbiter(3), empyrean_legacy, empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(3), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:05.497Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(6), divine_arbiter(5), empyrean_legacy, empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(5), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:06.252Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade(6), divine_arbiter(8), empyrean_legacy, empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(6), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:07.007Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(9), divine_arbiter(9), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:07.762Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(9), divine_arbiter(10), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:08.516Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(12), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(11), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:09.404Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(15), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(11), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:10.160Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(15), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(12), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:10.917Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(17), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(14), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:11.671Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(20), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(14), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:12.426Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(22), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(17), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:13.180Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(24), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(17), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:13.937Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, divine_purpose, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(19), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:14.690Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, divine_purpose, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(20), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:15.443Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, divine_purpose, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(20), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:16.198Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(3), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(6), lights_deliverance(23), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:16.950Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(4), empyrean_legacy_cooldown, divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification(5), lights_deliverance(23), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:17.704Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade(10), rush_of_light, divine_arbiter(7), empyrean_legacy_cooldown, divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification(6), lights_deliverance(23), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:18.459Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, divine_arbiter(9), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(5), lights_deliverance(26), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:19.361Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, divine_arbiter(10), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(5), lights_deliverance(26), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:20.262Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, divine_arbiter(11), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(5), lights_deliverance(27), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:21.165Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, divine_arbiter(11), blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(4), lights_deliverance(27), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:22.066Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, divine_arbiter(13), blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(4), lights_deliverance(30), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers, tempered_potion
0:22.967Rhammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, divine_arbiter(15), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(5), lights_deliverance(30), flask_of_alchemical_chaos_vers, tempered_potion
0:23.945Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, divine_arbiter(18), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(30), flask_of_alchemical_chaos_vers, tempered_potion
0:24.923Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade, rush_of_light, divine_arbiter(20), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(33), flask_of_alchemical_chaos_vers, tempered_potion
0:25.872Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade, rush_of_light, divine_arbiter(20), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(33), flask_of_alchemical_chaos_vers, tempered_potion
0:26.821Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(4), rush_of_light, divine_arbiter(22), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(36), flask_of_alchemical_chaos_vers, tempered_potion
0:27.697Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(4), rush_of_light, divine_arbiter(22), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(36), flask_of_alchemical_chaos_vers, tempered_potion
0:28.570Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, crusade(4), rush_of_light, divine_arbiter(24), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(37), flask_of_alchemical_chaos_vers, tempered_potion
0:29.444Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(39), flask_of_alchemical_chaos_vers, tempered_potion
0:30.421Rhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(40), flask_of_alchemical_chaos_vers, tempered_potion
0:31.399Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(40), flask_of_alchemical_chaos_vers, tempered_potion
0:32.375 Waiting0.200s 1.0/5 20% HoPo bloodlust, rush_of_light, divine_arbiter, empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(43), flask_of_alchemical_chaos_vers, tempered_potion
0:32.575Gexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, divine_arbiter(2), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(43), flask_of_alchemical_chaos_vers, tempered_potion
0:33.331Lwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, divine_arbiter(2), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(43), flask_of_alchemical_chaos_vers
0:34.344Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade, rush_of_light, divine_arbiter(3), empyrean_legacy_cooldown, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(44), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:35.279Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, crusade(6), rush_of_light, divine_arbiter(3), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(47), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:36.033Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(6), rush_of_light, divine_arbiter(5), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(49), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:36.788Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, crusade(9), rush_of_light, divine_arbiter(7), empyrean_legacy_cooldown, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(2), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:37.542Hhammer_of_light
[finishers]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(9), rush_of_light, divine_arbiter(7), empyrean_legacy_cooldown, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(2), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:38.295 Waiting0.621s 2.0/5 40% HoPo bloodlust, crusade(9), rush_of_light, divine_arbiter(8), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(6), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:38.916Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(9), rush_of_light, divine_arbiter(9), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(8), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:39.668Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(9), rush_of_light, divine_arbiter(9), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(8), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:40.423Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), rush_of_light, divine_arbiter(11), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(11), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:41.260Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), rush_of_light, divine_arbiter(13), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(11), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:42.098Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), rush_of_light, divine_arbiter(14), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(12), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:42.936 Waiting2.257s 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(16), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:45.193Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(17), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(15), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:46.261Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), rush_of_light, divine_arbiter(19), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(16), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:47.223Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(20), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(3), lights_deliverance(18), sacrosanct_crusade, flask_of_alchemical_chaos_haste
0:48.185Rhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), rush_of_light, divine_arbiter(21), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(19), flask_of_alchemical_chaos_haste
0:49.148Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, divine_arbiter(22), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(19), flask_of_alchemical_chaos_haste
0:50.398Rhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(24), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(22), flask_of_alchemical_chaos_haste
0:51.648Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(22), flask_of_alchemical_chaos_haste
0:52.896Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rush_of_light, divine_arbiter, empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(25), flask_of_alchemical_chaos_haste
0:54.146Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(4), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(26), flask_of_alchemical_chaos_haste
0:55.395Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rush_of_light, divine_arbiter(5), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(28), flask_of_alchemical_chaos_haste
0:56.853 Waiting3.398s 1.0/5 20% HoPo rush_of_light, divine_arbiter(6), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(29), flask_of_alchemical_chaos_haste
1:00.251Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(8), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(31), flask_of_alchemical_chaos_haste
1:01.744Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo divine_arbiter(9), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(31), flask_of_alchemical_chaos_haste
1:03.057Fshield_of_vengeance
[cooldowns]
Vauquelin 2.0/5 40% HoPo rush_of_light, divine_arbiter(11), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(34), flask_of_alchemical_chaos_haste
1:03.810Gexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(11), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(34), flask_of_alchemical_chaos_haste
1:04.566Lwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(12), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, sanctification(2), lights_deliverance(36), flask_of_alchemical_chaos_haste
1:05.817Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, rush_of_light, divine_arbiter(12), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance(36), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:07.029Kblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(6), rush_of_light, divine_arbiter(13), shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(40), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:07.951Mdivine_toll
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(6), rush_of_light, divine_arbiter(14), shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(41), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:08.876Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(6), rush_of_light, divine_arbiter(15), empyrean_legacy, empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(42), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:09.800Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), rush_of_light, divine_arbiter(17), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(44), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:10.657Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(9), rush_of_light, divine_arbiter(18), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(45), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:11.516Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), rush_of_light, divine_arbiter(20), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(47), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:12.353Rhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), divine_arbiter(21), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(48), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:13.234Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), divine_arbiter(23), empyrean_legacy_cooldown, blessing_of_dawn(2), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(48), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:14.115Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, divine_resonance, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(3), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:14.995Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, divine_resonance, hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance, sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:16.111Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, hammer_of_light_free, shake_the_heavens, sanctification(4), lights_deliverance, flask_of_alchemical_chaos_haste
1:17.121Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(5), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:18.000Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), divine_arbiter(2), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(9), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:18.879Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(4), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(10), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:19.716Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(4), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(10), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:20.804Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, divine_arbiter(5), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(11), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:21.893Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, divine_arbiter(6), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(13), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:22.981Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, divine_arbiter(9), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:24.069Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(11), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(16), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:25.157Rhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(11), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(4), lights_deliverance(17), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:26.407Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, divine_arbiter(14), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(18), flask_of_alchemical_chaos_haste
1:27.656Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(15), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(20), flask_of_alchemical_chaos_haste
1:29.027Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo divine_arbiter(16), blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(21), flask_of_alchemical_chaos_haste
1:30.354Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_arbiter(18), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(22), flask_of_alchemical_chaos_haste
1:31.667Ifinal_verdict
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(19), empyrean_legacy_cooldown, divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(24), flask_of_alchemical_chaos_haste
1:32.978 Waiting0.937s 2.0/5 40% HoPo divine_arbiter(21), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(27), flask_of_alchemical_chaos_haste
1:33.915Gexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(21), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(27), flask_of_alchemical_chaos_haste
1:34.670Lwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(21), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(28), flask_of_alchemical_chaos_crit
1:36.046Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, divine_arbiter(22), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(28), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_crit
1:37.383Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), divine_arbiter(23), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(34), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_crit
1:38.400Kblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(6), divine_arbiter(24), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(35), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_crit
1:39.415Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(6), divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(35), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_crit
1:40.432Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), divine_arbiter(2), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(38), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_crit
1:41.376Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), divine_arbiter(2), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(38), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_crit
1:42.321Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(9), divine_arbiter(3), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(39), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_crit
1:43.262Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), rush_of_light, divine_arbiter(4), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(41), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_crit
1:44.141Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), rush_of_light, divine_arbiter(6), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(42), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_crit
1:45.018Rhammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), rush_of_light, divine_arbiter(8), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(44), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_crit
1:46.028 Waiting1.765s 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(9), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(44), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_crit
1:47.793Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(10), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(45), keen_prowess, flask_of_alchemical_chaos_crit
1:49.042Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), rush_of_light, divine_arbiter(11), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(46), keen_prowess, flask_of_alchemical_chaos_crit
1:50.050Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, divine_arbiter(12), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(48), keen_prowess, flask_of_alchemical_chaos_crit
1:51.362Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(14), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(49), keen_prowess, flask_of_alchemical_chaos_crit
1:52.672Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, divine_arbiter(16), empyrean_legacy_cooldown, blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(2), flask_of_alchemical_chaos_crit
1:53.984Hhammer_of_light
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(16), empyrean_legacy_cooldown, blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(2), flask_of_alchemical_chaos_crit
1:55.295Ifinal_verdict
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(17), empyrean_legacy_cooldown, divine_purpose, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(7), sacrosanct_crusade, flask_of_alchemical_chaos_crit
1:56.494 Waiting0.285s 2.0/5 40% HoPo divine_arbiter(18), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(11), sacrosanct_crusade, flask_of_alchemical_chaos_crit
1:56.779Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo divine_arbiter(19), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(11), sacrosanct_crusade, flask_of_alchemical_chaos_crit
1:57.978Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade, divine_arbiter(20), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(13), sacrosanct_crusade, flask_of_alchemical_chaos_crit
1:59.140Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade, divine_arbiter(22), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:00.304Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade, divine_arbiter(22), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(15), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:01.466 Waiting3.329s 1.0/5 20% HoPo crusade(4), rush_of_light, divine_arbiter(24), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(17), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:04.795Gexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(19), flask_of_alchemical_chaos_vers
2:05.549Euse_item_quickwick_candlestick
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(19), flask_of_alchemical_chaos_vers
2:05.549Lwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(19), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:06.754Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(20), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:07.925Mdivine_toll
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(24), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:08.838Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(6), rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(26), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:09.726Kblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(9), rush_of_light, divine_arbiter, empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(28), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:10.553Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), rush_of_light, divine_arbiter(2), blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(29), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:11.379Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(9), rush_of_light, divine_arbiter(5), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(29), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:12.205Rhammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), rush_of_light, divine_arbiter(6), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(32), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:13.011Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), rush_of_light, divine_arbiter(10), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(32), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:13.820Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), rush_of_light, divine_arbiter(11), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(34), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:14.628Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), rush_of_light, divine_arbiter(12), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(35), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:15.435Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(10), rush_of_light, divine_arbiter(14), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(37), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:16.374 Waiting0.431s 2.0/5 40% HoPo rush_of_light, divine_arbiter(15), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(38), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:16.805Fshield_of_vengeance
[cooldowns]
Vauquelin 2.0/5 40% HoPo rush_of_light, divine_arbiter(15), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(38), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:17.559Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(16), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(38), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:18.764 Waiting2.829s 2.0/5 40% HoPo rush_of_light, divine_arbiter(19), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(41), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:21.593Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo divine_arbiter(21), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(42), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
2:22.859Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo divine_arbiter(22), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(45), quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
2:24.123Kblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo divine_arbiter(25), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification(5), lights_deliverance(46), quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
2:25.388Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_arbiter(25), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(46), quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
2:26.653Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade, rush_of_light, divine_arbiter(2), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(49), keen_prowess, flask_of_alchemical_chaos_vers
2:27.926Hhammer_of_light
[finishers]
Fluffy_Pillow 0.0/5 0% HoPo crusade(4), rush_of_light, divine_arbiter(4), empyrean_legacy_cooldown, blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance, keen_prowess, flask_of_alchemical_chaos_vers
2:29.096 Waiting0.622s 0.0/5 0% HoPo crusade(4), rush_of_light, divine_arbiter(4), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(6), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_vers
2:29.718Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(4), rush_of_light, divine_arbiter(5), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(7), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_vers
2:30.908Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(7), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_vers
2:32.048Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rush_of_light, divine_arbiter(9), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(10), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_vers
2:33.186 Waiting1.622s 1.0/5 20% HoPo rush_of_light, divine_arbiter(9), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(11), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_vers
2:34.808Gexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(12), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:35.563Lwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(11), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(12), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:36.764Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, divine_arbiter(11), blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(13), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:38.103Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(6), divine_arbiter(12), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(18), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:39.125Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(6), divine_arbiter(13), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(19), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:40.144 Waiting0.102s 0.0/5 0% HoPo crusade(9), divine_arbiter(15), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(22), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:40.246Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(9), divine_arbiter(15), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(22), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:41.437Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), divine_arbiter(16), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(22), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:42.384Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), divine_arbiter(16), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(23), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:43.330Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(10), divine_arbiter(18), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(25), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:44.255Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), divine_arbiter(19), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(26), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:45.181Rhammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), divine_arbiter(20), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(26), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:46.245Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_arbiter(23), empyrean_legacy_cooldown, blessing_of_dawn(2), blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(27), sacrosanct_crusade, flask_of_alchemical_chaos_vers
2:47.627Rhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(24), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(29), flask_of_alchemical_chaos_vers
2:49.007Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(30), flask_of_alchemical_chaos_vers
2:50.534Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(31), flask_of_alchemical_chaos_vers
2:51.915Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter, empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(33), flask_of_alchemical_chaos_vers
2:53.346Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_arbiter(3), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(34), flask_of_alchemical_chaos_vers
2:54.727Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(4), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(37), flask_of_alchemical_chaos_vers
2:56.110Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo divine_arbiter(5), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(37), flask_of_alchemical_chaos_vers
2:57.490Rhammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo divine_arbiter(5), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(38), flask_of_alchemical_chaos_vers
2:58.871Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_arbiter(7), blessing_of_dawn(2), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(39), flask_of_alchemical_chaos_vers
3:00.252Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade, divine_arbiter(9), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(42), flask_of_alchemical_chaos_vers
3:01.593Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade, divine_arbiter(10), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(42), flask_of_alchemical_chaos_vers
3:02.935Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(4), divine_arbiter(12), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(45), flask_of_alchemical_chaos_vers
3:04.169Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo divine_arbiter(12), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(46), flask_of_alchemical_chaos_vers
3:05.549Gexecution_sentence
[cooldowns]
Fluffy_Pillow 4.0/5 80% HoPo divine_arbiter(13), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(46), flask_of_alchemical_chaos_haste
3:06.304Lwake_of_ashes
[generators]
Fluffy_Pillow 4.0/5 80% HoPo divine_arbiter(13), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(47), flask_of_alchemical_chaos_haste
3:07.616Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, divine_arbiter(14), empyrean_legacy_cooldown, blessing_of_dawn(2), blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(47), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:08.890Mdivine_toll
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(9), rush_of_light, divine_arbiter(15), empyrean_legacy_cooldown, divine_purpose, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(2), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:09.747Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), rush_of_light, divine_arbiter(16), empyrean_legacy_cooldown, divine_purpose, blessing_of_dusk, divine_resonance, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(3), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:10.605Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(9), rush_of_light, divine_arbiter(18), empyrean_legacy_cooldown, divine_purpose, blessing_of_dawn, blessing_of_dusk, divine_resonance, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(4), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:11.461Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), rush_of_light, divine_arbiter(19), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(7), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:12.297Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(20), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(12), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:13.134Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), rush_of_light, divine_arbiter(21), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(12), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:13.972Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), rush_of_light, divine_arbiter(23), empyrean_legacy_cooldown, divine_purpose, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:14.812Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, divine_purpose, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(15), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:15.650Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), rush_of_light, divine_arbiter(2), empyrean_legacy_cooldown, divine_purpose, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(17), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:16.488Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), rush_of_light, divine_arbiter(3), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(18), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:17.326Ohammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(5), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(20), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:18.163Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), rush_of_light, divine_arbiter(7), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(21), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:19.000Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), rush_of_light, divine_arbiter(11), empyrean_legacy_cooldown, blessing_of_dawn(2), blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(21), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:19.963Fshield_of_vengeance
[cooldowns]
Vauquelin 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(12), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(23), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:20.717Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(13), shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(24), flask_of_alchemical_chaos_haste
3:21.680Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(13), shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(24), flask_of_alchemical_chaos_haste
3:22.928 Waiting1.047s 1.0/5 20% HoPo rush_of_light, divine_arbiter(15), shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(27), flask_of_alchemical_chaos_haste
3:23.975Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(17), empyrean_legacy, empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(27), flask_of_alchemical_chaos_haste
3:25.223Ohammer_of_wrath
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rush_of_light, divine_arbiter(19), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(4), lights_deliverance(30), flask_of_alchemical_chaos_haste
3:26.472Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(21), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(31), flask_of_alchemical_chaos_haste
3:27.720Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, divine_arbiter(23), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(31), flask_of_alchemical_chaos_haste
3:28.971Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(34), flask_of_alchemical_chaos_haste
3:30.219 Waiting0.100s 2.0/5 40% HoPo rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(35), flask_of_alchemical_chaos_haste
3:30.319Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(35), flask_of_alchemical_chaos_haste
3:31.568Ifinal_verdict
[finishers]
Fluffy_Pillow 0.0/5 0% HoPo crusade, rush_of_light, divine_arbiter, empyrean_legacy_cooldown, divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(37), flask_of_alchemical_chaos_haste
3:32.782Ohammer_of_wrath
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(4), rush_of_light, divine_arbiter(3), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(40), flask_of_alchemical_chaos_haste
3:33.898Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(4), rush_of_light, divine_arbiter(4), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(40), flask_of_alchemical_chaos_haste
3:35.014Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(4), rush_of_light, divine_arbiter(7), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(41), flask_of_alchemical_chaos_vers
3:36.190Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, divine_arbiter(8), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(44), flask_of_alchemical_chaos_vers
3:37.506Gexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(9), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(44), flask_of_alchemical_chaos_vers
3:38.262Lwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(9), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(45), flask_of_alchemical_chaos_vers
3:39.643Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, divine_arbiter(10), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(45), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:40.986Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), divine_arbiter(11), empyrean_legacy_cooldown, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance, sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:42.221Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(6), divine_arbiter(12), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(2), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:43.240Hhammer_of_light
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(6), divine_arbiter(13), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(2), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:44.259Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(6), divine_arbiter(14), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(6), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:45.280Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), rush_of_light, divine_arbiter(15), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(10), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:46.184Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), rush_of_light, divine_arbiter(16), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(11), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:47.087Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(10), rush_of_light, divine_arbiter(17), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(13), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:47.968Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(20), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(13), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:48.850Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, divine_arbiter(21), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:49.995 Waiting2.913s 1.0/5 20% HoPo rush_of_light, divine_arbiter(22), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(17), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:52.908Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(24), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(18), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:54.223Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(24), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(19), flask_of_alchemical_chaos_vers
3:55.540Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(19), flask_of_alchemical_chaos_vers
3:56.857Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter, empyrean_legacy_cooldown, divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(22), flask_of_alchemical_chaos_vers
3:58.174Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, divine_arbiter(2), empyrean_legacy_cooldown, divine_purpose, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(23), flask_of_alchemical_chaos_vers
3:59.491Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade, rush_of_light, divine_arbiter(3), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(25), flask_of_alchemical_chaos_vers
4:00.770Ohammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(4), rush_of_light, divine_arbiter(5), empyrean_legacy_cooldown, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(28), flask_of_alchemical_chaos_vers
4:01.946Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(4), rush_of_light, divine_arbiter(8), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(28), flask_of_alchemical_chaos_vers
4:03.123Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(7), rush_of_light, divine_arbiter(9), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(31), flask_of_alchemical_chaos_vers
4:04.211Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(12), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(32), flask_of_alchemical_chaos_vers
4:05.528Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(12), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(32), flask_of_alchemical_chaos_vers
4:06.843Ohammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, divine_arbiter(14), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(35), flask_of_alchemical_chaos_vers
4:08.246Gexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(16), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(36), flask_of_alchemical_chaos_vers
4:09.001Euse_item_quickwick_candlestick
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(16), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(36), flask_of_alchemical_chaos_vers
4:09.001Lwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(16), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(36), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
4:10.210Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, rush_of_light, divine_arbiter(17), blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance(38), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
4:11.387Mdivine_toll
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), rush_of_light, divine_arbiter(17), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(42), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
4:12.278Ohammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(6), rush_of_light, divine_arbiter(19), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(43), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:13.262Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(6), rush_of_light, divine_arbiter(21), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(44), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:14.155Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), rush_of_light, divine_arbiter(22), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(46), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:14.986Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(47), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:15.814Kblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(10), divine_arbiter, empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(49), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:16.665Hhammer_of_light
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), divine_arbiter(4), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(3), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:17.517Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), divine_arbiter(5), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(3), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:18.367Ohammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), rush_of_light, divine_arbiter(6), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(7), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:19.176Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), rush_of_light, divine_arbiter(8), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:19.986Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), rush_of_light, divine_arbiter(9), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(8), sacrosanct_crusade, shadowbinding_ritual_knife_Crit, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:20.795Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(11), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(11), sacrosanct_crusade, shadowbinding_ritual_knife_Crit, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:21.606Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), rush_of_light, divine_arbiter(12), empyrean_legacy_cooldown, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(11), sacrosanct_crusade, shadowbinding_ritual_knife_Crit, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:22.418Ohammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), rush_of_light, divine_arbiter(14), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(13), sacrosanct_crusade, shadowbinding_ritual_knife_Crit, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:23.229Fshield_of_vengeance
[cooldowns]
Vauquelin 4.0/5 80% HoPo crusade(10), rush_of_light, divine_arbiter(17), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(14), sacrosanct_crusade, shadowbinding_ritual_knife_Crit, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:23.983Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), rush_of_light, divine_arbiter(17), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(14), sacrosanct_crusade, shadowbinding_ritual_knife_Crit, quickwicks_quick_trick_wick_walk, keen_prowess, flask_of_alchemical_chaos_vers
4:24.794Ohammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter(19), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(17), sacrosanct_crusade, shadowbinding_ritual_knife_Crit, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
4:25.848Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_arbiter(21), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(17), sacrosanct_crusade, shadowbinding_ritual_knife_Crit, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
4:27.057Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(5), lights_deliverance(18), shadowbinding_ritual_knife_Crit, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
4:28.266Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, divine_arbiter, empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification(5), lights_deliverance(20), shadowbinding_ritual_knife_Crit, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
4:29.476Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, divine_arbiter(2), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(21), flask_of_alchemical_chaos_vers
4:30.793Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, divine_arbiter(2), empyrean_legacy_cooldown, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(22), flask_of_alchemical_chaos_vers
4:32.110Ohammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(4), shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(24), flask_of_alchemical_chaos_vers
4:33.491Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo divine_arbiter(7), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(25), flask_of_alchemical_chaos_vers
4:34.873Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo divine_arbiter(8), blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(28), flask_of_alchemical_chaos_mastery
4:36.254Ifinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo divine_arbiter(11), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(28), flask_of_alchemical_chaos_mastery
4:37.635 Waiting1.185s 0.0/5 0% HoPo divine_arbiter(12), empyrean_legacy_cooldown, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(31), flask_of_alchemical_chaos_mastery
4:38.820Ohammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo divine_arbiter(13), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(32), keen_prowess, flask_of_alchemical_chaos_mastery
4:40.380Gexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(15), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(32), keen_prowess, flask_of_alchemical_chaos_mastery
4:41.135Kblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(15), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(33), keen_prowess, flask_of_alchemical_chaos_mastery
4:42.517Lwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo divine_arbiter(15), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(34), keen_prowess, flask_of_alchemical_chaos_mastery
4:43.898Hhammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, divine_arbiter(16), empyrean_legacy_cooldown, blessing_of_dawn(2), hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(34), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:45.241Ohammer_of_wrath
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), rush_of_light, divine_arbiter(17), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(40), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:46.275Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(6), rush_of_light, divine_arbiter(18), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(40), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:47.245Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(6), rush_of_light, divine_arbiter(21), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(41), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:48.218Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), rush_of_light, divine_arbiter(23), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(43), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:49.121Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), rush_of_light, divine_arbiter(23), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(44), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:50.023Ifinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(9), rush_of_light, divine_arbiter(24), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(44), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:50.927Ohammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(47), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:51.809Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(47), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:52.690Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), rush_of_light, divine_arbiter(25), empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(48), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:53.704Hhammer_of_light
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), rush_of_light, divine_arbiter, empyrean_legacy_cooldown, blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(2), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:54.715 Waiting0.665s 2.0/5 40% HoPo crusade(10), divine_arbiter(2), empyrean_legacy_cooldown, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(4), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:55.380Ohammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), divine_arbiter(2), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(6), sacrosanct_crusade, keen_prowess, flask_of_alchemical_chaos_mastery
4:56.554Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), divine_arbiter(4), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(7), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
4:57.478Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), divine_arbiter(5), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(7), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
4:58.405Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_arbiter(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(9), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
4:59.608Ifinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_arbiter(8), empyrean_legacy, empyrean_legacy_cooldown, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(10), sacrosanct_crusade, flask_of_alchemical_chaos_mastery

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength176470495154871526964 (23548)
Agility61760617661760
Stamina864520284362270821159749
Intellect17647018176176470
Spirit00000
Health568724054164200
Holy Power550
Spell Power18176597720
Crit25.61%24.92%11147
Haste14.67%9.30%6139
Swing Speed60.53%53.02%6139
Versatility14.91%12.29%9585
Attack Power5248349184469
Mastery27.86%25.73%4942
Armor475024750247502
Run Speed70160

Gear

Source Slot Average Item Level: 611.00
Local Head Slag Accruing Mask
ilevel: 606, stats: { 6,075 Armor, +15,291 Sta, +898 Haste, +824 Mastery, +2,790 StrInt }
Local Neck Gem-Studded Pendant of the Peerless (gemstudded_pendant)
ilevel: 606, stats: { +8,601 Sta, +3,379 Crit, +1,352 Mastery }
Local Shoulders Entombed Seraph's Plumes
ilevel: 610, stats: { 5,693 Armor, +12,149 Sta, +901 Vers, +418 Mastery, +2,172 StrInt }
Local Chest Entombed Seraph's Breastplate
ilevel: 610, stats: { 8,281 Armor, +16,198 Sta, +1,225 Haste, +533 Vers, +2,896 StrInt }, enchant: { +520 StrAgiInt (crystalline_radiance_1) }
Local Waist Nether Bounty's Greatbelt
ilevel: 610, stats: { 4,658 Armor, +12,149 Sta, +450 Crit, +869 Haste, +2,172 StrInt }
Local Legs Leggings of Divine Retribution
ilevel: 610, stats: { 7,246 Armor, +16,198 Sta, +728 Haste, +1,030 Vers, +2,896 StrInt }
Local Feet Shattershell Greaves
ilevel: 606, stats: { 5,062 Armor, +11,469 Sta, +434 Crit, +857 Vers, +2,093 StrInt }
Local Wrists Secret-Dredger's Armplates
ilevel: 616, stats: { 4,283 Armor, +9,938 Sta, +532 Crit, +488 Haste, +1,723 StrInt }
Local Hands Secret-Dredger's Gauntlets
ilevel: 610, stats: { 4,658 Armor, +12,149 Sta, +716 Haste, +603 Vers, +2,172 StrInt }
Local Finger1 Ring of Earthen Craftsmanship
ilevel: 619, stats: { +10,359 Sta, +2,641 Crit, +2,641 Vers }, gems: { +141 Haste }, enchant: { +190 Mastery (glimmering_mastery_3) }
Local Finger2 Ceremonial Song Ring
ilevel: 610, stats: { +9,112 Sta, +3,360 Crit, +1,540 Vers }, gems: { +132 Crit, +44 Mastery }, enchant: { +190 Mastery (glimmering_mastery_3) }
Local Trinket1 Shadow-Binding Ritual Knife
ilevel: 616, stats: { +1,295 Mastery }
item effects: { equip: Shadow-Binding Ritual Knife }
Local Trinket2 Quickwick Candlestick
ilevel: 616, stats: { +2,911 StrAgiInt }
item effects: { use: Quickwick's Quick Trick Wick Walk }
Local Back Torchbearer's Greatcloak
ilevel: 616, stats: { 1,546 Armor, +9,938 Sta, +488 Vers, +532 Mastery, +1,723 StrAgiInt }, enchant: { +160 RunSpeed (whisper_of_silken_speed_3) }
Local Main Hand Mountain Shaper's Greataxe
ilevel: 610, weapon: { 5,100 - 10,595, 3.6 }, stats: { +2,896 Str, +16,198 Sta, +954 Haste, +804 Vers }, enchant: councils_guile_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Tabard Dream Wardens Tabard
ilevel: 1

Talents

Talent Tables

Paladin Talents [31]
1
2
3
4
5
6
7
8
9
10
Retribution Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

paladin="Vauquelin"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/vauquelin"
spec=retribution
level=80
race=human
role=attack
position=back
talents=CYEA5ba6OK14IUITjS1kSUVJcBAAAYAAassNzstsNGbjZ22mZDAAAAAAjmmhhZGbzgZbYMLzYbYwMmhlF2AAAIzMtNLz2MAgNgBAjxMMD

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=the_sushi_special
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3

head=slag_accruing_mask,id=223295,bonus_id=10377/10876/10274/3135/10255
neck=gemstudded_pendant,id=224665,bonus_id=6652/1749/10274/3135/10255/10395/10879
shoulders=entombed_seraphs_plumes,id=211991,bonus_id=10265/10369/1511
back=torchbearers_greatcloak,id=211007,bonus_id=10263/6652/10377/1521/10255,enchant=whisper_of_silken_speed_3
chest=entombed_seraphs_breastplate,id=211996,bonus_id=10373/10269/1511/10255,enchant=crystalline_radiance_1
tabard=dream_wardens_tabard,id=210501
wrists=secretdredgers_armplates,id=211036,bonus_id=10263/6652/10877/10377/3195/10255
hands=secretdredgers_gauntlets,id=211032,bonus_id=6652/10377/10269/3189/10255
waist=nether_bountys_greatbelt,id=225589,bonus_id=6652/10877/10376/10354/10269/1511/10255
legs=leggings_of_divine_retribution,id=150493,bonus_id=10265/7756/10376/8902/10045/10255
feet=shattershell_greaves,id=212443,bonus_id=6652/10378/10353/10274/1507/10255
finger1=ring_of_earthen_craftsmanship,id=215135,bonus_id=10421/9633/8902/10395/10879/9627/10222/11143,gems=141haste,enchant=glimmering_mastery_3,crafted_stats=crit/vers
finger2=ceremonial_song_ring,id=219221,bonus_id=6652/10269/3189/10255/10395/10879,gems=132crit_44mastery,enchant=glimmering_mastery_3
trinket1=shadowbinding_ritual_knife,id=215178,bonus_id=10263/6652/3295/10255
trinket2=quickwick_candlestick,id=225649,bonus_id=6652/10263/3145/10255
main_hand=mountain_shapers_greataxe,id=219354,bonus_id=6652/10269/1515/10255,enchant=councils_guile_3

# Gear Summary
# gear_ilvl=611.40
# gear_strength=26964
# gear_stamina=159749
# gear_attack_power=469
# gear_crit_rating=10928
# gear_haste_rating=6019
# gear_mastery_rating=4845
# gear_versatility_rating=9397
# gear_speed_rating=160
# gear_armor=47502
# set_bonus=thewarwithin_season_1_2pc=1

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 41174598
Max Event Queue: 98
Sim Seconds: 3006673
CPU Seconds: 42.9218
Physical Seconds: 16.4330
Speed Up: 70050

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Vauquelin Vauquelin augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Vauquelin Vauquelin blade_of_justice 184575 20924530 69754 12.85 250538 514400 64.2 64.2 28.5% 0.0% 0.0% 0.0% 4.66sec 20924530 299.98sec
Vauquelin Vauquelin blade_of_justice_consecration 26573 0 0 0.00 0 0 22.8 0.0 0.0% 0.0% 0.0% 0.0% 13.49sec 0 299.98sec
Vauquelin Vauquelin blade_of_justice_consecration_tick ticks -81297 3847567 12825 0.00 7650 15707 0.0 0.0 28.5% 0.0% 0.0% 0.0% 0.00sec 3847567 299.98sec
Vauquelin Vauquelin divine_arbiter 406983 7565292 25220 2.66 569491 0 13.3 13.3 0.0% 0.0% 0.0% 0.0% 22.40sec 7565292 299.98sec
Vauquelin Vauquelin divine_storm 53385 5017861 16727 2.68 288251 591576 13.4 13.4 28.6% 0.0% 0.0% 0.0% 22.77sec 5017861 299.98sec
Vauquelin Vauquelin divine_storm_tempest 224239 603889 2013 2.68 34718 71209 13.4 13.4 28.5% 0.0% 0.0% 0.0% 22.77sec 603889 299.98sec
Vauquelin Vauquelin divine_toll 375576 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.88sec 0 299.98sec
Vauquelin Vauquelin divine_toll_judgment 20271 2175044 7251 1.07 314955 644483 5.3 5.3 28.0% 0.0% 0.0% 0.0% 61.88sec 2175044 299.98sec
Vauquelin Vauquelin divine_resonance_judgment 20271 3524385 11749 3.11 173896 358141 15.5 15.5 28.8% 0.0% 0.0% 0.0% 18.72sec 3524385 299.98sec
Vauquelin Vauquelin empyrean_hammer 431398 56895991 189668 80.52 108715 223389 402.6 402.6 28.4% 0.0% 0.0% 0.0% 0.74sec 56895991 299.98sec
Vauquelin Vauquelin execution_sentence 387113 32897674 109667 1.90 3461201 0 9.5 9.5 0.0% 0.0% 0.0% 0.0% 31.75sec 32897674 299.98sec
Vauquelin Vauquelin expurgation ticks -383346 16861568 56205 28.59 90470 186865 64.2 143.0 28.5% 0.0% 0.0% 0.0% 4.66sec 16861568 299.98sec
Vauquelin Vauquelin final_verdict 383328 45320037 151078 18.36 379898 779691 91.8 91.8 28.5% 0.0% 0.0% 0.0% 3.21sec 45320037 299.98sec
Vauquelin Vauquelin flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Vauquelin Vauquelin food 457302 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Vauquelin Vauquelin hammer_of_light 427453 33146609 110497 3.45 1484454 3041021 17.3 17.2 28.1% 0.0% 0.0% 0.0% 17.56sec 33146609 299.98sec
Vauquelin Vauquelin hammer_of_wrath 24275 6711934 22375 3.87 267555 547250 19.3 19.3 28.5% 0.0% 0.0% 0.0% 14.97sec 6711934 299.98sec
Vauquelin Vauquelin highlords_judgment 383921 5878353 19596 6.19 147787 295996 30.9 30.9 28.5% 0.0% 0.0% 0.0% 9.73sec 5878353 299.98sec
Vauquelin Vauquelin judgment 20271 9134016 30449 8.11 173198 355250 40.6 40.6 28.5% 0.0% 0.0% 0.0% 7.36sec 9134016 299.98sec
Vauquelin Vauquelin melee 0 0 0 0.00 0 0 167.3 0.0 0.0% 0.0% 0.0% 0.0% 1.79sec 0 299.98sec
Vauquelin Vauquelin crusading_strike 408385 15729770 52437 33.47 72293 148339 167.3 167.3 28.5% 0.0% 0.0% 0.0% 1.79sec 15729770 299.98sec
Vauquelin Vauquelin potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 301.74sec 0 299.98sec
Vauquelin Vauquelin sacrosanct_crusade_heal 461885 0 0 0.00 0 0 17.3 0.0 0.0% 0.0% 0.0% 0.0% 17.56sec 0 299.98sec
Vauquelin Vauquelin shield_of_vengeance 184662 0 0 0.98 0 0 4.9 4.9 0.0% 0.0% 0.0% 0.0% 64.39sec 0 299.98sec
Vauquelin Vauquelin shield_of_vengeance_proc 184689 9756437 32524 0.98 1986127 0 4.9 4.9 0.0% 0.0% 0.0% 0.0% 64.55sec 9756437 299.98sec
Vauquelin Vauquelin wake_of_ashes 255937 5362410 17876 1.97 420987 862970 9.8 9.8 28.1% 0.0% 0.0% 0.0% 31.88sec 5362410 299.98sec
Vauquelin Vauquelin truths_wake ticks -403695 9158959 30530 14.18 99246 203764 9.8 70.9 28.7% 0.0% 0.0% 0.0% 31.88sec 9158959 299.98sec
Vauquelin Vauquelin seething_flames_0 405345 3547110 11825 1.96 279083 571928 9.8 9.8 28.1% 0.0% 0.0% 0.0% 31.88sec 3547110 299.98sec
Vauquelin Vauquelin seething_flames_1 405350 3622584 12076 1.96 284355 584010 9.8 9.8 28.5% 0.0% 0.0% 0.0% 31.88sec 3622584 299.98sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health975,274.70.00.00%0.0100.0%

Scale Factors for other metrics

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Execution Sentence9.50.031.7s31.7s12.0s38.04%0.00%0.0 (0.0)9.5

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_execution_sentence
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 47.5s
  • trigger_min/max:30.0s / 47.5s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s
  • uptime_min/max:34.05% / 41.53%

Stack Uptimes

  • execution_sentence_1:38.04%

Spelldata

  • id:343527
  • name:Execution Sentence
  • tooltip:Sentenced to suffer {$s2=20}% of the damage your abilities deal during its duration as Holy damage.
  • description:A hammer slowly falls from the sky upon the target, after {$d=8 seconds}, they suffer {$s2=20}% of the damage taken from your abilities as Holy damage during that time. {$?s406158=false} [|cFFFFFFFFGenerates {$406158s1=3} Holy Power.][]
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:100.00%
Judgment78.50.010.5s3.8s10.6s78.63%88.12%0.0 (0.0)0.0

Buff Details

  • buff initial source:Vauquelin
  • cooldown name:buff_judgment
  • max_stacks:20
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 43.0s
  • trigger_min/max:0.0s / 21.6s
  • trigger_pct:99.82%
  • duration_min/max:0.0s / 36.3s
  • uptime_min/max:68.91% / 89.76%

Stack Uptimes

  • judgment_1:15.19%
  • judgment_2:21.77%
  • judgment_3:14.24%
  • judgment_4:11.34%
  • judgment_5:7.93%
  • judgment_6:4.63%
  • judgment_7:2.46%
  • judgment_8:0.84%
  • judgment_9:0.20%
  • judgment_10:0.04%
  • judgment_11:0.00%
  • judgment_12:0.00%
  • judgment_13:0.00%

Spelldata

  • id:197277
  • name:Judgment
  • tooltip:Taking {$=}w1% increased damage from {$@=}auracaster's next Holy Power ability.
  • description:{$@spelldesc20271=Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]}
  • max_stacks:20
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 299.98
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 992548.15
Minimum 877086.38
Maximum 1112709.59
Spread ( max - min ) 235623.22
Range [ ( max - min ) / 2 * 100% ] 11.87%
Standard Deviation 30069.4843
5th Percentile 943871.20
95th Percentile 1042405.62
( 95th Percentile - 5th Percentile ) 98534.42
Mean Distribution
Standard Deviation 300.7099
95.00% Confidence Interval ( 991958.77 - 993137.53 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3526
0.1 Scale Factor Error with Delta=300 7718549
0.05 Scale Factor Error with Delta=300 30874194
0.01 Scale Factor Error with Delta=300 771854834
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health03672792160
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.