SimulationCraft 1115-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.1.7.61609 Live (hotfix 2025-06-30/61609, git build 087637b109)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Evoker

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-06-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 30.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Rogue

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-05-06 Grand Melee Blade Flurry Bonus
Grand Melee (effect#2) base_value 20.00 10.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Tiftiv : 2,116,327 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2,116,326.92,116,326.91,534.7 / 0.073%305,015.1 / 14.4%167,953.6
Resource Out In Waiting APM Active
Focus11.110.91.12%51.6100.0%
Originhttps://worldofwarcraft.com/en-gb/character/blackrock/tiftiv
TalentC8PAIKKe/J2LdooRW3uJg8yy0PGYgtxoxyAysFsNzMbzYmZMzMGYMMzMzMz2AAAAAAAgmhhxMzMmhZYMMzwYYmlZGWAAAAAAGA
Set Bonus
Scale Factors for Tiftiv Damage Per Second
Wdps Crit Mastery Vers Haste Agi
Scale Factors 132.07 28.96 25.37 25.12 24.63 23.63
Normalized 5.59 1.23 1.07 1.06 1.04 1.00
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 1.01 0.96 0.95 0.95 0.96 0.95
Ranking
  • Wdps > Crit > Mastery ~= Vers ~= Haste > Agi
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, Agility=23.63, CritRating=28.96, HasteRating=24.63, MasteryRating=25.37, Versatility=25.12, Dps=132.07 )

Scale Factors for other metrics

Scale Factors for Tiftiv Priority Target Damage Per Second
Wdps Crit Mastery Vers Haste Agi
Scale Factors 132.07 28.96 25.37 25.12 24.63 23.63
Normalized 5.59 1.23 1.07 1.06 1.04 1.00
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 1.01 0.96 0.95 0.95 0.96 0.95
Ranking
  • Wdps > Crit > Mastery ~= Vers ~= Haste > Agi
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, Agility=23.63, CritRating=28.96, HasteRating=24.63, MasteryRating=25.37, Versatility=25.12, Dps=132.07 )
Scale Factors for Tiftiv Damage Per Second (Effective)
Wdps Crit Mastery Vers Haste Agi
Scale Factors 132.07 28.96 25.37 25.12 24.63 23.63
Normalized 5.59 1.23 1.07 1.06 1.04 1.00
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Crit > Mastery > Vers > Haste > Agi
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, Agility=23.63, CritRating=28.96, HasteRating=24.63, MasteryRating=25.37, Versatility=25.12, Dps=132.07 )
Scale Factors for Tiftiv Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, )
Scale Factors for Tiftiv Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, )
Scale Factors for Tiftiv Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, )
Scale Factors for Tiftiv Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, )
Scale Factors for Tiftiv Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, )
Scale Factors for Tiftiv Healing Taken Per Second
Haste Vers Mastery Wdps Crit Agi
Scale Factors 0.02 0.01 0.01 0.00 0.00 0.00
Normalized 9.52 6.06 4.23 2.58 1.89 1.00
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Haste > Vers > Mastery > Wdps > Crit > Agi
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, Agility=0.00, CritRating=0.00, HasteRating=0.02, MasteryRating=0.01, Versatility=0.01, Dps=0.00 )
Scale Factors for Tiftiv Fight Length
Haste Agi Crit Mastery Wdps Vers
Scale Factors -0.00 -0.00 0.00 0.00 0.00 0.00
Normalized 1.02 1.00 -0.01 -0.01 -0.03 -1.04
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Haste > Agi > Crit > Mastery > Wdps > Vers
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, Agility=0.00, CritRating=-0.00, HasteRating=0.00, MasteryRating=-0.00, Versatility=-0.00, Dps=-0.00 )
Scale Factors for Raid Damage Per Second
Wdps Crit Mastery Vers Haste Agi
Scale Factors 132.07 28.96 25.37 25.12 24.63 23.63
Normalized 5.59 1.23 1.07 1.06 1.04 1.00
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 1.01 0.96 0.95 0.95 0.96 0.95
Ranking
  • Wdps > Crit > Mastery ~= Vers ~= Haste > Agi
Pawn string ( Pawn: v1: "Tiftiv-Survival": Class=Hunter, Spec=Survival, Agility=23.63, CritRating=28.96, HasteRating=24.63, MasteryRating=25.37, Versatility=25.12, Dps=132.07 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Tiftiv2,116,327
auto_attack_mh 60,3662.9%161.62.21s111,97450,460Direct161.686,504173,451111,97429.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage161.62161.620.000.000.002.21910.000018,097,430.9825,853,446.9730.00%50,459.8750,459.87
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.71%114.287216786,503.7772,128122,07586,505.9681,34690,6629,885,35514,121,92230.00%
crit29.29%47.352279173,450.57144,256244,149173,503.41161,965190,4978,212,07611,731,52530.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Coordinated Assault 0 (11,578)0.0% (0.5%)3.0120.75s1,150,732937,132

Stats Details: Coordinated Assault

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.980.000.000.000.001.22810.00000.000.000.00%937,131.54937,131.54

Action Details: Coordinated Assault

  • id:360952
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:360952
  • name:Coordinated Assault
  • school:nature
  • tooltip:You and your pet's bond is strengthened, increasing you and your pet's damage by {$s2=20}% and increasing your chance to reset Kill Command's cooldown.{$?a459922=true}[ Kill Command is generating {$459962s4=2} additional stack of Tip of the Spear, your Haste is increased by {$459962s1=10}%, and Tip of the Spear's damage bonus is increased by {$459962s2=50}%.][]
  • description:You and your pet charge your enemy, striking them for a combined {$=}<combinedDmg> Physical damage. You and your pet's bond is then strengthened for {$d=20 seconds}, causing you and your pet to deal {$s2=20}% increased damage. While Coordinated Assault is active, Kill Command's chance to reset its cooldown is increased by {$s1=15}%.

Action Priority List

    sentst
    [J]:2.98
  • if_expr:!talent.bombardier|talent.bombardier&cooldown.wildfire_bomb.charges_fractional<1
    Coordinated Assault (_player) 3,8310.2%0.00.00s00Direct3.0292,875597,149381,04229.0%

Stats Details: Coordinated Assault Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.002.980.000.000.000.00000.00001,135,101.731,621,572.2830.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.03%2.1203292,875.37249,640454,673285,488.350403,523619,745885,34829.25%
crit28.97%0.8603597,149.48509,265847,029383,934.900831,026515,357736,22419.27%

Action Details: Coordinated Assault Player

  • id:360969
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:360969
  • name:Coordinated Assault
  • school:physical
  • tooltip:
  • description:{$@spelldesc360952=You and your pet charge your enemy, striking them for a combined {$=}<combinedDmg> Physical damage. You and your pet's bond is then strengthened for {$d=20 seconds}, causing you and your pet to deal {$s2=20}% increased damage. While Coordinated Assault is active, Kill Command's chance to reset its cooldown is increased by {$s1=15}%.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
    Coordinated Assault 7,747 / 7,7470.4%3.0120.75s769,6970Direct3.0601,3721,199,939769,54228.1%

Stats Details: Coordinated Assault

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.982.980.000.000.000.00000.00002,292,925.443,275,604.5030.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.88%2.1403601,372.06474,0821,212,426588,319.9901,212,4261,287,8711,839,81429.34%
crit28.12%0.84031,199,939.28948,1652,142,839751,536.7102,080,1481,005,0541,435,79118.77%

Action Details: Coordinated Assault

  • id:360969
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:360969
  • name:Coordinated Assault
  • school:physical
  • tooltip:
  • description:{$@spelldesc360952=You and your pet charge your enemy, striking them for a combined {$=}<combinedDmg> Physical damage. You and your pet's bond is then strengthened for {$d=20 seconds}, causing you and your pet to deal {$s2=20}% increased damage. While Coordinated Assault is active, Kill Command's chance to reset its cooldown is increased by {$s1=15}%.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Explosive Shot (_damage) 83,1943.9%0.00.00s00Direct13.71,206,7432,896,0211,815,03436.0%

Stats Details: Explosive Shot Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0013.730.000.000.000.00000.000024,924,070.0424,924,070.040.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.00%8.791191,206,742.70791,6112,144,7401,206,894.12926,5011,687,62710,605,81710,605,8170.00%
crit36.00%4.940122,896,021.281,614,8875,309,4352,909,486.6104,899,61114,318,25314,318,2530.00%

Action Details: Explosive Shot Damage

  • id:212680
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:212680
  • name:Explosive Shot
  • school:fire
  • tooltip:
  • description:{$@spelldesc212431=Fires an explosive shot at your target. After {$t1=3} sec, the shot will explode, dealing {$212680s1=0} Fire damage to all enemies within {$212680=}A1 yds. Deals reduced damage beyond {$s2=5} targets.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter1370178PCT20.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Spell Direct AmountBlackrock Munitions4620361PCT8.0%
Spell Direct AmountRanger3856951PCT20.0%
Spell Periodic AmountRanger3856952PCT20.0%
Flanking Strike 0 (233,750)0.0% (11.0%)10.031.13s7,004,5945,689,162

Stats Details: Flanking Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.000.000.000.000.001.23130.00000.000.000.00%5,689,161.725,689,161.72

Action Details: Flanking Strike

  • id:269751
  • school:physical
  • range:15.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:15
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:269751
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:You and your pet leap to the target and strike it as one, dealing a total of {$=}<damage> Physical damage. Tip of the Spear grants an additional {$260285s1=15}% damage bonus to Flanking Strike and Flanking Strike generates {$s2=2} stacks of Tip of the Spear.

Action Priority List

    sentst
    [F]:10.00
  • if_expr:buff.tip_of_the_spear.stack>0

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownHunter1370143SET1.000
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
    Flanking Strike (_player) 74,5193.5%0.00.00s00Direct10.01,334,7653,355,9942,234,19944.5%

Stats Details: Flanking Strike Player

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0010.000.000.000.000.00000.000022,332,652.9231,903,757.9830.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.50%5.550121,334,764.98983,1702,273,9521,329,705.8902,003,3607,404,69210,578,12129.99%
crit44.50%4.450113,355,993.962,154,3495,429,6573,370,853.4804,982,74814,927,96121,325,63729.92%

Action Details: Flanking Strike Player

  • id:269752
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:269752
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc269751=You and your pet leap to the target and strike it as one, dealing a total of {$=}<damage> Physical damage. Tip of the Spear grants an additional {$260285s1=15}% damage bonus to Flanking Strike and Flanking Strike generates {$s2=2} stacks of Tip of the Spear.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Spell Direct AmountFrenzy Strikes2940291PCT40.0%
Spell Direct AmountTactical Advantage3789511PCT5.0%
    (flanking_strike_) Merciless Blow 80,5993.8%0.00.00s00Periodic101.3147,861364,826238,24741.7%26.3%

Stats Details: Flanking Strike Merciless Blow

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.00101.26101.260.000.00000.778324,124,975.5324,124,975.530.00%306,123.430.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit58.34%59.083394147,860.76152238,391147,955.50127,902163,4648,735,3248,735,3240.00%
crit41.66%42.182166364,825.67332577,406365,134.39302,768424,71315,389,65215,389,6520.00%

Action Details: Flanking Strike Merciless Blow

  • id:1217375
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.600000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.04
  • base_multiplier:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:1217375
  • name:Merciless Blow
  • school:physical
  • tooltip:Bleeding for {$s1=0} every {$t1=1} sec.
  • description:{$@spelldesc459868=Enemies damaged by Flanking Strike bleed for an additional {$1217375=}o1 damage over {$1217375d=8 seconds}. Up to {$s1=5} enemies damaged by Butchery bleed for an additional {$459870=}o1 damage over {$459870d=8 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
    Flanking Strike 78,632 / 78,6323.7%10.031.13s2,356,8780Direct10.01,303,2003,678,0742,356,85144.4%

Stats Details: Flanking Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.0010.000.000.000.000.00000.000023,558,884.8633,655,516.1430.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.63%5.560121,303,200.18819,6012,889,5711,294,708.9902,599,9497,246,65910,352,35929.99%
crit44.37%4.430113,678,074.291,687,8537,797,5713,710,053.1707,137,80516,312,22623,303,15729.94%

Action Details: Flanking Strike

  • id:259516
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:30.0

Spelldata

  • id:259516
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc269751=You and your pet leap to the target and strike it as one, dealing a total of {$=}<damage> Physical damage. Tip of the Spear grants an additional {$260285s1=15}% damage bonus to Flanking Strike and Flanking Strike generates {$s2=2} stacks of Tip of the Spear.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Spell Direct AmountFrenzy Strikes2940291PCT40.0%
Spell Direct AmountTactical Advantage3789511PCT5.0%
Harpoon 0 (5,187)0.0% (0.2%)14.221.65s109,4710

Stats Details: Harpoon

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.200.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Harpoon

  • id:190925
  • school:physical
  • range:30.0
  • travel_speed:90.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:190925
  • name:Harpoon
  • school:physical
  • tooltip:Rooted.
  • description:Hurls a harpoon at an enemy, rooting them in place for {$190927d=3 seconds} and pulling you to them.

Action Priority List

    cds
    [A]:14.20
  • if_expr:prev.kill_command

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownHunter1370143SET1.000
Modify Recharge Time (Category)Terms of Engagement2658952SET-10000.000
    Harpoon (_terms_of_engagement) 5,1870.2%0.00.00s00Direct14.277,126172,352109,50434.0%

Stats Details: Harpoon Terms Of Engagement

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0014.200.000.000.000.00000.00001,554,342.552,220,487.1430.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.00%9.3711677,125.7662,410120,71077,118.9566,69992,265722,6091,032,29830.00%
crit34.00%4.83012172,351.68127,316279,721172,706.440263,852831,7341,188,19029.94%

Action Details: Harpoon Terms Of Engagement

  • id:271625
  • school:physical
  • range:100.0
  • travel_speed:70.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:271625
  • name:Harpoon
  • school:physical
  • tooltip:
  • description:{$@spelldesc190925=Hurls a harpoon at an enemy, rooting them in place for {$190927d=3 seconds} and pulling you to them.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Kill Command 0 (127,387)0.0% (6.0%)79.33.73s481,962384,707

Stats Details: Kill Command

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage79.260.000.000.000.001.25280.00000.000.000.00%384,707.08384,707.08

Action Details: Kill Command

  • id:259489
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:focus
  • energize_amount:15.0

Spelldata

  • id:259489
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal {$=}<damage> Physical damage to the enemy. Kill Command has a {$s2=10}% chance to immediately reset its cooldown. |cFFFFFFFFGenerates {$s3=15} Focus.|r

Action Priority List

    sentst
    [D]:10.33
  • if_expr:(buff.relentless_primal_ferocity.up&buff.tip_of_the_spear.stack<1)
  • target_if_expr:bloodseeker.remains
    sentst
    [G]:3.10
  • if_expr:buff.strike_it_rich.remains&buff.tip_of_the_spear.stack<1
    sentst
    [K]:5.30
  • if_expr:buff.tip_of_the_spear.stack<1&cooldown.flanking_strike.remains<gcd
  • target_if_expr:bloodseeker.remains
    sentst
    [L]:60.54
  • if_expr:focus+cast_regen<focus.max&(!buff.relentless_primal_ferocity.up|(buff.relentless_primal_ferocity.up&(buff.tip_of_the_spear.stack<1|focus<30)))
  • target_if_expr:bloodseeker.remains

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownHunter1370143SET1.000
Hasted Cooldown Duration (Category)Hunter13701411SET1.000
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
    Arcane Shot (_quick_shot) 24,7041.2%0.00.00s00Direct23.8221,917490,273311,48933.4%

Stats Details: Arcane Shot Quick Shot

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.780.000.000.000.00000.00007,409,008.007,409,008.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.62%15.84332221,917.13181,018356,460221,943.38194,912265,7773,516,1703,516,1700.00%
crit33.38%7.94022490,273.37369,278866,186491,064.990758,9523,892,8383,892,8380.00%

Action Details: Arcane Shot Quick Shot

  • id:185358
  • school:arcane
  • range:40.0
  • travel_speed:70.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:185358
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:A quick shot that causes $sw2 Arcane damage.{$?s260393=false}[ Arcane Shot has a {$260393h=30}% chance to reduce the cooldown of Rapid Fire by {$=}{{$260393m1=50}/10}.1 sec.][]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownHunter1370143SET1.000
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Spell Direct AmountRanger3856951PCT20.0%
Spell Periodic AmountRanger3856952PCT20.0%
    Kill Command 102,683 / 102,6834.9%79.33.73s388,4880Direct79.3225,877500,978317,64433.4%
Periodic179.521,46349,61031,27834.9%99.0%

Stats Details: Kill Command

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage79.2679.26179.51179.5178.070.00001.654730,792,405.0841,582,775.8825.95%103,666.610.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.64%52.822980225,877.50184,279372,067225,931.71212,588243,61811,931,36717,044,79330.00%
crit33.36%26.441044500,978.44368,557943,475501,708.22422,749602,32713,246,24918,923,19430.00%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit65.13%116.917915921,462.963535,37521,467.0020,16922,6092,509,2912,509,2910.00%
crit34.87%62.60359549,610.454491,92549,665.9143,46855,7953,105,4983,105,4980.00%

Action Details: Kill Command

  • id:259277
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.126000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:259277
  • name:Kill Command
  • school:physical
  • tooltip:Bleeding for {$=}w2 damage every {$t2=2} sec.
  • description:{$@spelldesc259489=Give the command to kill, causing your pet to savagely deal {$=}<damage> Physical damage to the enemy. Kill Command has a {$s2=10}% chance to immediately reset its cooldown. |cFFFFFFFFGenerates {$s3=15} Focus.|r}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountKiller Companion3789551PCT20.0%
Kill Shot 20,1811.0%4.852.57s1,267,924987,555Direct4.8850,2662,037,9861,268,85035.2%

Stats Details: Kill Shot

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.774.770.000.000.001.28410.00006,045,814.678,636,869.4630.00%987,555.48987,555.48
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.78%3.09010850,266.00599,1351,568,496832,942.8201,568,4962,625,0773,750,10729.23%
crit35.22%1.68072,037,985.501,222,2353,892,8041,725,559.7903,775,3043,420,7374,886,76325.22%

Action Details: Kill Shot

  • id:320976
  • school:physical
  • range:40.0
  • travel_speed:80.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:10
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:320976
  • name:Kill Shot
  • school:physical
  • tooltip:
  • description:You attempt to finish off a wounded target, dealing {$s1=0} Physical damage. Only usable on enemies with less than {$s2=20}% health.

Action Priority List

    sentst
    [Q]:4.77

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownHunter1370143SET1.000
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Spell Direct AmountRanger3856951PCT20.0%
Spell Periodic AmountRanger3856952PCT20.0%
Lightning Strike 33,7471.6%43.55.98s232,7100Direct43.5180,300360,864232,71329.0%

Stats Details: Lightning Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage43.5343.530.000.000.000.00000.000010,129,280.6510,129,280.650.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.97%30.89764180,299.71164,097209,789180,242.51167,709192,0365,570,0385,570,0380.00%
crit29.03%12.63135360,863.94328,195419,569360,719.12329,482393,3644,559,2434,559,2430.00%

Action Details: Lightning Strike

  • id:1236111
  • school:nature
  • range:50000.0
  • travel_speed:0.0000
  • radius:40.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:153774.29
  • base_dd_max:153774.29
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:1236111
  • name:Lightning Strike
  • school:nature
  • tooltip:
  • description:{$@spelldesc1236108=Your spells and abilities have a chance to turn you into a Lightning Rod striking a random enemy target within {$1236111=}A1 yds for {$=}{{$=}<rolemult>*{$1236137=}w1} Nature damage every $1236110t sec for {$1236110d=15 seconds}.}
Lunar Storm (_initial) 9,0690.4%0.00.00s00Direct10.2202,246416,943265,52829.5%

Stats Details: Lunar Storm Initial

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0010.250.000.000.000.00000.00002,720,587.432,720,587.430.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.52%7.23112202,245.59174,917291,886202,155.98177,632239,7621,461,3401,461,3400.00%
crit29.48%3.02010416,943.31356,831671,293403,576.600632,5981,259,2481,259,2480.00%

Action Details: Lunar Storm Initial

  • id:1217459
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1217459
  • name:Lunar Storm
  • school:arcane
  • tooltip:
  • description:{$@spelldesc450385=Every {$451803d=30 seconds} your next {$?s137016=false}[Rapid Fire][Wildfire Bomb] launches a celestial arrow that conjures a {$450978s1=12} yd radius Lunar Storm at the target's location dealing {$1217459s1=0} Arcane damage. For the next {$450978d=12 seconds}, a random enemy affected by Sentinel within your Lunar Storm gets struck for {$450883s1=0} Arcane damage every {$450978t2=0.400} sec. Any target struck by this effect takes {$450884s2=10}% increased damage from you and your pet for {$450884d=8 seconds}. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Lunar Storm (_periodic) 334,92115.8%0.00.00s00Direct299.7211,108506,985335,15741.9%

Stats Details: Lunar Storm Periodic

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00299.690.000.000.000.00000.0000100,447,170.71100,447,170.710.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit58.07%174.03114241211,107.64163,985331,093211,102.18198,408225,91236,738,77536,738,7750.00%
crit41.93%125.6676181506,984.51334,529807,182507,305.40467,986550,72463,708,39563,708,3950.00%

Action Details: Lunar Storm Periodic

  • id:450883
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:450883
  • name:Lunar Storm
  • school:arcane
  • tooltip:
  • description:{$@spelldesc450385=Every {$451803d=30 seconds} your next {$?s137016=false}[Rapid Fire][Wildfire Bomb] launches a celestial arrow that conjures a {$450978s1=12} yd radius Lunar Storm at the target's location dealing {$1217459s1=0} Arcane damage. For the next {$450978d=12 seconds}, a random enemy affected by Sentinel within your Lunar Storm gets struck for {$450883s1=0} Arcane damage every {$450978t2=0.400} sec. Any target struck by this effect takes {$450884s2=10}% increased damage from you and your pet for {$450884d=8 seconds}. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Mongoose Bite 524,18924.8%81.33.57s1,932,8591,543,117Direct81.31,312,6503,154,1371,932,81333.7%

Stats Details: Mongoose Bite

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage81.2681.260.000.000.001.25260.0000157,056,854.93224,366,711.2430.00%1,543,116.511,543,116.51
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.32%53.8932811,312,650.00478,90611,213,2961,314,905.40965,5742,087,17870,741,194101,058,74830.00%
crit33.68%27.379483,154,136.84976,96924,374,5993,167,732.611,946,3866,855,98286,315,661123,307,96330.00%

Action Details: Mongoose Bite

  • id:259387
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:30
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:259387
  • name:Mongoose Bite
  • school:physical
  • tooltip:
  • description:A brutal attack that deals {$s1=0} Physical damage and grants you Mongoose Fury. |cFFFFFFFFMongoose Fury|r Increases the damage of Mongoose Bite by {$259388s1=15}% {$?s385737=true}[and the chance for Kill Command to reset by {$259388s2=0}% ][]for {$259388d=16 seconds}, stacking up to {$259388u=5} times.

Action Priority List

    sentst
    [H]:1.55
  • if_expr:buff.strike_it_rich.remains&buff.coordinated_assault.up
    sentst
    [M]:6.63
  • if_expr:buff.mongoose_fury.remains<gcd&buff.mongoose_fury.stack>0
    sentst
    [P]:63.74
  • if_expr:buff.mongoose_fury.remains
    sentst
    [R]:9.33
  • if_expr:!talent.contagious_reagents
  • target_if_expr:dot.serpent_sting.remains

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownHunter1370143SET1.000
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Spell Direct AmountViper's Venom2685012PCT15.0%
Spell Direct AmountSweeping Spear3789501PCT10.0%
Spell Direct AmountSentinel Precision4503753PCT10.0%
Spell Periodic AmountSentinel Precision4503754PCT10.0%
Sentinel 132,9286.3%0.00.00s00Periodic149.4185,914420,978266,87434.4%0.0%

Stats Details: Sentinel

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00149.390.000.00000.000039,868,712.8139,868,712.810.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit65.56%97.9460136185,914.47150,656305,814185,935.04176,625198,10018,207,65218,207,6520.00%
crit34.44%51.452380420,977.82307,339741,574421,434.12381,647471,09421,661,06121,661,0610.00%

Action Details: Sentinel

  • id:450412
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:450412
  • name:Sentinel
  • school:arcane
  • tooltip:
  • description:{$@spelldesc450369=Your attacks have a chance to apply Sentinel on the target, stacking up to {$450387u=10} times. While Sentinel stacks are higher than {$s1=3}, applying Sentinel has a chance to trigger an implosion, causing a stack to be consumed on the target every sec to deal {$450412s1=0} Arcane damage. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Serpent Sting (_vipers_venom) 96,6434.6%0.00.00s00Direct81.276,566172,947109,10633.8%
Periodic116.0121,846273,169173,44534.1%96.8%

Stats Details: Serpent Sting Vipers Venom

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0081.24116.00116.0080.130.00002.502628,984,188.0828,984,188.080.00%99,838.410.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.24%53.81337776,566.2561,879125,67476,577.3471,31682,5044,119,8944,119,8940.00%
crit33.76%27.431049172,946.67126,233295,870173,176.37151,620212,0904,743,4274,743,4270.00%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit65.90%76.4446108121,846.22136199,787121,861.78114,007129,5519,314,4009,314,4000.00%
crit34.10%39.561865273,169.313,588478,582273,414.69239,820311,26710,806,46710,806,4670.00%

Action Details: Serpent Sting Vipers Venom

  • id:259491
  • school:nature
  • range:40.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.314000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.69
  • base_multiplier:1.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:259491
  • name:Serpent Sting
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=3} sec.$?a265428[ The Hunter's pet deals {$=}w3% increased damage to you.][]
  • description:Fire a poison-tipped arrow at an enemy, dealing {$s1=0} Nature damage instantly and an additional {$=}o2 damage over {$d=12 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownHunter1370143SET1.000
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Periodic AmountSurvival Hunter13701711PCT36.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Spell Direct AmountRanger3856951PCT20.0%
Spell Periodic AmountRanger3856952PCT20.0%
Spearhead 35,9001.7%5.461.09s2,004,9731,665,456Periodic70.582,294199,870152,46359.7%17.6%

Stats Details: Spearhead

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.360.0070.4870.480.001.20390.747910,745,523.0810,745,523.080.00%181,625.731,665,456.15
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit40.32%28.42104882,294.49120115,87682,322.1667,99194,7482,338,5542,338,5540.00%
crit59.68%42.062062199,870.13214289,645200,028.52176,854224,6138,406,9698,406,9690.00%

Action Details: Spearhead

  • id:360966
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:360966
  • name:Spearhead
  • school:physical
  • tooltip:
  • description:You give the signal, and your pet charges your target, bleeding them for {$378957=}o1 damage over {$378957d=10 seconds} and increasing you and your pet's chance to critically strike your target by {$378957s2=30}% for {$378957d=10 seconds}.

Action Details: Spearhead Bleed

  • id:378957
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.04
  • base_multiplier:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:378957
  • name:Spearhead
  • school:physical
  • tooltip:Suffering {$s1=0} damage every {$t1=1} sec. {$@=}auracaster has a {$s2=30}% increased chance to critically strike this target{$?s378962=true}[ and their critical strikes deal {$s3=0}% increased damage.][.]
  • description:{$@spelldesc360966=You give the signal, and your pet charges your target, bleeding them for {$378957=}o1 damage over {$378957d=10 seconds} and increasing you and your pet's chance to critically strike your target by {$378957s2=30}% for {$378957d=10 seconds}.}

Action Priority List

    sentst
    [E]:5.36
  • if_expr:cooldown.coordinated_assault.remains

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownHunter1370143SET1.000
Spell CooldownDeadly Duo3789621ADD-30000.000
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Squall Sailor's Citrine 4,1390.2%2.568.50s503,2760Direct2.5392,814785,664503,54128.2%

Stats Details: Squall Sailors Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.472.460.000.000.000.00000.00001,240,698.821,240,698.820.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.81%1.7709392,813.63338,515507,924326,106.110498,481694,996694,9960.00%
crit28.19%0.6905785,664.12677,031993,106393,426.620990,782545,703545,7030.00%

Action Details: Squall Sailors Citrine

  • id:462952
  • school:nature
  • range:50.0
  • travel_speed:30.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:171992.91
  • base_dd_max:171992.91
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462952
  • name:Squall Sailor's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462539=Your spells and abilities have a chance to slice {$s3=5} enemies with a rushing seabreeze, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1089}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1089}/100)*{$=}<rolemult>}] Nature damage to each of them.}
Storm Sewer's Citrine 7740.0%2.470.43s95,8420Direct2.474,177148,47195,85829.2%

Stats Details: Storm Sewers Citrine Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.422.420.000.000.000.00000.0000232,153.22232,153.220.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.83%1.720974,177.4962,509101,94460,804.48099,907127,276127,2760.00%
crit29.17%0.7105148,470.79125,019201,72374,693.760201,723104,877104,8770.00%

Action Details: Storm Sewers Citrine Damage

  • id:468422
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:66740.76
  • base_dd_max:66740.76
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468422
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)*{$=}<healingrolemult>}][{$=}{{$462342s3=10779}*({$s2=2941}/100)*{$=}<healingrolemult>}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Thunderlord's Crackling Citrine 7,4080.4%2.468.65s912,4620Direct2.4706,9331,415,596912,36129.0%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.432.430.000.000.000.00000.00002,221,701.032,221,701.030.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.00%1.7308706,933.25609,455915,459585,178.490912,6551,222,0381,222,0380.00%
crit29.00%0.71051,415,595.691,218,9101,834,360715,757.0001,834,360999,663999,6630.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309651.83
  • base_dd_max:309651.83
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
Undersea Overseer's Citrine 4,9580.2%2.469.44s609,0210Direct2.4470,893943,667608,94729.2%

Stats Details: Undersea Overseers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.442.440.000.000.000.00000.00001,486,767.951,486,767.950.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.79%1.7309470,893.08406,091613,798387,091.930592,423813,766813,7660.00%
crit29.21%0.7106943,667.37812,1831,193,860479,935.9501,193,860673,002673,0020.00%

Action Details: Undersea Overseers Citrine

  • id:462953
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:206326.91
  • base_dd_max:206326.91
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:462953
  • name:Undersea Overseer's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462538=Your spells and abilities have a chance to drench an enemy in freezing seawater that bounces to {$=}{{$462953=}X-1} nearby enemies, dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1306}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1306}/100)*{$=}<rolemult>}] Frost damage to each of them.}
Wildfire Bomb 0 (322,206)0.0% (15.2%)40.57.41s2,380,9581,948,016

Stats Details: Wildfire Bomb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage40.530.000.000.000.001.22230.00000.000.000.00%1,948,015.621,948,015.62

Action Details: Wildfire Bomb

  • id:259495
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:focus
  • base_cost:10
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:259495
  • name:Wildfire Bomb
  • school:physical
  • tooltip:
  • description:Hurl a bomb at the target, exploding for {$265157s1=0} Fire damage in a cone and coating enemies in wildfire, scorching them for {$269747=}o1 Fire damage over {$269747d=6 seconds}. Deals reduced damage beyond {$s2=8} targets. Deals {$s3=80}% increased damage to your primary target.

Action Priority List

    sentst
    [C]:10.20
  • if_expr:!buff.lunar_storm_cooldown.remains
    sentst
    [I]:7.37
  • if_expr:(buff.lunar_storm_cooldown.remains>full_recharge_time-gcd)&(buff.tip_of_the_spear.stack>0&cooldown.wildfire_bomb.charges_fractional>1.7|cooldown.wildfire_bomb.charges_fractional>1.9)|(talent.bombardier&cooldown.coordinated_assault.remains<2*gcd)
    sentst
    [N]:22.95
  • if_expr:buff.tip_of_the_spear.stack>0&buff.lunar_storm_cooldown.remains>full_recharge_time&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.in>15)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownHunter1370143SET1.000
Hasted Cooldown Duration (Category)Hunter13701410SET1.000
Modify Cooldown Charge (Category)Guerrilla Tactics2643321SET1.000
    Wildfire Bomb (_damage) 156,8787.4%0.00.00s00Direct40.5770,8681,842,8291,159,52636.3%

Stats Details: Wildfire Bomb Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0040.510.000.000.000.00000.000046,967,323.8646,967,323.860.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit63.74%25.821342770,867.90448,4821,436,345771,160.93659,648913,19219,903,93019,903,9300.00%
crit36.26%14.694291,842,828.81914,9033,376,4471,849,262.301,328,2382,419,28627,063,39427,063,3940.00%

Action Details: Wildfire Bomb Damage

  • id:265157
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:265157
  • name:Wildfire Bomb
  • school:fire
  • tooltip:
  • description:{$@spelldesc259495=Hurl a bomb at the target, exploding for {$265157s1=0} Fire damage in a cone and coating enemies in wildfire, scorching them for {$269747=}o1 Fire damage over {$269747d=6 seconds}. Deals reduced damage beyond {$s2=8} targets. Deals {$s3=80}% increased damage to your primary target.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Spell Direct AmountSpecialized Arsenal4595421PCT10.0%
Spell Periodic AmountSpecialized Arsenal4595422PCT10.0%
Spell Direct AmountGuerrilla Tactics2643322PCT50.0%
Spell Direct AmountGrenade Juggler4598431PCT5.0%
Spell Periodic AmountGrenade Juggler4598434PCT5.0%
Spell Direct AmountTactical Advantage3789512PCT5.0%
Spell Periodic AmountTactical Advantage3789513PCT5.0%
Spell Direct AmountSentinel Precision4503753PCT10.0%
Spell Periodic AmountSentinel Precision4503754PCT10.0%
    Wildfire Bomb (_dot) 165,3297.8%0.00.00s00Periodic207.9159,709377,580238,21336.0%69.3%

Stats Details: Wildfire Bomb Dot

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.00207.90207.9018.100.00001.000049,523,733.6749,523,733.670.00%238,211.690.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit63.97%132.9986192159,709.0596,969587,507159,924.44140,012190,97321,238,75821,238,7580.00%
crit36.03%74.9141114377,579.93199,7561,339,608378,430.29316,852457,15828,284,97628,284,9760.00%

Action Details: Wildfire Bomb Dot

  • id:269747
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.209880
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.39
  • base_multiplier:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:unknown

Spelldata

  • id:269747
  • name:Wildfire Bomb
  • school:fire
  • tooltip:Suffering {$=}w1 Fire damage every {$t1=1} sec.
  • description:{$@spelldesc259495=Hurl a bomb at the target, exploding for {$265157s1=0} Fire damage in a cone and coating enemies in wildfire, scorching them for {$269747=}o1 Fire damage over {$269747d=6 seconds}. Deals reduced damage beyond {$s2=8} targets. Deals {$s3=80}% increased damage to your primary target.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountSurvival Hunter1370171PCT4.0%
Spell Periodic AmountSurvival Hunter1370172PCT4.0%
Spell Direct AmountSurvival Hunter13701714PCT4.0%
Spell Periodic AmountSurvival Hunter13701715PCT4.0%
Spell Direct AmountSurvival Hunter13701716PCT-4.0%
Spell Periodic AmountSurvival Hunter13701717PCT-4.0%
Spell Direct AmountSpecialized Arsenal4595421PCT10.0%
Spell Periodic AmountSpecialized Arsenal4595422PCT10.0%
Spell Direct AmountGrenade Juggler4598431PCT5.0%
Spell Periodic AmountGrenade Juggler4598434PCT5.0%
Spell Direct AmountTactical Advantage3789512PCT5.0%
Spell Periodic AmountTactical Advantage3789513PCT5.0%
Spell Direct AmountSentinel Precision4503753PCT10.0%
Spell Periodic AmountSentinel Precision4503754PCT10.0%
pet - duck 256865 / 256865
Claw 16,5820.8%89.93.32s55,21454,967Direct89.935,94991,34555,21234.8%

Stats Details: Claw

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage89.9489.940.000.000.001.00450.00004,966,090.677,094,408.1430.00%54,966.8654,966.86
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit65.22%58.66368535,949.3725,15999,29535,966.4830,29142,0292,108,9123,012,72930.00%
crit34.78%31.28145191,345.1350,318265,56191,717.6664,093132,0642,857,1784,081,67930.00%

Action Details: Claw

  • id:16827
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing {$=}{{$=}<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has {$62762s3=50} or more Focus.

Action Priority List

    default
    [ ]:89.94
melee 51,2212.4%264.31.12s58,07951,264Direct264.339,95992,17958,07834.7%

Stats Details: Melee

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage264.29264.290.000.000.001.13290.000015,349,824.5521,928,298.8630.00%51,263.8251,263.82
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit65.30%172.5811522939,958.7232,25565,50939,969.5238,03042,2146,896,2009,851,70530.00%
crit34.70%91.715313392,178.6064,510169,32392,279.9682,468103,4468,453,62412,076,59430.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
Tiftiv
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Tiftiv
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Explosive Shot 13.921.54s

Stats Details: Explosive Shot

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.870.000.000.000.221.23580.00000.000.000.00%0.000.00

Action Details: Explosive Shot

  • id:212431
  • school:fire
  • range:40.0
  • travel_speed:120.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:focus
  • base_cost:20
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:3.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:212431
  • name:Explosive Shot
  • school:fire
  • tooltip:Exploding for {$212680s1=0} Fire damage after {$t1=3} sec.
  • description:Fires an explosive shot at your target. After {$t1=3} sec, the shot will explode, dealing {$212680s1=0} Fire damage to all enemies within {$212680=}A1 yds. Deals reduced damage beyond {$s2=5} targets.

Action Priority List

    sentst
    [O]:13.87

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownHunter1370143SET1.000
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Tiftiv
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
The Sushi Special 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457302
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Tiftiv
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Legendary Skipper's Citrine 26.810.80s

Stats Details: Legendary Skippers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage26.830.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Legendary Skippers Citrine

  • id:462962
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462962
  • name:Legendary Skipper's Citrine
  • school:physical
  • tooltip:
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
cyrces_circlet 2.469.82s

Stats Details: Mariners Hallowed Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.440.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Mariners Hallowed Citrine

  • id:462960
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Tiftiv
  • aoe:3
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309539.45
  • base_dd_max:309539.45
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462960
  • name:Mariner's Hallowed Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462530=Your spells and abilities have a chance to bathe an ally in restorative water that jumps to {$=}{{$462960=}x1-1} nearby allies, restoring {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1960}/100)*{$=}<healingrolemult>}][{$=}{{$462342s3=10779}*({$s2=1960}/100)*{$=}<healingrolemult>}] health to each of them.}
cyrces_circlet 2.468.67s

Stats Details: Old Salts Bardic Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal2.430.0028.400.000.160.00000.83500.000.000.00%0.000.00

Action Details: Old Salts Bardic Citrine

  • id:462959
  • school:nature
  • range:50.0
  • travel_speed:15.0000
  • radius:50.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Tiftiv
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43009.23
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:462959
  • name:Old Salt's Bardic Citrine
  • school:nature
  • tooltip:Restoring {$=}w1 every sec.
  • description:{$@spelldesc462531=Your spells and abilities have a chance to whisper a sea shanty to {$s3=5} nearby allies, healing them for {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1634}/100)*{$=}<healingrolemult>}][{$=}{{$462342s3=10779}*({$s2=1634}/100)*{$=}<healingrolemult>}] health over {$462959d=5 seconds}.}
Tempered Potion 1.5307.69s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [B]:1.48
  • if_expr:target.time_to_die<25|buff.coordinated_assault.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault
Storm Sewer's Citrine 2.470.43s

Stats Details: Storm Sewers Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb2.422.420.000.000.000.00000.00000.001,529,107.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%2.420110.00000.000001,529,10790.99%

Action Details: Storm Sewers Citrine

  • id:462958
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Tiftiv
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:464467.63
  • base_dd_max:464467.63
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • school:nature
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)*{$=}<healingrolemult>}][{$=}{{$462342s3=10779}*({$s2=2941}/100)*{$=}<healingrolemult>}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
Call Pet 1 (summon_pet) 1.00.00s

Stats Details: Summon Pet

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Summon Pet

  • id:883
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Tiftiv
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:883
  • name:Call Pet 1
  • school:physical
  • tooltip:
  • description:Summons your first pet to you.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownHunter1370143SET1.000
cyrces_circlet 2.566.41s

Stats Details: Windsingers Runed Citrine Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.450.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Windsingers Runed Citrine Proc

  • id:462534
  • school:froststorm
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • school:froststorm
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust1.00.00.0s0.0s40.0s13.51%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodseeker1.00.00.0s0.0s298.0s99.30%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_bloodseeker
  • max_stacks:10
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:237.9s / 358.0s
  • uptime_min/max:99.13% / 99.45%

Stack Uptimes

  • bloodseeker_1:99.30%

Spelldata

  • id:260249
  • name:Bloodseeker
  • tooltip:Attack speed increased by {$s1=10}%.
  • description:{$@spelldesc260248=Kill Command causes the target to bleed for {$=}{{$=}RAP*({$s1=10}/100)*({$259277d=8 seconds}/{$259277t2=2})} damage over {$259277d=8 seconds}. You and your pet gain {$260249s1=10}% attack speed for every bleeding enemy within {$s2=12} yds.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Charged Bolts6.43.645.8s28.0s19.0s40.43%0.00%37.1 (37.1)6.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_charged_bolts
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 149.1s
  • trigger_min/max:0.0s / 120.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 114.0s
  • uptime_min/max:16.18% / 74.07%

Stack Uptimes

  • charged_bolts_1:40.43%

Spelldata

  • id:1236110
  • name:Charged Bolts
  • tooltip:Damaging nearby targets for {$=}{{$=}<rolemult>*{$1236137=}w1} Nature damage every $t sec.
  • description:{$@spelldesc1236108=Your spells and abilities have a chance to turn you into a Lightning Rod striking a random enemy target within {$1236111=}A1 yds for {$=}{{$=}<rolemult>*{$1236137=}w1} Nature damage every $1236110t sec for {$1236110d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Coordinated Assault3.00.0120.7s120.7s19.4s19.44%0.00%0.0 (0.0)2.8

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_coordinated_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 127.7s
  • trigger_min/max:120.0s / 127.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:16.14% / 22.97%

Stack Uptimes

  • coordinated_assault_1:19.44%

Spelldata

  • id:360952
  • name:Coordinated Assault
  • tooltip:You and your pet's bond is strengthened, increasing you and your pet's damage by {$s2=20}% and increasing your chance to reset Kill Command's cooldown.{$?a459922=true}[ Kill Command is generating {$459962s4=2} additional stack of Tip of the Spear, your Haste is increased by {$459962s1=10}%, and Tip of the Spear's damage bonus is increased by {$459962s2=50}%.][]
  • description:You and your pet charge your enemy, striking them for a combined {$=}<combinedDmg> Physical damage. You and your pet's bond is then strengthened for {$d=20 seconds}, causing you and your pet to deal {$s2=20}% increased damage. While Coordinated Assault is active, Kill Command's chance to reset its cooldown is increased by {$s1=15}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Deathblow6.51.541.9s33.1s10.1s21.69%0.00%1.5 (1.5)3.2

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_deathblow
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:false
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 303.7s
  • trigger_min/max:0.8s / 298.7s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 50.7s
  • uptime_min/max:0.00% / 54.66%

Stack Uptimes

  • deathblow_1:21.69%

Spelldata

  • id:378770
  • name:Deathblow
  • tooltip:Your next {$?a466932=false}[Black Arrow][Kill Shot] can be used on any target, regardless of their current health.
  • description:{$@spelldesc378769=Aimed Shot now has a {$s2=15}% chance and Rapid Fire now has a {$s1=25}% chance to grant Deathblow. {$?a466932=false}[Black Arrow][Kill Shot] critical strike damage is increased by {$s3=25}%. {$@=}spellicon378770 {$@=}spellname378770 The cooldown of {$?a466932=false}[Black Arrow][Kill Shot] is reset. {$@=}spellaura378770}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Endurance Training1.00.00.0s0.0s300.0s100.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_endurance_training
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • endurance_training_1:100.00%

Spelldata

  • id:264662
  • name:Endurance Training
  • tooltip:Maximum health increased by {$=}w2%.
  • description:You and your pet gain {$s1=5}% increased maximum health.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Eyes Closed3.00.0120.7s120.7s7.9s7.93%0.00%0.0 (0.0)2.9

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_eyes_closed
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 127.7s
  • trigger_min/max:120.0s / 127.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:6.46% / 9.63%

Stack Uptimes

  • eyes_closed_1:7.93%

Spelldata

  • id:451180
  • name:Eyes Closed
  • tooltip:All abilities are guaranteed to apply Sentinel.
  • description:{$@spelldesc450381=For {$451180d=8 seconds} after activating {$?s137016=false}[Trueshot][Coordinated Assault], all abilities are guaranteed to apply Sentinel.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine (_proc)2.20.282.6s70.2s15.4s11.25%0.00%0.2 (0.2)2.1

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_fathomdwellers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1983.23
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:5067.54

Trigger Details

  • interval_min/max:15.0s / 335.3s
  • trigger_min/max:0.1s / 335.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.1s
  • uptime_min/max:0.00% / 45.92%

Stack Uptimes

  • fathomdwellers_runed_citrine_proc_1:11.25%

Spelldata

  • id:465962
  • name:Fathomdweller's Runed Citrine
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc462535=Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Crit)2.10.6112.8s77.4s35.4s25.07%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 342.1s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 79.31%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.07%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6111.9s76.1s35.4s25.14%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 355.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 192.4s
  • uptime_min/max:0.00% / 80.25%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.14%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.6s76.2s35.5s25.13%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 344.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 192.2s
  • uptime_min/max:0.00% / 80.01%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.13%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6112.0s76.8s35.2s24.66%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 344.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 79.33%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.66%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Frenzy Strikes10.00.031.2s31.2s11.8s39.20%0.00%0.0 (0.0)9.6

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_frenzy_strikes
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.0s / 37.2s
  • trigger_min/max:30.0s / 37.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:36.74% / 41.37%

Stack Uptimes

  • frenzy_strikes_1:39.20%

Spelldata

  • id:1217377
  • name:Frenzy Strikes
  • tooltip:Attack speed increased by {$s1=25}%.
  • description:{$@spelldesc294029=Flanking Strike damage increased by {$s1=40}% and Flanking Strike now increases your attack speed by {$1217377s1=25}% for {$1217377d=12 seconds}. Butchery reduces the remaining cooldown on Wildfire Bomb by {$=}{{$212436s2=3000}/1000}.1 sec for each target hit, up to {$212436s3=5} targets.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
House of Cards3.20.0116.5s116.5s14.7s15.85%0.00%0.0 (0.0)3.1

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_house_of_cards
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:8841.57
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:House of Cards

Stat Details

  • stat:mastery_rating
  • amount:9301.39

Trigger Details

  • interval_min/max:90.0s / 128.0s
  • trigger_min/max:90.0s / 128.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:13.28% / 18.75%

Stack Uptimes

  • house_of_cards_1:15.85%

Spelldata

  • id:466681
  • name:House of Cards
  • tooltip:Mastery increased by {$=}w1.
  • description:Deal yourself in, granting you {$=}{{$466680s1=10478}*(1-{$466680s2=10}/100)} to {$=}{{$466680s1=10478}*(1+{$466680s2=10}/100)} Mastery for {$d=15 seconds} and stacking the deck. Stacking the deck increases the minimum Mastery on future hands by {$=}{{$466680s1=10478}*({$466680s2=10}/100/3)} until you leave combat, up to {$1219158u=3} times.
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:0.00%
I Did That!3.119.591.8s13.5s89.3s91.26%0.00%19.5 (19.5)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_i_did_that
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:0.00
  • stat:haste_rating
  • amount:186.43
  • stat:mastery_rating
  • amount:0.00
  • stat:versatility_rating
  • amount:0.00

Trigger Details

  • interval_min/max:24.0s / 355.8s
  • trigger_min/max:12.0s / 27.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.9s
  • uptime_min/max:69.13% / 99.97%

Stack Uptimes

  • i_did_that_1:91.26%

Spelldata

  • id:1214823
  • name:I Did That!
  • tooltip:Claiming credit from allies! {$?=}e0[Critical Strike increased by {$=}w1. ][]{$?=}e1[Haste increased by {$=}w2. ][]{$?=}e2[Mastery increased by {$=}w3. ][]{$?=}e3[Versatility increased by {$=}w4.][]
  • description:{$@spelldesc1214161=Take Credit for your allies' deeds up to once every {$1215043d=12 seconds}, gaining {$s1=94} of their highest secondary stat up to {$s2=10} times until shortly after leaving combat. You have a {$s3=10}% chance to get caught in the act, transferring all accumulated Credit to your ally for {$1214826d=15 seconds} instead.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Storm (_cooldown)10.20.030.8s30.8s28.6s97.52%0.00%0.0 (0.0)9.3

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_lunar_storm_cooldown
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.0s / 33.7s
  • trigger_min/max:30.0s / 33.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:96.10% / 98.82%

Stack Uptimes

  • lunar_storm_cooldown_1:97.52%

Spelldata

  • id:451803
  • name:Lunar Storm
  • tooltip:You cannot summon a Lunar Storm.
  • description:{$@spelldesc450385=Every {$451803d=30 seconds} your next {$?s137016=false}[Rapid Fire][Wildfire Bomb] launches a celestial arrow that conjures a {$450978s1=12} yd radius Lunar Storm at the target's location dealing {$1217459s1=0} Arcane damage. For the next {$450978d=12 seconds}, a random enemy affected by Sentinel within your Lunar Storm gets struck for {$450883s1=0} Arcane damage every {$450978t2=0.400} sec. Any target struck by this effect takes {$450884s2=10}% increased damage from you and your pet for {$450884d=8 seconds}. }
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Storm (_ready)10.30.030.7s30.8s0.7s2.48%25.32%0.0 (0.0)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_lunar_storm_ready
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.0s / 33.7s
  • trigger_min/max:30.0s / 33.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.7s
  • uptime_min/max:1.18% / 3.90%

Stack Uptimes

  • lunar_storm_ready_1:2.48%

Spelldata

  • id:451805
  • name:Lunar Storm
  • tooltip:Your next {$?=}c2[Rapid Fire][Wildfire Bomb] will summon a Lunar Storm.
  • description:{$@spelldesc450385=Every {$451803d=30 seconds} your next {$?s137016=false}[Rapid Fire][Wildfire Bomb] launches a celestial arrow that conjures a {$450978s1=12} yd radius Lunar Storm at the target's location dealing {$1217459s1=0} Arcane damage. For the next {$450978d=12 seconds}, a random enemy affected by Sentinel within your Lunar Storm gets struck for {$450883s1=0} Arcane damage every {$450978t2=0.400} sec. Any target struck by this effect takes {$450884s2=10}% increased damage from you and your pet for {$450884d=8 seconds}. }
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mongoose Fury9.871.431.2s3.6s25.6s83.92%87.88%33.1 (33.1)9.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_mongoose_fury
  • max_stacks:5
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.3s / 48.4s
  • trigger_min/max:0.8s / 26.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.0s
  • uptime_min/max:75.14% / 91.65%

Stack Uptimes

  • mongoose_fury_1:10.10%
  • mongoose_fury_2:9.49%
  • mongoose_fury_3:9.21%
  • mongoose_fury_4:9.55%
  • mongoose_fury_5:45.56%

Spelldata

  • id:259388
  • name:Mongoose Fury
  • tooltip:Mongoose Bite damage increased by {$s1=15}%.{$?=}{$=}w2>0[ Kill Command reset chance increased by {$=}w2%.][]
  • description:{$@spelldesc259387=A brutal attack that deals {$s1=0} Physical damage and grants you Mongoose Fury. |cFFFFFFFFMongoose Fury|r Increases the damage of Mongoose Bite by {$259388s1=15}% {$?s385737=true}[and the chance for Kill Command to reset by {$259388s2=0}% ][]for {$259388d=16 seconds}, stacking up to {$259388u=5} times.}
  • max_stacks:5
  • duration:16.00
  • cooldown:0.00
  • default_chance:101.00%
Seabed Leviathan's Citrine (_proc)2.20.282.4s70.0s15.4s11.27%0.00%0.2 (0.2)2.1

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_seabed_leviathans_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.55
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Cyrce's Circlet

Stat Details

  • stat:stamina
  • amount:26760.28

Trigger Details

  • interval_min/max:15.0s / 347.7s
  • trigger_min/max:0.2s / 342.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 59.1s
  • uptime_min/max:0.00% / 47.96%

Stack Uptimes

  • seabed_leviathans_citrine_proc_1:11.27%

Spelldata

  • id:462963
  • name:Seabed Leviathan's Citrine
  • tooltip:Stamina increased by {$=}w1 and dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s4=64}/100)}][{$=}{{$462342s3=10779}*({$s4=64}/100)}] Frost damage to attackers while above {$s5=80}% health.
  • description:{$@spelldesc462527=Grants {$?a462527=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=435}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=435}/100)*({$462342s5=5663}/3)}] Stamina and increases your size slightly. In addition, being above {$s6=80}% health causes attackers to take {$?a462342=false}[{$=}{{$462342=}w1*({$s5=82}/100)}][{$=}{{$462342s3=10779}*({$s5=82}/100)}] Frost damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stacked Deck1.02.20.0s116.5s298.0s99.30%0.00%0.2 (0.2)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_stacked_deck_trinket
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:90.0s / 128.0s
  • trigger_pct:100.00%
  • duration_min/max:237.9s / 358.0s
  • uptime_min/max:99.13% / 99.45%

Stack Uptimes

  • stacked_deck_trinket_1:40.91%
  • stacked_deck_trinket_2:39.44%
  • stacked_deck_trinket_3:18.96%

Spelldata

  • id:1219158
  • name:Stacked Deck
  • tooltip:Future Gallyjack hands from House of Cards have their minimum Mastery increased by {$=}w1.
  • description:{$@spelldesc466681=Deal yourself in, granting you {$=}{{$466680s1=10478}*(1-{$466680s2=10}/100)} to {$=}{{$466680s1=10478}*(1+{$466680s2=10}/100)} Mastery for {$d=15 seconds} and stacking the deck. Stacking the deck increases the minimum Mastery on future hands by {$=}{{$466680s1=10478}*({$466680s2=10}/100/3)} until you leave combat, up to {$1219158u=3} times.}
  • max_stacks:3
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Sewer's Citrine1.20.093.0s86.1s10.0s3.93%0.00%0.0 (0.0)1.1

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_storm_sewers_citrine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:1.7s / 337.3s
  • trigger_min/max:0.4s / 337.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 27.4s
  • uptime_min/max:0.00% / 20.97%

Stack Uptimes

  • storm_sewers_citrine_1:3.93%

Spelldata

  • id:462958
  • name:Storm Sewer's Citrine
  • tooltip:Absorbing the next {$=}w1 damage received and dealing {$462532s3=10}% of the amount absorbed as Nature damage back to attackers.
  • description:{$@spelldesc462532=Your spells and abilities have a chance to shield an ally with lightning, absorbing the next {$?a462342=false}[{$=}{{$462342=}w1*({$s2=2941}/100)*{$=}<healingrolemult>}][{$=}{{$462342s3=10779}*({$s2=2941}/100)*{$=}<healingrolemult>}] damage taken for {$462958d=10 seconds}. While the shield persists, attackers take {$s3=10}% of the amount absorbed as Nature damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer's Runed Citrine (_proc)2.20.283.0s70.2s15.4s11.33%0.00%0.2 (0.2)2.1

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_stormbringers_runed_citrine_proc
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.71
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1601.10
  • stat:haste_rating
  • amount:1601.10
  • stat:mastery_rating
  • amount:1601.10
  • stat:versatility_rating
  • amount:1601.10

Trigger Details

  • interval_min/max:15.0s / 344.5s
  • trigger_min/max:0.1s / 333.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.3s
  • uptime_min/max:0.00% / 44.90%

Stack Uptimes

  • stormbringers_runed_citrine_proc_1:11.33%

Spelldata

  • id:465961
  • name:Stormbringer's Runed Citrine
  • tooltip:All secondary stats are increased by {$=}w1.
  • description:{$@spelldesc462536=Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Strike it Rich5.60.144.8s43.9s3.2s5.99%100.00%0.1 (0.1)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_strike_it_rich
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 316.3s
  • trigger_min/max:0.9s / 316.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s
  • uptime_min/max:0.00% / 23.16%

Stack Uptimes

  • strike_it_rich_1:5.99%

Spelldata

  • id:1216879
  • name:Strike it Rich
  • tooltip:Your next {$?s259387=true}[Mongoose Bite][Raptor Strike]'s damage increased by {$=}w1% and reduces the cooldown of Wildfire Bomb by {$=}{{$=}w2/1000} sec.
  • description:{$@spelldesc1216064=When your|cFFFFFFFF Winning Streak!|r ends, your next {$?s259387=true}[Mongoose Bite][Raptor Strike] deals {$1216879s1=400}% increased damage and reduces the cooldown of Wildfire Bomb by {$=}{{$1216879s2=10000}/1000} sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Suspicious Energy Drink10.36.428.4s17.0s12.7s43.55%0.00%6.4 (6.4)9.9

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_suspicious_energy_drink
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:3509.17

Trigger Details

  • interval_min/max:10.0s / 93.9s
  • trigger_min/max:0.0s / 74.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.2s
  • uptime_min/max:21.22% / 74.59%

Stack Uptimes

  • suspicious_energy_drink_1:43.55%

Spelldata

  • id:1216650
  • name:Suspicious Energy Drink
  • tooltip:Increases Mastery Rating by {$=}w1.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Tempered Potion1.50.0310.0s310.0s26.5s12.87%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 334.1s
  • trigger_min/max:300.0s / 334.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.90% / 16.80%

Stack Uptimes

  • tempered_potion_1:12.87%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Terms of Engagement14.20.021.7s21.7s9.8s46.51%0.00%0.0 (0.0)13.7

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_terms_of_engagement
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 28.5s
  • trigger_min/max:20.0s / 28.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:42.94% / 50.21%

Stack Uptimes

  • terms_of_engagement_1:46.51%

Spelldata

  • id:265898
  • name:Terms of Engagement
  • tooltip:Generating {$=}{{$m1=10}/5} Focus every sec.
  • description:{$@spelldesc265895=Harpoon has a {$=}{{$m2=-10000}/-1000} sec reduced cooldown, and deals {$271625s1=0} Physical damage and generates {$=}{({$265898s1=10}/5)*{$265898d=10 seconds}} Focus over {$265898d=10 seconds}. Killing an enemy resets the cooldown of Harpoon.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Tip of the Spear63.625.64.7s3.4s2.8s59.36%75.89%8.0 (9.5)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_tip_of_the_spear
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 44.0s
  • trigger_min/max:0.8s / 10.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.9s
  • uptime_min/max:50.74% / 67.17%

Stack Uptimes

  • tip_of_the_spear_1:33.04%
  • tip_of_the_spear_2:15.58%
  • tip_of_the_spear_3:10.75%

Spelldata

  • id:260286
  • name:Tip of the Spear
  • tooltip:Your next non-Kill Command spell deals {$=}w1% increased direct damage.
  • description:{$@spelldesc260285=Kill Command increases the direct damage of your other spells by {$s1=15}%, stacking up to {$260286u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Tip of the Spear (_explosive)10.30.229.2s28.7s3.1s10.58%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_tip_of_the_spear_explosive
  • max_stacks:5
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 179.3s
  • trigger_min/max:1.7s / 179.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:3.19% / 19.05%

Stack Uptimes

  • tip_of_the_spear_explosive_1:10.58%
  • tip_of_the_spear_explosive_2:0.00%

Spelldata

  • id:460852
  • name:Tip of the Spear
  • tooltip:Your next Explosive Shot deals {$s1=0}% increased damage.
  • description:{$@spelldesc260285=Kill Command increases the direct damage of your other spells by {$s1=15}%, stacking up to {$260286u=3} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Windsinger's Runed Citrine (_Mastery_proc)2.20.281.2s68.8s15.4s11.36%0.00%0.2 (0.2)2.1

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4871.31

Trigger Details

  • interval_min/max:15.0s / 343.4s
  • trigger_min/max:0.0s / 343.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.7s
  • uptime_min/max:0.00% / 49.74%

Stack Uptimes

  • windsingers_runed_citrine_Mastery_1:11.36%

Spelldata

  • id:465963
  • name:Windsinger's Runed Citrine
  • tooltip:Increased {$?=}{$=}w1!=0[Haste by {$=}w1. ][]{$?=}{$=}w3!=0[Critical Strike by {$=}w3. ][]{$?=}{$=}w4!=0[Versatility by {$=}w4. ][]{$?=}{$=}w5!=0[Mastery by {$=}w5. ][]
  • description:{$@spelldesc462534=Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Winning Streak!6.659.843.4s4.5s42.6s93.58%89.78%36.1 (36.1)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_winning_streak
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 318.7s
  • trigger_min/max:0.0s / 16.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 351.7s
  • uptime_min/max:78.01% / 99.91%

Stack Uptimes

  • winning_streak_1:8.79%
  • winning_streak_2:7.86%
  • winning_streak_3:7.07%
  • winning_streak_4:6.43%
  • winning_streak_5:5.87%
  • winning_streak_6:57.55%

Spelldata

  • id:1216874
  • name:Winning Streak!
  • tooltip:Wildfire Bomb damage increased by {$=}w1%.
  • description:{$@spelldesc1215730=Your spells and abilities have a chance to activate a|cFFFFFFFF Winning Streak!|r increasing the damage of your Wildfire Bomb by {$1216874s1=3}% stacking up to {$1216874=}U times. Wildfire Bomb has a {$1216874=}H% chance to end your|cFFFFFFFF Winning Streak!|r}
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:15.00%
duck - duck: Bloodseeker1.00.00.0s0.0s298.0s99.30%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Tiftiv_duck
  • cooldown name:buff_bloodseeker
  • max_stacks:10
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:237.9s / 358.0s
  • uptime_min/max:99.13% / 99.45%

Stack Uptimes

  • bloodseeker_1:99.30%

Spelldata

  • id:260249
  • name:Bloodseeker
  • tooltip:Attack speed increased by {$s1=10}%.
  • description:{$@spelldesc260248=Kill Command causes the target to bleed for {$=}{{$=}RAP*({$s1=10}/100)*({$259277d=8 seconds}/{$259277t2=2})} damage over {$259277d=8 seconds}. You and your pet gain {$260249s1=10}% attack speed for every bleeding enemy within {$s2=12} yds.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
duck - duck: Spearhead (_buff)5.40.061.2s61.2s9.8s17.60%0.00%0.0 (0.0)5.2

Buff Details

  • buff initial source:Tiftiv_duck
  • cooldown name:buff_spearhead_buff
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 67.0s
  • trigger_min/max:60.0s / 67.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:16.02% / 19.66%

Stack Uptimes

  • spearhead_buff_1:17.60%

Spelldata

  • id:1221386
  • name:Spearhead
  • tooltip:{$@=}auracaster has a {$s2=30}% increased chance to critically strike this target{$?s378962=false}[ and their critical strikes deal {$378962s2=30}% increased damage.][.]
  • description:{$@spelldesc360966=You give the signal, and your pet charges your target, bleeding them for {$378957=}o1 damage over {$378957d=10 seconds} and increasing you and your pet's chance to critically strike your target by {$378957s2=30}% for {$378957d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.23

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Stormbringer's Runed Citrine

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_stormbringers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.71
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:788.78
  • stat:haste_rating
  • amount:788.78
  • stat:mastery_rating
  • amount:788.78
  • stat:versatility_rating
  • amount:788.78

Spelldata

  • id:462536
  • name:Stormbringer's Runed Citrine
  • tooltip:
  • description:Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
The Sushi Special

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_the_sushi_special
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:470.00

Spelldata

  • id:461957
  • name:Well Fed
  • tooltip:Mastery increased by {$=}w9.
  • description:Increases Mastery by {$s1=0} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Deathblow7.90.021.033.1s0.9s298.7s
Extrapolated Shots Stacks1.11.06.0136.4s2.3s348.7s
Kill Command Reset23.17.043.012.6s0.8s146.8s
Overwatch Implosion0.00.02.025.7s23.9s27.4s
Release and Reload Stacks37.113.064.08.0s0.0s118.2s
Sentinel Implosions1.01.04.0155.7s10.8s343.4s
Sentinel Stacks246.5158.0322.01.2s0.0s27.5s
Skyfury (Main Hand)26.98.049.010.9s1.3s126.1s
bite_at_0_fury9.87.013.031.2s20.3s48.4s
bite_at_1_fury9.77.013.031.3s9.1s61.2s
bite_at_2_fury9.67.013.031.5s9.3s61.6s
bite_at_3_fury9.57.012.031.6s8.0s62.5s
bite_at_4_fury9.46.012.031.8s9.5s76.3s
bite_at_5_fury33.119.049.08.5s0.8s81.0s
Benefit Avg % Min Max
duck - wild_hunt17.91%15.38%21.33%
Uptime Avg % Min Max Avg Dur Min Max
Focus Cap2.68%0.65%8.86%1.0s0.0s4.5s
duck - Focus Cap0.00%0.00%0.05%0.0s0.0s0.1s

Cooldown waste details

Seconds per ExecuteSeconds per Iteration
AbilityAverageMinimumMaximumAverageMinimumMaximum
Harpoon1.8050.0018.45222.3915.21944.995
Spearhead1.2800.0016.9725.1540.00010.542
Kill Command1.8560.0019.68545.3002.767115.501
Explosive Shot2.3220.00121.15330.3637.10371.914
Wildfire Bomb0.6400.0014.2890.7520.0008.270
Flanking Strike1.3000.0017.23510.6713.25524.914
Coordinated Assault0.8550.0017.6811.3940.0009.403
Kill Shot13.1520.001255.26662.2890.000264.521

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Tiftiv
Focus RegenFocus1,033.741,749.2053.32%1.6962.523.45%
Invigorating PulseFocus22.39108.183.30%4.833.793.39%
Terms of EngagementFocus479.54268.268.18%0.5610.563.79%
Kill CommandFocus79.261,155.0635.21%14.5733.882.85%
pet - duck
Focus RegenFocus535.082,262.9388.30%4.230.010.00%
Flanking StrikeFocus10.00299.8711.70%30.000.000.00%
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Focus100.010.9411.06110.762.80.0100.0
Usage Type Count Total Tot% Avg RPE APR
Tiftiv
Explosive ShotFocus13.87277.328.36%20.0020.000.00
Flanking StrikeFocus10.00149.944.52%15.0015.00466,972.43
Kill ShotFocus4.7747.681.44%10.0010.00126,806.87
Mongoose BiteFocus81.262,437.6773.47%30.0030.0064,429.21
Wildfire BombFocus40.53405.2512.21%10.0010.00238,101.42
pet - duck
ClawFocus89.942,649.30100.00%29.4629.461,874.49

Statistics & Data Analysis

Fight Length
Tiftiv Fight Length
Count 9999
Mean 300.01
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Tiftiv Damage Per Second
Count 9999
Mean 2116326.93
Minimum 1872647.05
Maximum 2517040.75
Spread ( max - min ) 644393.70
Range [ ( max - min ) / 2 * 100% ] 15.22%
Standard Deviation 78300.1788
5th Percentile 1996621.25
95th Percentile 2254415.03
( 95th Percentile - 5th Percentile ) 257793.78
Mean Distribution
Standard Deviation 783.0409
95.00% Confidence Interval ( 2114792.20 - 2117861.66 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5259
0.1 Scale Factor Error with Delta=300 52337043
0.05 Scale Factor Error with Delta=300 209348170
0.01 Scale Factor Error with Delta=300 5233704238
Priority Target DPS
Tiftiv Priority Target Damage Per Second
Count 9999
Mean 2116326.93
Minimum 1872647.05
Maximum 2517040.75
Spread ( max - min ) 644393.70
Range [ ( max - min ) / 2 * 100% ] 15.22%
Standard Deviation 78300.1788
5th Percentile 1996621.25
95th Percentile 2254415.03
( 95th Percentile - 5th Percentile ) 257793.78
Mean Distribution
Standard Deviation 783.0409
95.00% Confidence Interval ( 2114792.20 - 2117861.66 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5259
0.1 Scale Factor Error with Delta=300 52337043
0.05 Scale Factor Error with Delta=300 209348170
0.01 Scale Factor Error with Delta=300 5233704238
DPS(e)
Tiftiv Damage Per Second (Effective)
Count 9999
Mean 2116326.93
Minimum 1872647.05
Maximum 2517040.75
Spread ( max - min ) 644393.70
Range [ ( max - min ) / 2 * 100% ] 15.22%
Damage
Tiftiv Damage
Count 9999
Mean 557248092.68
Minimum 404059160.96
Maximum 725166669.23
Spread ( max - min ) 321107508.27
Range [ ( max - min ) / 2 * 100% ] 28.81%
DTPS
Tiftiv Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Tiftiv Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Tiftiv Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Tiftiv Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Tiftiv Healing Taken Per Second
Count 9999
Mean 1826.36
Minimum 0.00
Maximum 8765.92
Spread ( max - min ) 8765.92
Range [ ( max - min ) / 2 * 100% ] 239.98%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 summon_pet
1 0.00 snapshot_stats
2 0.00 variable,name=stronger_trinket_slot,op=setif,value=1,value_else=2,condition=!trinket.2.is.house_of_cards&(trinket.1.is.house_of_cards|!trinket.2.has_cooldown|trinket.1.has_use_buff&(!trinket.2.has_use_buff|trinket.2.cooldown.duration<trinket.1.cooldown.duration|trinket.2.cast_time<trinket.1.cast_time|trinket.2.cast_time=trinket.1.cast_time&trinket.2.cooldown.duration=trinket.1.cooldown.duration)|!trinket.1.has_use_buff&(!trinket.2.has_use_buff&(trinket.2.cooldown.duration<trinket.1.cooldown.duration|trinket.2.cast_time<trinket.1.cast_time|trinket.2.cast_time=trinket.1.cast_time&trinket.2.cooldown.duration=trinket.1.cooldown.duration)))
Default action list Executed every time the actor is available.
# count action,conditions
3 1.00 auto_attack
4 0.00 call_action_list,name=cds
5 0.00 call_action_list,name=trinkets
6 0.00 call_action_list,name=plst,if=active_enemies<3&talent.howl_of_the_pack_leader
7 0.00 call_action_list,name=plcleave,if=active_enemies>2&talent.howl_of_the_pack_leader
8 0.00 call_action_list,name=sentst,if=active_enemies<3&!talent.howl_of_the_pack_leader
9 0.00 call_action_list,name=sentcleave,if=active_enemies>2&!talent.howl_of_the_pack_leader
0.00 arcane_torrent
0.00 bag_of_tricks
0.00 lights_judgment
actions.cds
# count action,conditions
0.00 blood_fury,if=buff.coordinated_assault.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault
0.00 invoke_external_buff,name=power_infusion,if=(buff.coordinated_assault.up&buff.coordinated_assault.remains>7&!buff.power_infusion.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault)
A 14.20 harpoon,if=prev.kill_command
0.00 ancestral_call,if=buff.coordinated_assault.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault
0.00 fireblood,if=buff.coordinated_assault.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault
0.00 berserking,if=buff.coordinated_assault.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault|time_to_die<13
0.00 muzzle
B 1.48 potion,if=target.time_to_die<25|buff.coordinated_assault.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault
0.00 aspect_of_the_eagle,if=target.distance>=6
actions.sentst
# count action,conditions
C 10.20 wildfire_bomb,if=!buff.lunar_storm_cooldown.remains
D 10.33 kill_command,target_if=min:bloodseeker.remains,if=(buff.relentless_primal_ferocity.up&buff.tip_of_the_spear.stack<1)
E 5.36 spearhead,if=cooldown.coordinated_assault.remains
F 10.00 flanking_strike,if=buff.tip_of_the_spear.stack>0
G 3.10 kill_command,if=buff.strike_it_rich.remains&buff.tip_of_the_spear.stack<1
H 1.55 mongoose_bite,if=buff.strike_it_rich.remains&buff.coordinated_assault.up
I 7.37 wildfire_bomb,if=(buff.lunar_storm_cooldown.remains>full_recharge_time-gcd)&(buff.tip_of_the_spear.stack>0&cooldown.wildfire_bomb.charges_fractional>1.7|cooldown.wildfire_bomb.charges_fractional>1.9)|(talent.bombardier&cooldown.coordinated_assault.remains<2*gcd)
0.00 butchery
J 2.98 coordinated_assault,if=!talent.bombardier|talent.bombardier&cooldown.wildfire_bomb.charges_fractional<1
0.00 fury_of_the_eagle,if=buff.tip_of_the_spear.stack>0
K 5.30 kill_command,target_if=min:bloodseeker.remains,if=buff.tip_of_the_spear.stack<1&cooldown.flanking_strike.remains<gcd
L 60.54 kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max&(!buff.relentless_primal_ferocity.up|(buff.relentless_primal_ferocity.up&(buff.tip_of_the_spear.stack<1|focus<30)))
M 6.63 mongoose_bite,if=buff.mongoose_fury.remains<gcd&buff.mongoose_fury.stack>0
N 22.95 wildfire_bomb,if=buff.tip_of_the_spear.stack>0&buff.lunar_storm_cooldown.remains>full_recharge_time&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.in>15)
O 13.87 explosive_shot
P 63.74 mongoose_bite,if=buff.mongoose_fury.remains
Q 4.77 kill_shot
R 9.33 raptor_bite,target_if=min:dot.serpent_sting.remains,if=!talent.contagious_reagents
0.00 raptor_bite,target_if=max:dot.serpent_sting.remains
actions.trinkets
# count action,conditions
0.00 variable,name=buff_sync_ready,value=buff.coordinated_assault.up
0.00 variable,name=buff_sync_remains,value=cooldown.coordinated_assault.remains
0.00 variable,name=buff_sync_active,value=buff.coordinated_assault.up
0.00 variable,name=damage_sync_active,value=1
0.00 variable,name=damage_sync_remains,value=0
S 3.21 use_items,slots=trinket1:trinket2,if=this_trinket.has_use_buff&(variable.buff_sync_ready&(variable.stronger_trinket_slot=this_trinket_slot|other_trinket.cooldown.remains)|!variable.buff_sync_ready&(variable.stronger_trinket_slot=this_trinket_slot&(variable.buff_sync_remains>this_trinket.cooldown.duration%3&fight_remains>this_trinket.cooldown.duration+20|other_trinket.has_use_buff&other_trinket.cooldown.remains>variable.buff_sync_remains-15&other_trinket.cooldown.remains-5<variable.buff_sync_remains&variable.buff_sync_remains+45>fight_remains)|variable.stronger_trinket_slot!=this_trinket_slot&(other_trinket.cooldown.remains&(other_trinket.cooldown.remains-5<variable.buff_sync_remains&variable.buff_sync_remains>=20|other_trinket.cooldown.remains-5>=variable.buff_sync_remains&(variable.buff_sync_remains>this_trinket.cooldown.duration%3|this_trinket.cooldown.duration<fight_remains&(variable.buff_sync_remains+this_trinket.cooldown.duration>fight_remains)))|other_trinket.cooldown.ready&variable.buff_sync_remains>20&variable.buff_sync_remains<other_trinket.cooldown.duration%3)))|!this_trinket.has_use_buff&(this_trinket.cast_time=0|!variable.buff_sync_active)&(!this_trinket.is.junkmaestros_mega_magnet|buff.junkmaestros_mega_magnet.stack>10)&(!other_trinket.has_cooldown&(variable.damage_sync_active|this_trinket.is.junkmaestros_mega_magnet&buff.junkmaestros_mega_magnet.stack>25|!this_trinket.is.junkmaestros_mega_magnet&variable.damage_sync_remains>this_trinket.cooldown.duration%3)|other_trinket.has_cooldown&(!other_trinket.has_use_buff&(variable.stronger_trinket_slot=this_trinket_slot|other_trinket.cooldown.remains)&(variable.damage_sync_active|this_trinket.is.junkmaestros_mega_magnet&buff.junkmaestros_mega_magnet.stack>25|variable.damage_sync_remains>this_trinket.cooldown.duration%3&!this_trinket.is.junkmaestros_mega_magnet|other_trinket.cooldown.remains-5<variable.damage_sync_remains&variable.damage_sync_remains>=20)|other_trinket.has_use_buff&(variable.damage_sync_active|this_trinket.is.junkmaestros_mega_magnet&buff.junkmaestros_mega_magnet.stack>25|!this_trinket.is.junkmaestros_mega_magnet&variable.damage_sync_remains>this_trinket.cooldown.duration%3)&(other_trinket.cooldown.remains>=20|other_trinket.cooldown.remains-5>variable.buff_sync_remains)))|fight_remains<25&(variable.stronger_trinket_slot=this_trinket_slot|other_trinket.cooldown.remains)

Sample Sequence

023CJBSDAEFIONDRPPDNPPDPLNPLPLLALPLIPLPPCLNOKFPLNPLPLAMQRLNPPLLPLPLCPEKAFNOPLMLNQRLPPPLPQLALCNLOPPKFLMLNRPLALPPLPLIPCJSDEONPDAFRPPDNPLPPLLPPLLAPCLLNOMKFNLRLPLAPPLPLPLIPPCELNOLAMRKFNPLNGPPLNPLPLACPLMOLNRPKFLPLNPPLAPPPLJSCEDNOQDRPPDAFNOPDLPPLLPILCLPLAMQRLNPPKFOPLLLI

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0summon_pet
[precombat]
Tiftiv 100.0/100 100% focus
Pre2stronger_trinket_slot
[precombat]
Tiftiv 100.0/100 100% focus
0:00.0003auto_attack
[default]
Fluffy_Pillow 100.0/100 100% focus
0:00.000Cwildfire_bomb
[sentst]
Fluffy_Pillow 100.0/100 100% focus bloodlust
0:01.042Jcoordinated_assault
[sentst]
Fluffy_Pillow 97.5/100 98% focus bloodlust, lunar_storm_cooldown, i_did_that
0:02.081Bpotion
[cds]
Fluffy_Pillow 100.0/100 100% focus bloodlust, coordinated_assault, eyes_closed, lunar_storm_cooldown, i_did_that
0:02.081Suse_items
[trinkets]
Fluffy_Pillow 100.0/100 100% focus bloodlust, coordinated_assault, eyes_closed, lunar_storm_cooldown, i_did_that, tempered_potion
0:02.081Dkill_command
[sentst]
Fluffy_Pillow 100.0/100 100% focus bloodlust, coordinated_assault, eyes_closed, lunar_storm_cooldown, i_did_that, stacked_deck_trinket, house_of_cards, tempered_potion
0:02.992Aharpoon
[cds]
Fluffy_Pillow 100.0/100 100% focus bloodlust, tip_of_the_spear(3), bloodseeker, coordinated_assault, eyes_closed, lunar_storm_cooldown, i_did_that, stacked_deck_trinket, house_of_cards, tempered_potion
0:02.992Espearhead
[sentst]
Fluffy_Pillow 100.0/100 100% focus bloodlust, tip_of_the_spear(3), bloodseeker, coordinated_assault, winning_streak, eyes_closed, lunar_storm_cooldown, i_did_that, stacked_deck_trinket, house_of_cards, tempered_potion
0:03.905Fflanking_strike
[sentst]
Fluffy_Pillow 100.0/100 100% focus bloodlust, tip_of_the_spear(3), bloodseeker, terms_of_engagement, coordinated_assault, winning_streak, eyes_closed, lunar_storm_cooldown, i_did_that, stacked_deck_trinket, house_of_cards, tempered_potion
0:04.817Iwildfire_bomb
[sentst]
Fluffy_Pillow 94.3/100 94% focus bloodlust, tip_of_the_spear(3), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(2), eyes_closed, lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, tempered_potion
0:05.730Oexplosive_shot
[sentst]
Fluffy_Pillow 93.7/100 94% focus bloodlust, tip_of_the_spear(2), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(2), eyes_closed, lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, tempered_potion
0:06.641Nwildfire_bomb
[sentst]
Fluffy_Pillow 83.0/100 83% focus bloodlust, tip_of_the_spear, tip_of_the_spear_explosive, frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(2), eyes_closed, lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, tempered_potion
0:07.552Dkill_command
[sentst]
Fluffy_Pillow 82.4/100 82% focus bloodlust, tip_of_the_spear_explosive, frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(2), eyes_closed, lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, tempered_potion
0:08.462Rmongoose_bite
[sentst]
Fluffy_Pillow 100.0/100 100% focus bloodlust, tip_of_the_spear(3), tip_of_the_spear_explosive, frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(2), eyes_closed, lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, tempered_potion
0:09.374Pmongoose_bite
[sentst]
Fluffy_Pillow 79.4/100 79% focus bloodlust, tip_of_the_spear(2), mongoose_fury, frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(2), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, suspicious_energy_drink, tempered_potion
0:10.286Pmongoose_bite
[sentst]
Fluffy_Pillow 63.7/100 64% focus bloodlust, tip_of_the_spear, mongoose_fury(2), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(2), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, suspicious_energy_drink, tempered_potion
0:11.197Dkill_command
[sentst]
Fluffy_Pillow 43.1/100 43% focus bloodlust, mongoose_fury(3), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(3), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, suspicious_energy_drink, tempered_potion
0:12.108Nwildfire_bomb
[sentst]
Fluffy_Pillow 67.4/100 67% focus bloodlust, tip_of_the_spear(3), mongoose_fury(3), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(4), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, suspicious_energy_drink, tempered_potion
0:13.019Pmongoose_bite
[sentst]
Fluffy_Pillow 66.8/100 67% focus bloodlust, tip_of_the_spear(2), mongoose_fury(3), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(4), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, suspicious_energy_drink, tempered_potion
0:13.927Pmongoose_bite
[sentst]
Fluffy_Pillow 44.4/100 44% focus bloodlust, tip_of_the_spear, mongoose_fury(4), frenzy_strikes, bloodseeker, coordinated_assault, winning_streak(4), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, suspicious_energy_drink, tempered_potion
0:14.836Dkill_command
[sentst]
Fluffy_Pillow 21.9/100 22% focus bloodlust, mongoose_fury(5), frenzy_strikes, bloodseeker, coordinated_assault, winning_streak(5), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, suspicious_energy_drink, tempered_potion
0:15.745Pmongoose_bite
[sentst]
Fluffy_Pillow 49.4/100 49% focus bloodlust, deathblow, tip_of_the_spear(3), mongoose_fury(5), frenzy_strikes, bloodseeker, coordinated_assault, winning_streak(5), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, suspicious_energy_drink, tempered_potion
0:16.655Lkill_command
[sentst]
Fluffy_Pillow 27.0/100 27% focus bloodlust, deathblow, tip_of_the_spear(2), mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(5), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, house_of_cards, suspicious_energy_drink, tempered_potion
0:17.561Nwildfire_bomb
[sentst]
Fluffy_Pillow 49.5/100 49% focus bloodlust, deathblow, tip_of_the_spear(3), mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(5), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, suspicious_energy_drink, tempered_potion
0:18.473Pmongoose_bite
[sentst]
Fluffy_Pillow 47.0/100 47% focus bloodlust, deathblow, tip_of_the_spear(2), mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(5), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, suspicious_energy_drink, tempered_potion
0:19.382Lkill_command
[sentst]
Fluffy_Pillow 24.6/100 25% focus bloodlust, deathblow, tip_of_the_spear, mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, tempered_potion
0:20.293Pmongoose_bite
[sentst]
Fluffy_Pillow 47.3/100 47% focus bloodlust, deathblow, tip_of_the_spear(3), mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste, tempered_potion
0:21.161Lkill_command
[sentst]
Fluffy_Pillow 24.7/100 25% focus bloodlust, deathblow, tip_of_the_spear(2), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste, tempered_potion
0:22.113Lkill_command
[sentst]
Fluffy_Pillow 47.2/100 47% focus bloodlust, deathblow, tip_of_the_spear(3), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste, tempered_potion
0:23.066Aharpoon
[cds]
Fluffy_Pillow 69.8/100 70% focus bloodlust, deathblow, tip_of_the_spear(3), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste, tempered_potion
0:23.066Lkill_command
[sentst]
Fluffy_Pillow 69.8/100 70% focus bloodlust, deathblow, tip_of_the_spear(3), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste, tempered_potion
0:24.019Pmongoose_bite
[sentst]
Fluffy_Pillow 94.0/100 94% focus bloodlust, deathblow, tip_of_the_spear(3), mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste, tempered_potion
0:24.974Lkill_command
[sentst]
Fluffy_Pillow 73.5/100 74% focus bloodlust, deathblow, tip_of_the_spear(2), mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste, tempered_potion
0:25.927Iwildfire_bomb
[sentst]
Fluffy_Pillow 98.0/100 98% focus bloodlust, deathblow, tip_of_the_spear(3), mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste, tempered_potion
0:26.878Pmongoose_bite
[sentst]
Fluffy_Pillow 97.4/100 97% focus bloodlust, deathblow, tip_of_the_spear(2), mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste, tempered_potion
0:27.832Lkill_command
[sentst]
Fluffy_Pillow 76.8/100 77% focus bloodlust, deathblow, tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste, tempered_potion
0:28.783Pmongoose_bite
[sentst]
Fluffy_Pillow 100.0/100 100% focus bloodlust, deathblow, tip_of_the_spear(2), mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste, tempered_potion
0:29.734Pmongoose_bite
[sentst]
Fluffy_Pillow 79.4/100 79% focus bloodlust, deathblow, tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste, tempered_potion
0:30.685Cwildfire_bomb
[sentst]
Fluffy_Pillow 58.9/100 59% focus bloodlust, deathblow, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_ready, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste, tempered_potion
0:31.637Lkill_command
[sentst]
Fluffy_Pillow 58.3/100 58% focus bloodlust, deathblow, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste, tempered_potion
0:32.590Nwildfire_bomb
[sentst]
Fluffy_Pillow 82.6/100 83% focus bloodlust, deathblow, tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:33.573Oexplosive_shot
[sentst]
Fluffy_Pillow 81.2/100 81% focus bloodlust, deathblow, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:34.560Kkill_command
[sentst]
Fluffy_Pillow 68.8/100 69% focus bloodlust, deathblow, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:35.545Fflanking_strike
[sentst]
Fluffy_Pillow 91.3/100 91% focus bloodlust, deathblow, tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:36.530Pmongoose_bite
[sentst]
Fluffy_Pillow 83.9/100 84% focus bloodlust, deathblow, tip_of_the_spear(2), mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
0:37.514Lkill_command
[sentst]
Fluffy_Pillow 61.4/100 61% focus bloodlust, deathblow, tip_of_the_spear, mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
0:38.496Nwildfire_bomb
[sentst]
Fluffy_Pillow 83.9/100 84% focus bloodlust, deathblow, tip_of_the_spear(2), mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
0:39.477Pmongoose_bite
[sentst]
Fluffy_Pillow 81.5/100 81% focus bloodlust, deathblow, tip_of_the_spear, mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
0:40.458Lkill_command
[sentst]
Fluffy_Pillow 58.2/100 58% focus deathblow, mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
0:41.733Pmongoose_bite
[sentst]
Fluffy_Pillow 80.7/100 81% focus deathblow, tip_of_the_spear, mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
0:43.008Lkill_command
[sentst]
Fluffy_Pillow 58.2/100 58% focus deathblow, mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
0:44.317Aharpoon
[cds]
Fluffy_Pillow 81.0/100 81% focus deathblow, tip_of_the_spear, mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
0:44.317Mmongoose_bite
[sentst]
Fluffy_Pillow 81.0/100 81% focus deathblow, tip_of_the_spear, mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
0:45.591Qkill_shot
[sentst]
Fluffy_Pillow 60.9/100 61% focus deathblow, frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
0:46.867Rmongoose_bite
[sentst]
Fluffy_Pillow 66.0/100 66% focus frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:48.143Lkill_command
[sentst]
Fluffy_Pillow 46.1/100 46% focus mongoose_fury, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:49.418Nwildfire_bomb
[sentst]
Fluffy_Pillow 71.2/100 71% focus tip_of_the_spear, mongoose_fury, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:50.692Pmongoose_bite
[sentst]
Fluffy_Pillow 71.2/100 71% focus mongoose_fury, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:51.966Pmongoose_bite
[sentst]
Fluffy_Pillow 51.3/100 51% focus mongoose_fury(2), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:53.236Lkill_command
[sentst]
Fluffy_Pillow 31.4/100 31% focus mongoose_fury(3), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:54.505Lkill_command
[sentst]
Fluffy_Pillow 56.2/100 56% focus tip_of_the_spear, mongoose_fury(3), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:55.776Pmongoose_bite
[sentst]
Fluffy_Pillow 78.7/100 79% focus tip_of_the_spear(2), mongoose_fury(3), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:57.049Lkill_command
[sentst]
Fluffy_Pillow 56.3/100 56% focus tip_of_the_spear, mongoose_fury(4), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:58.318Pmongoose_bite
[sentst]
Fluffy_Pillow 78.8/100 79% focus tip_of_the_spear(2), mongoose_fury(4), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
0:59.590Lkill_command
[sentst]
Fluffy_Pillow 56.3/100 56% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:00.862Cwildfire_bomb
[sentst]
Fluffy_Pillow 78.8/100 79% focus tip_of_the_spear(2), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_ready, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:02.134Pmongoose_bite
[sentst]
Fluffy_Pillow 76.3/100 76% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:03.404Espearhead
[sentst]
Fluffy_Pillow 53.9/100 54% focus mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:04.673Kkill_command
[sentst]
Fluffy_Pillow 66.4/100 66% focus mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:05.942Aharpoon
[cds]
Fluffy_Pillow 88.9/100 89% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:05.942Fflanking_strike
[sentst]
Fluffy_Pillow 88.9/100 89% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:07.213Nwildfire_bomb
[sentst]
Fluffy_Pillow 83.9/100 84% focus tip_of_the_spear(2), mongoose_fury(5), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:08.483Oexplosive_shot
[sentst]
Fluffy_Pillow 88.9/100 89% focus tip_of_the_spear, mongoose_fury(5), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:09.752Pmongoose_bite
[sentst]
Fluffy_Pillow 79.0/100 79% focus tip_of_the_spear_explosive, mongoose_fury(5), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:11.022Lkill_command
[sentst]
Fluffy_Pillow 59.1/100 59% focus tip_of_the_spear_explosive, mongoose_fury(5), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:12.290Mmongoose_bite
[sentst]
Fluffy_Pillow 89.1/100 89% focus tip_of_the_spear, mongoose_fury(5), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:13.559Lkill_command
[sentst]
Fluffy_Pillow 69.2/100 69% focus frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:14.829Nwildfire_bomb
[sentst]
Fluffy_Pillow 94.2/100 94% focus deathblow, tip_of_the_spear, frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:16.096Qkill_shot
[sentst]
Fluffy_Pillow 94.1/100 94% focus deathblow, frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:17.360Rmongoose_bite
[sentst]
Fluffy_Pillow 91.7/100 92% focus frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, flask_of_alchemical_chaos_haste
1:18.626Lkill_command
[sentst]
Fluffy_Pillow 69.2/100 69% focus mongoose_fury, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
1:19.891Pmongoose_bite
[sentst]
Fluffy_Pillow 91.7/100 92% focus deathblow, tip_of_the_spear, mongoose_fury, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_haste
1:21.157Pmongoose_bite
[sentst]
Fluffy_Pillow 68.9/100 69% focus deathblow, mongoose_fury(2), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:22.479Pmongoose_bite
[sentst]
Fluffy_Pillow 46.4/100 46% focus deathblow, mongoose_fury(3), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:23.803Lkill_command
[sentst]
Fluffy_Pillow 23.9/100 24% focus deathblow, mongoose_fury(4), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:25.125Pmongoose_bite
[sentst]
Fluffy_Pillow 46.4/100 46% focus deathblow, tip_of_the_spear, mongoose_fury(4), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:26.450Qkill_shot
[sentst]
Fluffy_Pillow 24.0/100 24% focus deathblow, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:27.773 Waiting1.009s 21.5/100 21% focus mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:28.782Lkill_command
[sentst]
Fluffy_Pillow 27.2/100 27% focus mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:30.313Aharpoon
[cds]
Fluffy_Pillow 50.9/100 51% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:30.313Lkill_command
[sentst]
Fluffy_Pillow 50.9/100 51% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:31.634Cwildfire_bomb
[sentst]
Fluffy_Pillow 76.0/100 76% focus tip_of_the_spear(2), mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_ready, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:32.955Nwildfire_bomb
[sentst]
Fluffy_Pillow 76.1/100 76% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:34.277Lkill_command
[sentst]
Fluffy_Pillow 76.3/100 76% focus mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:35.599Oexplosive_shot
[sentst]
Fluffy_Pillow 100.0/100 100% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:36.921Pmongoose_bite
[sentst]
Fluffy_Pillow 90.2/100 90% focus tip_of_the_spear_explosive, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:38.241Pmongoose_bite
[sentst]
Fluffy_Pillow 70.3/100 70% focus tip_of_the_spear_explosive, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:39.561Kkill_command
[sentst]
Fluffy_Pillow 50.5/100 50% focus mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:40.883Fflanking_strike
[sentst]
Fluffy_Pillow 74.7/100 75% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:42.203Lkill_command
[sentst]
Fluffy_Pillow 72.2/100 72% focus tip_of_the_spear(2), mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:43.521Mmongoose_bite
[sentst]
Fluffy_Pillow 94.7/100 95% focus tip_of_the_spear(3), mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:44.840Lkill_command
[sentst]
Fluffy_Pillow 72.3/100 72% focus tip_of_the_spear(2), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:46.157Nwildfire_bomb
[sentst]
Fluffy_Pillow 94.8/100 95% focus tip_of_the_spear(3), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:47.474Rmongoose_bite
[sentst]
Fluffy_Pillow 92.3/100 92% focus tip_of_the_spear(2), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:48.792Pmongoose_bite
[sentst]
Fluffy_Pillow 74.8/100 75% focus tip_of_the_spear, mongoose_fury, frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:50.107Lkill_command
[sentst]
Fluffy_Pillow 52.3/100 52% focus mongoose_fury(2), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:51.429Aharpoon
[cds]
Fluffy_Pillow 74.8/100 75% focus tip_of_the_spear, mongoose_fury(2), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:51.429Lkill_command
[sentst]
Fluffy_Pillow 74.8/100 75% focus tip_of_the_spear, mongoose_fury(2), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:52.752Pmongoose_bite
[sentst]
Fluffy_Pillow 99.9/100 100% focus tip_of_the_spear(2), mongoose_fury(2), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:54.074Pmongoose_bite
[sentst]
Fluffy_Pillow 80.0/100 80% focus tip_of_the_spear, mongoose_fury(3), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket, flask_of_alchemical_chaos_crit
1:55.397Lkill_command
[sentst]
Fluffy_Pillow 60.2/100 60% focus mongoose_fury(4), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:56.717Pmongoose_bite
[sentst]
Fluffy_Pillow 85.4/100 85% focus tip_of_the_spear, mongoose_fury(4), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, seabed_leviathans_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:58.037Lkill_command
[sentst]
Fluffy_Pillow 65.5/100 66% focus mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, seabed_leviathans_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
1:59.358Iwildfire_bomb
[sentst]
Fluffy_Pillow 90.9/100 91% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:00.651Pmongoose_bite
[sentst]
Fluffy_Pillow 91.0/100 91% focus mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:01.945Cwildfire_bomb
[sentst]
Fluffy_Pillow 70.2/100 70% focus mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_ready, i_did_that, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:03.238Jcoordinated_assault
[sentst]
Fluffy_Pillow 67.7/100 68% focus mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:04.531Suse_items
[trinkets]
Fluffy_Pillow 76.0/100 76% focus mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, stacked_deck_trinket, suspicious_energy_drink, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:04.531Dkill_command
[sentst]
Fluffy_Pillow 76.0/100 76% focus mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, stacked_deck_trinket(2), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:05.707Espearhead
[sentst]
Fluffy_Pillow 98.5/100 99% focus tip_of_the_spear(3), mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, stacked_deck_trinket(2), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:06.884Oexplosive_shot
[sentst]
Fluffy_Pillow 100.0/100 100% focus tip_of_the_spear(3), mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, stacked_deck_trinket(2), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:08.059Nwildfire_bomb
[sentst]
Fluffy_Pillow 87.5/100 88% focus tip_of_the_spear(2), tip_of_the_spear_explosive, mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, stacked_deck_trinket(2), house_of_cards, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:09.234Pmongoose_bite
[sentst]
Fluffy_Pillow 85.0/100 85% focus tip_of_the_spear, tip_of_the_spear_explosive, mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, seabed_leviathans_citrine_proc, stacked_deck_trinket(2), house_of_cards, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:10.409Dkill_command
[sentst]
Fluffy_Pillow 62.6/100 63% focus mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), house_of_cards, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:11.583Aharpoon
[cds]
Fluffy_Pillow 85.1/100 85% focus tip_of_the_spear(3), mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), house_of_cards, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:11.583Fflanking_strike
[sentst]
Fluffy_Pillow 85.1/100 85% focus tip_of_the_spear(3), mongoose_fury(5), bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), house_of_cards, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:12.758Rmongoose_bite
[sentst]
Fluffy_Pillow 79.8/100 80% focus tip_of_the_spear(3), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), house_of_cards, flask_of_alchemical_chaos_crit, storm_sewers_citrine
2:13.933Pmongoose_bite
[sentst]
Fluffy_Pillow 59.6/100 60% focus tip_of_the_spear(2), mongoose_fury, frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), house_of_cards, flask_of_alchemical_chaos_crit
2:15.132Pmongoose_bite
[sentst]
Fluffy_Pillow 39.5/100 40% focus tip_of_the_spear, mongoose_fury(2), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), house_of_cards, flask_of_alchemical_chaos_crit
2:16.331Dkill_command
[sentst]
Fluffy_Pillow 24.4/100 24% focus mongoose_fury(3), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), house_of_cards, flask_of_alchemical_chaos_crit
2:17.530Nwildfire_bomb
[sentst]
Fluffy_Pillow 49.4/100 49% focus tip_of_the_spear(3), mongoose_fury(3), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), house_of_cards, flask_of_alchemical_chaos_crit
2:18.728Pmongoose_bite
[sentst]
Fluffy_Pillow 49.3/100 49% focus tip_of_the_spear(2), mongoose_fury(3), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:19.927Lkill_command
[sentst]
Fluffy_Pillow 29.2/100 29% focus tip_of_the_spear, mongoose_fury(4), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:21.121Pmongoose_bite
[sentst]
Fluffy_Pillow 54.1/100 54% focus tip_of_the_spear(3), mongoose_fury(4), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:22.316Pmongoose_bite
[sentst]
Fluffy_Pillow 32.7/100 33% focus tip_of_the_spear(2), mongoose_fury(5), frenzy_strikes, bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:23.510Lkill_command
[sentst]
Fluffy_Pillow 10.1/100 10% focus tip_of_the_spear, mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:24.825Lkill_command
[sentst]
Fluffy_Pillow 32.6/100 33% focus tip_of_the_spear(2), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:26.139Pmongoose_bite
[sentst]
Fluffy_Pillow 55.1/100 55% focus tip_of_the_spear(3), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:27.451Pmongoose_bite
[sentst]
Fluffy_Pillow 32.7/100 33% focus tip_of_the_spear(2), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:28.766Lkill_command
[sentst]
Fluffy_Pillow 10.2/100 10% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:30.080Lkill_command
[sentst]
Fluffy_Pillow 32.7/100 33% focus tip_of_the_spear(2), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
2:31.395Aharpoon
[cds]
Fluffy_Pillow 55.2/100 55% focus tip_of_the_spear(3), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:31.583Pmongoose_bite
[sentst]
Fluffy_Pillow 56.3/100 56% focus tip_of_the_spear(3), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:32.932Cwildfire_bomb
[sentst]
Fluffy_Pillow 36.4/100 36% focus tip_of_the_spear(2), mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_ready, charged_bolts, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:34.279Lkill_command
[sentst]
Fluffy_Pillow 36.6/100 37% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:35.630Lkill_command
[sentst]
Fluffy_Pillow 66.8/100 67% focus tip_of_the_spear(2), mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:36.978Nwildfire_bomb
[sentst]
Fluffy_Pillow 92.0/100 92% focus tip_of_the_spear(3), mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:38.325Oexplosive_shot
[sentst]
Fluffy_Pillow 92.3/100 92% focus tip_of_the_spear(2), mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:39.675Mmongoose_bite
[sentst]
Fluffy_Pillow 82.5/100 82% focus tip_of_the_spear, tip_of_the_spear_explosive, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:41.025Kkill_command
[sentst]
Fluffy_Pillow 62.7/100 63% focus tip_of_the_spear_explosive, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:42.373Fflanking_strike
[sentst]
Fluffy_Pillow 86.5/100 86% focus tip_of_the_spear, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:43.722Nwildfire_bomb
[sentst]
Fluffy_Pillow 79.0/100 79% focus tip_of_the_spear(2), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:45.071Lkill_command
[sentst]
Fluffy_Pillow 76.7/100 77% focus tip_of_the_spear, frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:46.391Rmongoose_bite
[sentst]
Fluffy_Pillow 99.2/100 99% focus tip_of_the_spear(2), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:47.709Lkill_command
[sentst]
Fluffy_Pillow 76.8/100 77% focus tip_of_the_spear, mongoose_fury, frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:49.028Pmongoose_bite
[sentst]
Fluffy_Pillow 99.3/100 99% focus tip_of_the_spear(2), mongoose_fury, frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
2:50.346Lkill_command
[sentst]
Fluffy_Pillow 76.9/100 77% focus tip_of_the_spear, mongoose_fury(2), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
2:51.606Aharpoon
[cds]
Fluffy_Pillow 99.4/100 99% focus tip_of_the_spear(2), mongoose_fury(2), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
2:51.606Pmongoose_bite
[sentst]
Fluffy_Pillow 99.4/100 99% focus tip_of_the_spear(2), mongoose_fury(2), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
2:52.867Pmongoose_bite
[sentst]
Fluffy_Pillow 79.4/100 79% focus tip_of_the_spear, mongoose_fury(3), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
2:54.125Lkill_command
[sentst]
Fluffy_Pillow 59.4/100 59% focus mongoose_fury(4), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
2:55.385Pmongoose_bite
[sentst]
Fluffy_Pillow 84.4/100 84% focus tip_of_the_spear, mongoose_fury(4), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
2:56.643Lkill_command
[sentst]
Fluffy_Pillow 64.5/100 64% focus mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
2:57.903Pmongoose_bite
[sentst]
Fluffy_Pillow 89.5/100 90% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
2:59.160Lkill_command
[sentst]
Fluffy_Pillow 69.5/100 70% focus mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
3:00.442Iwildfire_bomb
[sentst]
Fluffy_Pillow 99.6/100 100% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
3:01.724Pmongoose_bite
[sentst]
Fluffy_Pillow 99.8/100 100% focus mongoose_fury(5), bloodseeker, strike_it_rich, lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_haste
3:02.980Pmongoose_bite
[sentst]
Fluffy_Pillow 77.3/100 77% focus mongoose_fury(5), bloodseeker, winning_streak, lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_haste
3:04.240Cwildfire_bomb
[sentst]
Fluffy_Pillow 54.8/100 55% focus mongoose_fury(5), bloodseeker, winning_streak, lunar_storm_ready, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_haste
3:05.497Espearhead
[sentst]
Fluffy_Pillow 52.3/100 52% focus mongoose_fury(5), bloodseeker, winning_streak, lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_haste
3:06.963Lkill_command
[sentst]
Fluffy_Pillow 61.1/100 61% focus mongoose_fury(5), bloodseeker, winning_streak, lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_haste
3:08.220Nwildfire_bomb
[sentst]
Fluffy_Pillow 83.6/100 84% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(2), lunar_storm_cooldown, i_did_that, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_haste
3:09.476Oexplosive_shot
[sentst]
Fluffy_Pillow 81.1/100 81% focus mongoose_fury(5), bloodseeker, winning_streak(2), lunar_storm_cooldown, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_haste
3:10.739Lkill_command
[sentst]
Fluffy_Pillow 68.7/100 69% focus mongoose_fury(5), bloodseeker, winning_streak(2), lunar_storm_cooldown, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_haste
3:11.999Aharpoon
[cds]
Fluffy_Pillow 91.2/100 91% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(2), lunar_storm_cooldown, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
3:11.999Mmongoose_bite
[sentst]
Fluffy_Pillow 91.2/100 91% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(2), lunar_storm_cooldown, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
3:13.261Rmongoose_bite
[sentst]
Fluffy_Pillow 71.1/100 71% focus bloodseeker, terms_of_engagement, winning_streak(2), lunar_storm_cooldown, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
3:14.524Kkill_command
[sentst]
Fluffy_Pillow 56.1/100 56% focus mongoose_fury, bloodseeker, terms_of_engagement, winning_streak(2), lunar_storm_cooldown, stormbringers_runed_citrine_proc, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
3:15.785Fflanking_strike
[sentst]
Fluffy_Pillow 81.2/100 81% focus tip_of_the_spear, mongoose_fury, bloodseeker, terms_of_engagement, winning_streak(3), lunar_storm_cooldown, stacked_deck_trinket(2), flask_of_alchemical_chaos_haste
3:17.072Nwildfire_bomb
[sentst]
Fluffy_Pillow 76.3/100 76% focus tip_of_the_spear(2), mongoose_fury, frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(3), lunar_storm_cooldown, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_haste
3:18.359Pmongoose_bite
[sentst]
Fluffy_Pillow 76.3/100 76% focus tip_of_the_spear, mongoose_fury, frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak, strike_it_rich, lunar_storm_cooldown, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_haste
3:19.646Lkill_command
[sentst]
Fluffy_Pillow 56.4/100 56% focus mongoose_fury(2), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak, lunar_storm_cooldown, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_haste
3:20.934Nwildfire_bomb
[sentst]
Fluffy_Pillow 81.2/100 81% focus tip_of_the_spear, mongoose_fury(2), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(2), lunar_storm_cooldown, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_vers
3:22.286Gkill_command
[sentst]
Fluffy_Pillow 81.0/100 81% focus mongoose_fury(2), frenzy_strikes, bloodseeker, strike_it_rich, lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_vers
3:23.635Pmongoose_bite
[sentst]
Fluffy_Pillow 100.0/100 100% focus tip_of_the_spear, mongoose_fury(2), frenzy_strikes, bloodseeker, strike_it_rich, lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_vers
3:24.985Pmongoose_bite
[sentst]
Fluffy_Pillow 77.5/100 78% focus mongoose_fury(3), frenzy_strikes, bloodseeker, lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_vers
3:26.333Lkill_command
[sentst]
Fluffy_Pillow 55.0/100 55% focus mongoose_fury(4), frenzy_strikes, bloodseeker, lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:27.683Nwildfire_bomb
[sentst]
Fluffy_Pillow 82.6/100 83% focus tip_of_the_spear, mongoose_fury(4), frenzy_strikes, bloodseeker, lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:29.033Pmongoose_bite
[sentst]
Fluffy_Pillow 80.1/100 80% focus mongoose_fury(4), bloodseeker, lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:30.382Lkill_command
[sentst]
Fluffy_Pillow 57.6/100 58% focus mongoose_fury(5), bloodseeker, lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:31.732Pmongoose_bite
[sentst]
Fluffy_Pillow 80.1/100 80% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak, lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:33.083Lkill_command
[sentst]
Fluffy_Pillow 57.6/100 58% focus mongoose_fury(5), bloodseeker, winning_streak, lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:34.434Aharpoon
[cds]
Fluffy_Pillow 80.2/100 80% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak, lunar_storm_ready, charged_bolts, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:34.434Cwildfire_bomb
[sentst]
Fluffy_Pillow 80.2/100 80% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak, lunar_storm_ready, charged_bolts, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:35.781Pmongoose_bite
[sentst]
Fluffy_Pillow 80.3/100 80% focus mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak, lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:37.128Lkill_command
[sentst]
Fluffy_Pillow 60.5/100 60% focus mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(2), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_vers
3:38.477Mmongoose_bite
[sentst]
Fluffy_Pillow 85.7/100 86% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(3), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_vers
3:39.824Oexplosive_shot
[sentst]
Fluffy_Pillow 70.9/100 71% focus bloodseeker, terms_of_engagement, winning_streak(3), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_vers
3:41.171Lkill_command
[sentst]
Fluffy_Pillow 61.1/100 61% focus bloodseeker, terms_of_engagement, winning_streak(4), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_vers
3:42.518Nwildfire_bomb
[sentst]
Fluffy_Pillow 86.4/100 86% focus tip_of_the_spear, bloodseeker, terms_of_engagement, winning_streak(4), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_vers
3:43.864Rmongoose_bite
[sentst]
Fluffy_Pillow 86.6/100 87% focus bloodseeker, terms_of_engagement, winning_streak(5), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_vers
3:45.210Pmongoose_bite
[sentst]
Fluffy_Pillow 65.4/100 65% focus mongoose_fury, bloodseeker, winning_streak(5), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_vers
3:46.558Kkill_command
[sentst]
Fluffy_Pillow 42.9/100 43% focus mongoose_fury(2), bloodseeker, winning_streak(5), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:47.900Fflanking_strike
[sentst]
Fluffy_Pillow 65.4/100 65% focus tip_of_the_spear, mongoose_fury(2), bloodseeker, winning_streak(5), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:49.242Lkill_command
[sentst]
Fluffy_Pillow 58.0/100 58% focus tip_of_the_spear(2), mongoose_fury(2), frenzy_strikes, bloodseeker, winning_streak(5), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_vers
3:50.586Pmongoose_bite
[sentst]
Fluffy_Pillow 80.5/100 80% focus tip_of_the_spear(3), mongoose_fury(2), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
3:51.929Lkill_command
[sentst]
Fluffy_Pillow 63.0/100 63% focus tip_of_the_spear(2), mongoose_fury(3), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
3:53.273Nwildfire_bomb
[sentst]
Fluffy_Pillow 85.5/100 86% focus tip_of_the_spear(3), mongoose_fury(3), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
3:54.616Pmongoose_bite
[sentst]
Fluffy_Pillow 83.0/100 83% focus tip_of_the_spear(2), mongoose_fury(3), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
3:55.959Pmongoose_bite
[sentst]
Fluffy_Pillow 60.6/100 61% focus tip_of_the_spear, mongoose_fury(4), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
3:57.302Lkill_command
[sentst]
Fluffy_Pillow 38.1/100 38% focus mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(2), flask_of_alchemical_chaos_crit
3:58.644Aharpoon
[cds]
Fluffy_Pillow 65.6/100 66% focus tip_of_the_spear, mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
3:58.644Pmongoose_bite
[sentst]
Fluffy_Pillow 65.6/100 66% focus tip_of_the_spear, mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
3:59.983Pmongoose_bite
[sentst]
Fluffy_Pillow 50.7/100 51% focus mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:01.323Pmongoose_bite
[sentst]
Fluffy_Pillow 30.9/100 31% focus mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:02.663Lkill_command
[sentst]
Fluffy_Pillow 11.1/100 11% focus mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:04.002Jcoordinated_assault
[sentst]
Fluffy_Pillow 36.3/100 36% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:05.341Suse_items
[trinkets]
Fluffy_Pillow 47.2/100 47% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_ready, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(2), suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:05.341Cwildfire_bomb
[sentst]
Fluffy_Pillow 47.2/100 47% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_ready, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(3), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:06.558Espearhead
[sentst]
Fluffy_Pillow 47.2/100 47% focus mongoose_fury(5), bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(3), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:07.775Dkill_command
[sentst]
Fluffy_Pillow 57.2/100 57% focus bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(3), house_of_cards, flask_of_alchemical_chaos_crit
4:08.993Nwildfire_bomb
[sentst]
Fluffy_Pillow 81.6/100 82% focus tip_of_the_spear(3), bloodseeker, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, stacked_deck_trinket(3), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:10.209Oexplosive_shot
[sentst]
Fluffy_Pillow 84.1/100 84% focus tip_of_the_spear(2), bloodseeker, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, stacked_deck_trinket(3), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:11.423Qkill_shot
[sentst]
Fluffy_Pillow 71.6/100 72% focus tip_of_the_spear, tip_of_the_spear_explosive, bloodseeker, coordinated_assault, winning_streak(6), eyes_closed, lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, windsingers_runed_citrine_Mastery, stacked_deck_trinket(3), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:12.636Dkill_command
[sentst]
Fluffy_Pillow 69.1/100 69% focus tip_of_the_spear_explosive, bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(3), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:13.849Rmongoose_bite
[sentst]
Fluffy_Pillow 91.7/100 92% focus tip_of_the_spear(3), bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(3), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:15.060Pmongoose_bite
[sentst]
Fluffy_Pillow 69.2/100 69% focus tip_of_the_spear(2), mongoose_fury, bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(3), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:16.274Pmongoose_bite
[sentst]
Fluffy_Pillow 46.7/100 47% focus tip_of_the_spear, mongoose_fury(2), bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(3), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:17.487Dkill_command
[sentst]
Fluffy_Pillow 24.2/100 24% focus mongoose_fury(3), bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(3), house_of_cards, suspicious_energy_drink, flask_of_alchemical_chaos_crit
4:18.700Aharpoon
[cds]
Fluffy_Pillow 46.7/100 47% focus tip_of_the_spear(3), mongoose_fury(3), bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(3), house_of_cards, flask_of_alchemical_chaos_crit
4:18.700Fflanking_strike
[sentst]
Fluffy_Pillow 46.7/100 47% focus tip_of_the_spear(3), mongoose_fury(3), bloodseeker, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(3), house_of_cards, flask_of_alchemical_chaos_crit
4:19.915Nwildfire_bomb
[sentst]
Fluffy_Pillow 41.6/100 42% focus tip_of_the_spear(3), mongoose_fury(3), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(3), house_of_cards, flask_of_alchemical_chaos_mastery
4:21.129Oexplosive_shot
[sentst]
Fluffy_Pillow 41.5/100 42% focus tip_of_the_spear(2), mongoose_fury(3), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:22.343Pmongoose_bite
[sentst]
Fluffy_Pillow 31.5/100 31% focus tip_of_the_spear, tip_of_the_spear_explosive, mongoose_fury(3), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, i_did_that, fathomdwellers_runed_citrine_proc, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:23.557Dkill_command
[sentst]
Fluffy_Pillow 11.3/100 11% focus tip_of_the_spear_explosive, mongoose_fury(4), frenzy_strikes, bloodseeker, terms_of_engagement, coordinated_assault, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:24.786Lkill_command
[sentst]
Fluffy_Pillow 35.9/100 36% focus tip_of_the_spear(3), mongoose_fury(4), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:26.140Pmongoose_bite
[sentst]
Fluffy_Pillow 61.1/100 61% focus tip_of_the_spear(3), mongoose_fury(4), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:27.495Pmongoose_bite
[sentst]
Fluffy_Pillow 41.3/100 41% focus tip_of_the_spear(2), mongoose_fury(5), frenzy_strikes, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:28.849Lkill_command
[sentst]
Fluffy_Pillow 21.4/100 21% focus tip_of_the_spear, mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:30.203Lkill_command
[sentst]
Fluffy_Pillow 43.9/100 44% focus tip_of_the_spear(2), mongoose_fury(5), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:31.559Pmongoose_bite
[sentst]
Fluffy_Pillow 66.5/100 66% focus tip_of_the_spear(3), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:32.915Iwildfire_bomb
[sentst]
Fluffy_Pillow 44.0/100 44% focus tip_of_the_spear(2), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery, storm_sewers_citrine
4:34.267Lkill_command
[sentst]
Fluffy_Pillow 41.5/100 42% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery, storm_sewers_citrine
4:35.622Cwildfire_bomb
[sentst]
Fluffy_Pillow 64.1/100 64% focus tip_of_the_spear(2), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_ready, charged_bolts, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery, storm_sewers_citrine
4:36.974Lkill_command
[sentst]
Fluffy_Pillow 61.6/100 62% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery, storm_sewers_citrine
4:38.324Pmongoose_bite
[sentst]
Fluffy_Pillow 84.1/100 84% focus tip_of_the_spear(2), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery, storm_sewers_citrine
4:39.673Lkill_command
[sentst]
Fluffy_Pillow 61.6/100 62% focus tip_of_the_spear, mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery, storm_sewers_citrine
4:41.042Aharpoon
[cds]
Fluffy_Pillow 84.3/100 84% focus deathblow, tip_of_the_spear(2), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery, storm_sewers_citrine
4:41.042Mmongoose_bite
[sentst]
Fluffy_Pillow 84.3/100 84% focus deathblow, tip_of_the_spear(2), mongoose_fury(5), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery, storm_sewers_citrine
4:42.392Qkill_shot
[sentst]
Fluffy_Pillow 69.3/100 69% focus deathblow, tip_of_the_spear, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:43.741Rmongoose_bite
[sentst]
Fluffy_Pillow 74.6/100 75% focus bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:45.091Lkill_command
[sentst]
Fluffy_Pillow 54.8/100 55% focus mongoose_fury, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:46.440Nwildfire_bomb
[sentst]
Fluffy_Pillow 80.0/100 80% focus tip_of_the_spear, mongoose_fury, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:47.791Pmongoose_bite
[sentst]
Fluffy_Pillow 80.2/100 80% focus mongoose_fury, bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:49.138Pmongoose_bite
[sentst]
Fluffy_Pillow 60.4/100 60% focus mongoose_fury(2), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_mastery
4:50.484Kkill_command
[sentst]
Fluffy_Pillow 40.8/100 41% focus mongoose_fury(3), bloodseeker, terms_of_engagement, winning_streak(6), lunar_storm_cooldown, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_haste
4:51.765Fflanking_strike
[sentst]
Fluffy_Pillow 64.6/100 65% focus tip_of_the_spear, mongoose_fury(3), bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_haste
4:53.046Oexplosive_shot
[sentst]
Fluffy_Pillow 57.1/100 57% focus tip_of_the_spear(2), mongoose_fury(3), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_haste
4:54.327Pmongoose_bite
[sentst]
Fluffy_Pillow 44.7/100 45% focus tip_of_the_spear, tip_of_the_spear_explosive, mongoose_fury(3), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_haste
4:55.611Lkill_command
[sentst]
Fluffy_Pillow 22.2/100 22% focus tip_of_the_spear_explosive, mongoose_fury(4), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, stacked_deck_trinket(3), flask_of_alchemical_chaos_haste
4:56.893Lkill_command
[sentst]
Fluffy_Pillow 44.7/100 45% focus tip_of_the_spear, mongoose_fury(4), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(3), flask_of_alchemical_chaos_haste
4:58.173Lkill_command
[sentst]
Fluffy_Pillow 67.2/100 67% focus tip_of_the_spear(2), mongoose_fury(4), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(3), flask_of_alchemical_chaos_haste
4:59.453Iwildfire_bomb
[sentst]
Fluffy_Pillow 89.8/100 90% focus tip_of_the_spear(3), mongoose_fury(4), frenzy_strikes, bloodseeker, winning_streak(6), lunar_storm_cooldown, charged_bolts, i_did_that, windsingers_runed_citrine_Mastery, stacked_deck_trinket(3), flask_of_alchemical_chaos_haste

Stats

Level Bonus (80) Race Bonus (goblin) Raid-Buffed Unbuffed Gear Amount
Strength10765-310762107620
Agility176471682086743846579 (41466)
Stamina86452-1426582406269319818
Intellect14471314908144740
Spirit00000
Health895822281253800
Focus1001000
Spell Power14908144740
Crit32.11%25.80%8257
Haste11.53%10.40%6142
Swing Speed22.97%27.51%6142
Versatility3.58%0.00%0
Attack Power7211067907469
Mastery31.89%26.67%16361
Armor437024370243702
Run Speed700

Gear

Source Slot Average Item Level: 660.00
Local Head Tireless Collector's Chained Cowl
ilevel: 658, stats: { 5,522 Armor, +31,021 Sta, +663 Crit, +1,534 Mastery, +4,529 AgiInt }
Local Neck Pendant of Insatiable Vision
ilevel: 652, stats: { +16,152 Sta, +2,291 Crit, +4,391 Mastery }
Local Shoulders Epaulettes of Failed Enforcers
ilevel: 658, stats: { 5,062 Armor, +23,266 Sta, +531 Crit, +1,117 Haste, +3,397 AgiInt }
Local Chest Tireless Collector's Battlegear
ilevel: 658, stats: { 7,363 Armor, +31,021 Sta, +650 Crit, +1,547 Haste, +4,529 AgiInt }
Local Waist Durable Information Securing Container
ilevel: 694, stats: { 5,296 Armor, +36,570 Sta, +4,751 StrAgiInt }
item effects: { equip: Durable Information Securing Container, equip: Durable Information Securing Container, use: , equip: Durable Information Securing Container }
Local Legs Tireless Collector's Armored Breeches
ilevel: 658, stats: { 6,442 Armor, +31,021 Sta, +1,457 Crit, +741 Mastery, +4,529 AgiInt }
Local Feet Dubious Table-Runners
ilevel: 655, stats: { 4,513 Armor, +22,396 Sta, +543 Crit, +1,084 Mastery, +3,303 AgiInt }
Local Wrists Torchbearer's Bracers
ilevel: 658, stats: { 3,681 Armor, +17,449 Sta, +645 Crit, +592 Haste, +2,548 AgiInt }
Local Hands Tireless Collector's Gauntlets
ilevel: 652, stats: { 3,984 Armor, +21,536 Sta, +1,084 Crit, +523 Haste, +3,212 AgiInt }
Local Finger1 The Jastor Diamond
ilevel: 671, stats: { +20,593 Sta, +1,134 Haste, +6,354 Mastery }
item effects: { equip: The Jastor Diamond, equip: The Jastor Diamond }
Local Finger2 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, singing citrines: { Stormbringer's Runed Citrine, Fathomdweller's Runed Citrine, Legendary Skipper's Citrine }
item effects: { equip: Cyrce's Circlet }
Local Trinket1 House of Cards
ilevel: 665, stats: { +4,596 StrAgiInt }
item effects: { equip: House of Cards, use: House of Cards }
Local Trinket2 Suspicious Energy Drink
ilevel: 645, stats: { +3,815 StrAgiInt }
item effects: { equip: Suspicious Energy Drink }
Local Back Cloak of Insatiable Vision
ilevel: 645, stats: { 1,839 Armor, +14,735 Sta, +534 Haste, +635 Mastery, +2,257 StrAgiInt }
Local Main Hand Void-Touched Spear
ilevel: 671, weapon: { 9,697 - 18,011, 3.6 }, stats: { +5,113 Agi, +36,609 Sta, +695 Haste, +1,622 Mastery }, temporary_enchant: Ironclaw Sharpened Weapon
Local Tabard Sacred Templar's Tabard
ilevel: 1

Profile

hunter="Tiftiv"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/blackrock/tiftiv"
spec=survival
level=80
race=goblin
role=attack
position=back
talents=C8PAIKKe/J2LdooRW3uJg8yy0PGYgtxoxyAysFsNzMbzYmZMzMGYMMzMzMz2AAAAAAAgmhhxMzMmhZYMMzwYYmlZGWAAAAAAGA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=the_sushi_special
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=stronger_trinket_slot,op=setif,value=1,value_else=2,condition=!trinket.2.is.house_of_cards&(trinket.1.is.house_of_cards|!trinket.2.has_cooldown|trinket.1.has_use_buff&(!trinket.2.has_use_buff|trinket.2.cooldown.duration<trinket.1.cooldown.duration|trinket.2.cast_time<trinket.1.cast_time|trinket.2.cast_time=trinket.1.cast_time&trinket.2.cooldown.duration=trinket.1.cooldown.duration)|!trinket.1.has_use_buff&(!trinket.2.has_use_buff&(trinket.2.cooldown.duration<trinket.1.cooldown.duration|trinket.2.cast_time<trinket.1.cast_time|trinket.2.cast_time=trinket.1.cast_time&trinket.2.cooldown.duration=trinket.1.cooldown.duration)))

# Executed every time the actor is available.
actions=auto_attack
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=plst,if=active_enemies<3&talent.howl_of_the_pack_leader
actions+=/call_action_list,name=plcleave,if=active_enemies>2&talent.howl_of_the_pack_leader
actions+=/call_action_list,name=sentst,if=active_enemies<3&!talent.howl_of_the_pack_leader
actions+=/call_action_list,name=sentcleave,if=active_enemies>2&!talent.howl_of_the_pack_leader
actions+=/arcane_torrent
actions+=/bag_of_tricks
actions+=/lights_judgment

actions.cds=blood_fury,if=buff.coordinated_assault.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault
actions.cds+=/invoke_external_buff,name=power_infusion,if=(buff.coordinated_assault.up&buff.coordinated_assault.remains>7&!buff.power_infusion.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault)
actions.cds+=/harpoon,if=prev.kill_command
actions.cds+=/ancestral_call,if=buff.coordinated_assault.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault
actions.cds+=/fireblood,if=buff.coordinated_assault.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault
actions.cds+=/berserking,if=buff.coordinated_assault.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault|time_to_die<13
actions.cds+=/muzzle
actions.cds+=/potion,if=target.time_to_die<25|buff.coordinated_assault.up|!talent.coordinated_assault&cooldown.spearhead.remains|!talent.spearhead&!talent.coordinated_assault
actions.cds+=/aspect_of_the_eagle,if=target.distance>=6

actions.plcleave=spearhead,if=cooldown.coordinated_assault.remains
actions.plcleave+=/raptor_bite,target_if=max:dot.serpent_sting.remains,if=buff.strike_it_rich.up&buff.strike_it_rich.remains<gcd|buff.hogstrider.remains&boar_charge.remains>0|buff.hogstrider.remains<gcd&buff.hogstrider.up|buff.hogstrider.remains&buff.strike_it_rich.remains|raid_event.adds.exists&raid_event.adds.remains<4
actions.plcleave+=/kill_command,target_if=min:bloodseeker.remains,if=buff.relentless_primal_ferocity.up&buff.tip_of_the_spear.stack<1
actions.plcleave+=/fury_of_the_eagle,if=buff.tip_of_the_spear.stack>0
actions.plcleave+=/explosive_shot,if=buff.tip_of_the_spear.stack>0
actions.plcleave+=/wildfire_bomb
actions.plcleave+=/kill_command,target_if=min:bloodseeker.remains,if=(buff.howl_of_the_pack_leader_wyvern.remains|buff.howl_of_the_pack_leader_boar.remains|buff.howl_of_the_pack_leader_bear.remains)
actions.plcleave+=/flanking_strike,if=buff.tip_of_the_spear.stack=2|buff.tip_of_the_spear.stack=1
actions.plcleave+=/butchery
actions.plcleave+=/coordinated_assault
actions.plcleave+=/fury_of_the_eagle,if=buff.tip_of_the_spear.stack>0
actions.plcleave+=/kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max
actions.plcleave+=/explosive_shot
actions.plcleave+=/kill_shot,if=buff.deathblow.remains&talent.sic_em
actions.plcleave+=/raptor_bite,target_if=min:dot.serpent_sting.remains,if=!talent.contagious_reagents
actions.plcleave+=/raptor_bite,target_if=max:dot.serpent_sting.remains

actions.plst=kill_command,target_if=min:bloodseeker.remains,if=(buff.relentless_primal_ferocity.up&buff.tip_of_the_spear.stack<1)|(buff.howl_of_the_pack_leader_wyvern.remains|buff.howl_of_the_pack_leader_boar.remains|buff.howl_of_the_pack_leader_bear.remains)
actions.plst+=/spearhead,if=cooldown.coordinated_assault.remains
actions.plst+=/flanking_strike,if=buff.tip_of_the_spear.stack>0
actions.plst+=/raptor_bite,target_if=min:dot.serpent_sting.remains,if=!dot.serpent_sting.ticking&target.time_to_die>12&(!talent.contagious_reagents|active_dot.serpent_sting=0)
actions.plst+=/raptor_bite,target_if=max:dot.serpent_sting.remains,if=talent.contagious_reagents&active_dot.serpent_sting<active_enemies&dot.serpent_sting.remains
actions.plst+=/butchery
actions.plst+=/kill_command,if=buff.strike_it_rich.remains&buff.tip_of_the_spear.stack<1
actions.plst+=/raptor_bite,if=buff.strike_it_rich.remains&buff.tip_of_the_spear.stack>0
actions.plst+=/fury_of_the_eagle,if=buff.tip_of_the_spear.stack>0&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.in>40)
actions.plst+=/coordinated_assault
actions.plst+=/wildfire_bomb
actions.plst+=/raptor_bite,target_if=max:dot.serpent_sting.remains,if=buff.howl_of_the_pack_leader_cooldown.up&buff.howl_of_the_pack_leader_cooldown.remains<2*gcd
actions.plst+=/kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max&(!buff.relentless_primal_ferocity.up|(buff.relentless_primal_ferocity.up&buff.tip_of_the_spear.stack<1|focus<30))
actions.plst+=/explosive_shot,if=active_enemies=2
actions.plst+=/raptor_bite,target_if=min:dot.serpent_sting.remains,if=!talent.contagious_reagents
actions.plst+=/raptor_bite,target_if=max:dot.serpent_sting.remains
actions.plst+=/kill_shot
actions.plst+=/explosive_shot

actions.sentcleave=wildfire_bomb,if=!buff.lunar_storm_cooldown.remains
actions.sentcleave+=/kill_command,target_if=min:bloodseeker.remains,if=buff.relentless_primal_ferocity.up&buff.tip_of_the_spear.stack<1
actions.sentcleave+=/wildfire_bomb,if=buff.tip_of_the_spear.stack>0&cooldown.wildfire_bomb.charges_fractional>1.7|cooldown.wildfire_bomb.charges_fractional>1.9|(talent.bombardier&cooldown.coordinated_assault.remains<2*gcd)|talent.butchery&cooldown.butchery.remains<gcd
actions.sentcleave+=/fury_of_the_eagle,if=buff.tip_of_the_spear.stack>0
actions.sentcleave+=/raptor_bite,target_if=max:dot.serpent_sting.remains,if=buff.strike_it_rich.up&buff.strike_it_rich.remains<gcd
actions.sentcleave+=/butchery
actions.sentcleave+=/explosive_shot,if=buff.tip_of_the_spear.stack>0
actions.sentcleave+=/coordinated_assault,if=!talent.bombardier|talent.bombardier&cooldown.wildfire_bomb.charges_fractional<1
actions.sentcleave+=/flanking_strike,if=(buff.tip_of_the_spear.stack=2|buff.tip_of_the_spear.stack=1)
actions.sentcleave+=/kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max
actions.sentcleave+=/wildfire_bomb,if=buff.tip_of_the_spear.stack>0
actions.sentcleave+=/explosive_shot
actions.sentcleave+=/kill_shot,if=buff.deathblow.remains&talent.sic_em
actions.sentcleave+=/raptor_bite,target_if=min:dot.serpent_sting.remains,if=!talent.contagious_reagents
actions.sentcleave+=/raptor_bite,target_if=max:dot.serpent_sting.remains

actions.sentst=wildfire_bomb,if=!buff.lunar_storm_cooldown.remains
actions.sentst+=/kill_command,target_if=min:bloodseeker.remains,if=(buff.relentless_primal_ferocity.up&buff.tip_of_the_spear.stack<1)
actions.sentst+=/spearhead,if=cooldown.coordinated_assault.remains
actions.sentst+=/flanking_strike,if=buff.tip_of_the_spear.stack>0
actions.sentst+=/kill_command,if=buff.strike_it_rich.remains&buff.tip_of_the_spear.stack<1
actions.sentst+=/mongoose_bite,if=buff.strike_it_rich.remains&buff.coordinated_assault.up
actions.sentst+=/wildfire_bomb,if=(buff.lunar_storm_cooldown.remains>full_recharge_time-gcd)&(buff.tip_of_the_spear.stack>0&cooldown.wildfire_bomb.charges_fractional>1.7|cooldown.wildfire_bomb.charges_fractional>1.9)|(talent.bombardier&cooldown.coordinated_assault.remains<2*gcd)
actions.sentst+=/butchery
actions.sentst+=/coordinated_assault,if=!talent.bombardier|talent.bombardier&cooldown.wildfire_bomb.charges_fractional<1
actions.sentst+=/fury_of_the_eagle,if=buff.tip_of_the_spear.stack>0
actions.sentst+=/kill_command,target_if=min:bloodseeker.remains,if=buff.tip_of_the_spear.stack<1&cooldown.flanking_strike.remains<gcd
actions.sentst+=/kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max&(!buff.relentless_primal_ferocity.up|(buff.relentless_primal_ferocity.up&(buff.tip_of_the_spear.stack<1|focus<30)))
actions.sentst+=/mongoose_bite,if=buff.mongoose_fury.remains<gcd&buff.mongoose_fury.stack>0
actions.sentst+=/wildfire_bomb,if=buff.tip_of_the_spear.stack>0&buff.lunar_storm_cooldown.remains>full_recharge_time&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.in>15)
actions.sentst+=/explosive_shot
actions.sentst+=/mongoose_bite,if=buff.mongoose_fury.remains
actions.sentst+=/kill_shot
actions.sentst+=/raptor_bite,target_if=min:dot.serpent_sting.remains,if=!talent.contagious_reagents
actions.sentst+=/raptor_bite,target_if=max:dot.serpent_sting.remains

actions.trinkets=variable,name=buff_sync_ready,value=buff.coordinated_assault.up
actions.trinkets+=/variable,name=buff_sync_remains,value=cooldown.coordinated_assault.remains
actions.trinkets+=/variable,name=buff_sync_active,value=buff.coordinated_assault.up
actions.trinkets+=/variable,name=damage_sync_active,value=1
actions.trinkets+=/variable,name=damage_sync_remains,value=0
actions.trinkets+=/use_items,slots=trinket1:trinket2,if=this_trinket.has_use_buff&(variable.buff_sync_ready&(variable.stronger_trinket_slot=this_trinket_slot|other_trinket.cooldown.remains)|!variable.buff_sync_ready&(variable.stronger_trinket_slot=this_trinket_slot&(variable.buff_sync_remains>this_trinket.cooldown.duration%3&fight_remains>this_trinket.cooldown.duration+20|other_trinket.has_use_buff&other_trinket.cooldown.remains>variable.buff_sync_remains-15&other_trinket.cooldown.remains-5<variable.buff_sync_remains&variable.buff_sync_remains+45>fight_remains)|variable.stronger_trinket_slot!=this_trinket_slot&(other_trinket.cooldown.remains&(other_trinket.cooldown.remains-5<variable.buff_sync_remains&variable.buff_sync_remains>=20|other_trinket.cooldown.remains-5>=variable.buff_sync_remains&(variable.buff_sync_remains>this_trinket.cooldown.duration%3|this_trinket.cooldown.duration<fight_remains&(variable.buff_sync_remains+this_trinket.cooldown.duration>fight_remains)))|other_trinket.cooldown.ready&variable.buff_sync_remains>20&variable.buff_sync_remains<other_trinket.cooldown.duration%3)))|!this_trinket.has_use_buff&(this_trinket.cast_time=0|!variable.buff_sync_active)&(!this_trinket.is.junkmaestros_mega_magnet|buff.junkmaestros_mega_magnet.stack>10)&(!other_trinket.has_cooldown&(variable.damage_sync_active|this_trinket.is.junkmaestros_mega_magnet&buff.junkmaestros_mega_magnet.stack>25|!this_trinket.is.junkmaestros_mega_magnet&variable.damage_sync_remains>this_trinket.cooldown.duration%3)|other_trinket.has_cooldown&(!other_trinket.has_use_buff&(variable.stronger_trinket_slot=this_trinket_slot|other_trinket.cooldown.remains)&(variable.damage_sync_active|this_trinket.is.junkmaestros_mega_magnet&buff.junkmaestros_mega_magnet.stack>25|variable.damage_sync_remains>this_trinket.cooldown.duration%3&!this_trinket.is.junkmaestros_mega_magnet|other_trinket.cooldown.remains-5<variable.damage_sync_remains&variable.damage_sync_remains>=20)|other_trinket.has_use_buff&(variable.damage_sync_active|this_trinket.is.junkmaestros_mega_magnet&buff.junkmaestros_mega_magnet.stack>25|!this_trinket.is.junkmaestros_mega_magnet&variable.damage_sync_remains>this_trinket.cooldown.duration%3)&(other_trinket.cooldown.remains>=20|other_trinket.cooldown.remains-5>variable.buff_sync_remains)))|fight_remains<25&(variable.stronger_trinket_slot=this_trinket_slot|other_trinket.cooldown.remains)

head=tireless_collectors_chained_cowl,id=229271,bonus_id=6652/10355/12176/8094/12178/11960/11988/1507/10255
neck=pendant_of_insatiable_vision,id=236913,bonus_id=6652/10395/10392/11215/11982/1501/10255
shoulders=epaulettes_of_failed_enforcers,id=228860,bonus_id=6652/11966/10354/11984/1507/10255
back=cloak_of_insatiable_vision,id=236970,bonus_id=11964/6652/11980/11215/1494/10255
chest=tireless_collectors_battlegear,id=229274,bonus_id=6652/10355/8094/12178/11958/11988/1507/10255
tabard=sacred_templars_tabard,id=233290
wrists=torchbearers_bracers,id=211028,bonus_id=6652/12176/11964/13250/11988/3237/10255
hands=tireless_collectors_gauntlets,id=229272,bonus_id=10354/11959/6652/12179/11982/1501/10255
waist=durable_information_securing_container,id=245965,bonus_id=12531/1482
legs=tireless_collectors_armored_breeches,id=229270,bonus_id=10355/11961/6652/12178/11988/1507/10255
feet=dubious_tablerunners,id=228883,bonus_id=6652/11967/10355/11987/1504/10255
finger1=the_jastor_diamond,id=231265,bonus_id=6652/10394/10392/10355/12372/1520/10255
finger2=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228638/228639/228646/0
trinket1=house_of_cards,id=230027,bonus_id=6652/10355/11990/1514/10255
trinket2=suspicious_energy_drink,id=235363,bonus_id=6652/11980/1517/10255
main_hand=voidtouched_spear,id=236890,bonus_id=6652/12372/1520/10255

# Gear Summary
# gear_ilvl=659.87
# gear_agility=46579
# gear_stamina=319818
# gear_attack_power=469
# gear_crit_rating=7864
# gear_haste_rating=6142
# gear_mastery_rating=16361
# gear_armor=43702
# set_bonus=thewarwithin_season_2_2pc=1
# set_bonus=thewarwithin_season_2_4pc=1

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 54881567
Max Event Queue: 102
Sim Seconds: 3007014
CPU Seconds: 76.9194
Physical Seconds: 16.6039
Speed Up: 39093

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Tiftiv Tiftiv augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Tiftiv Tiftiv auto_attack_mh 0 18097431 60322 32.32 86504 173451 161.6 161.6 29.3% 0.0% 0.0% 0.0% 2.21sec 25853447 300.01sec
Tiftiv Tiftiv coordinated_assault 360952 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.75sec 0 300.01sec
Tiftiv Tiftiv coordinated_assault_player 360969 1135102 3784 0.60 292875 597149 0.0 3.0 29.0% 0.0% 0.0% 0.0% 0.00sec 1621572 300.01sec
Tiftiv Tiftiv_duck coordinated_assault 360969 2292925 7643 0.60 601372 1199939 3.0 3.0 28.1% 0.0% 0.0% 0.0% 120.75sec 3275605 300.01sec
Tiftiv Tiftiv explosive_shot 212431 0 0 0.00 0 0 13.9 0.0 0.0% 0.0% 0.0% 0.0% 21.54sec 0 300.01sec
Tiftiv Tiftiv explosive_shot_damage 212680 24924070 83077 2.75 1206743 2896021 0.0 13.7 36.0% 0.0% 0.0% 0.0% 0.00sec 24924070 300.01sec
Tiftiv Tiftiv flanking_strike 269751 0 0 0.00 0 0 10.0 0.0 0.0% 0.0% 0.0% 0.0% 31.13sec 0 300.01sec
Tiftiv Tiftiv flanking_strike_player 269752 22332653 74439 2.00 1334765 3355994 0.0 10.0 44.5% 0.0% 0.0% 0.0% 0.00sec 31903758 300.01sec
Tiftiv Tiftiv flanking_strike_merciless_blow ticks -1217375 24124976 80417 20.25 147861 364826 0.0 101.3 41.7% 0.0% 0.0% 0.0% 0.00sec 24124976 300.01sec
Tiftiv Tiftiv_duck flanking_strike 259516 23558885 78527 2.00 1303200 3678074 10.0 10.0 44.4% 0.0% 0.0% 0.0% 31.13sec 33655516 300.01sec
Tiftiv Tiftiv flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Tiftiv Tiftiv food 457302 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Tiftiv Tiftiv harpoon 190925 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.65sec 0 300.01sec
Tiftiv Tiftiv harpoon_terms_of_engagement 271625 1554343 5181 2.84 77126 172352 0.0 14.2 34.0% 0.0% 0.0% 0.0% 0.00sec 2220487 300.01sec
Tiftiv Tiftiv kill_command 259489 0 0 0.00 0 0 79.3 0.0 0.0% 0.0% 0.0% 0.0% 3.73sec 0 300.01sec
Tiftiv Tiftiv arcane_shot_quick_shot 185358 7409008 24696 4.76 221917 490273 0.0 23.8 33.4% 0.0% 0.0% 0.0% 0.00sec 7409008 300.01sec
Tiftiv Tiftiv_duck kill_command 259277 25177616 83922 15.85 225877 500978 79.3 79.3 33.4% 0.0% 0.0% 0.0% 3.73sec 41582776 300.01sec
Tiftiv Tiftiv_duck kill_command ticks -259277 5614789 18716 35.90 21463 49610 79.3 179.5 34.9% 0.0% 0.0% 0.0% 3.73sec 41582776 300.01sec
Tiftiv Tiftiv kill_shot 320976 6045815 20152 0.95 850266 2037986 4.8 4.8 35.2% 0.0% 0.0% 0.0% 52.57sec 8636869 300.01sec
Tiftiv Tiftiv legendary_skippers_citrine 462962 0 0 0.00 0 0 26.8 0.0 0.0% 0.0% 0.0% 0.0% 10.80sec 0 300.01sec
Tiftiv Tiftiv lightning_strike 1236111 10129281 33763 8.71 180300 360864 43.5 43.5 29.0% 0.0% 0.0% 0.0% 5.98sec 10129281 300.01sec
Tiftiv Tiftiv lunar_storm_initial 1217459 2720587 9068 2.05 202246 416943 0.0 10.2 29.5% 0.0% 0.0% 0.0% 0.00sec 2720587 300.01sec
Tiftiv Tiftiv lunar_storm_periodic 450883 100447171 334811 59.94 211108 506985 0.0 299.7 41.9% 0.0% 0.0% 0.0% 0.00sec 100447171 300.01sec
Tiftiv Tiftiv mariners_hallowed_citrine 462960 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 69.82sec 0 300.01sec
Tiftiv Tiftiv mongoose_bite 259387 157056855 523503 16.25 1312650 3154137 81.3 81.3 33.7% 0.0% 0.0% 0.0% 3.57sec 224366711 300.01sec
Tiftiv Tiftiv old_salts_bardic_citrine 462959 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 68.67sec 0 300.01sec
Tiftiv Tiftiv potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.69sec 0 300.01sec
Tiftiv Tiftiv sentinel ticks -450412 39868713 132896 0.00 185914 420978 0.0 0.0 34.4% 0.0% 0.0% 0.0% 0.00sec 39868713 300.01sec
Tiftiv Tiftiv serpent_sting_vipers_venom 259491 8863321 29543 16.25 76566 172947 0.0 81.2 33.8% 0.0% 0.0% 0.0% 0.00sec 28984188 300.01sec
Tiftiv Tiftiv serpent_sting_vipers_venom ticks -259491 20120867 67070 23.20 121846 273169 0.0 116.0 34.1% 0.0% 0.0% 0.0% 0.00sec 28984188 300.01sec
Tiftiv Tiftiv spearhead ticks -360966 10745523 35818 14.10 82294 199870 5.4 70.5 59.7% 0.0% 0.0% 0.0% 61.09sec 10745523 300.01sec
Tiftiv Tiftiv squall_sailors_citrine 462952 1240699 4136 0.49 392814 785664 2.5 2.5 28.2% 0.0% 0.0% 0.0% 68.50sec 1240699 300.01sec
Tiftiv Tiftiv storm_sewers_citrine 462958 0 0 0.48 0 0 2.4 2.4 0.0% 0.0% 0.0% 0.0% 70.43sec 1529107 300.01sec
Tiftiv Tiftiv storm_sewers_citrine_damage 468422 232153 774 0.48 74177 148471 2.4 2.4 29.2% 0.0% 0.0% 0.0% 70.43sec 232153 300.01sec
Tiftiv Tiftiv summon_pet 883 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Tiftiv Tiftiv thunderlords_crackling_citrine 462951 2221701 7405 0.49 706933 1415596 2.4 2.4 29.0% 0.0% 0.0% 0.0% 68.65sec 2221701 300.01sec
Tiftiv Tiftiv undersea_overseers_citrine 462953 1486768 4956 0.49 470893 943667 2.4 2.4 29.2% 0.0% 0.0% 0.0% 69.44sec 1486768 300.01sec
Tiftiv Tiftiv wildfire_bomb 259495 0 0 0.00 0 0 40.5 0.0 0.0% 0.0% 0.0% 0.0% 7.41sec 0 300.01sec
Tiftiv Tiftiv wildfire_bomb_damage 265157 46967324 156552 8.10 770868 1842829 0.0 40.5 36.3% 0.0% 0.0% 0.0% 0.00sec 46967324 300.01sec
Tiftiv Tiftiv wildfire_bomb_dot ticks -269747 49523734 165079 41.58 159709 377580 0.0 207.9 36.0% 0.0% 0.0% 0.0% 0.00sec 49523734 300.01sec
Tiftiv Tiftiv windsingers_runed_citrine_proc 462534 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 66.41sec 0 300.01sec
Tiftiv Tiftiv_duck claw 16827 4966091 16553 17.99 35949 91345 89.9 89.9 34.8% 0.0% 0.0% 0.0% 3.32sec 7094408 300.01sec
Tiftiv Tiftiv_duck melee 0 15349825 51164 52.86 39959 92179 264.3 264.3 34.7% 0.0% 0.0% 0.0% 1.12sec 21928299 300.01sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health2,061,919.50.00.00%0.0100.0%

Scale Factors for other metrics

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Lunar Storm10.2289.530.7s1.0s18.9s64.52%0.00%289.5 (289.5)9.6

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_lunar_storm
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 62.1s
  • trigger_min/max:0.4s / 50.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.6s
  • uptime_min/max:57.82% / 66.53%

Stack Uptimes

  • lunar_storm_1:64.52%

Spelldata

  • id:450884
  • name:Lunar Storm
  • tooltip:Damage taken from {$@=}auracaster and their pets increased by {$=}w1%.
  • description:{$@spelldesc450385=Every {$451803d=30 seconds} your next {$?s137016=false}[Rapid Fire][Wildfire Bomb] launches a celestial arrow that conjures a {$450978s1=12} yd radius Lunar Storm at the target's location dealing {$1217459s1=0} Arcane damage. For the next {$450978d=12 seconds}, a random enemy affected by Sentinel within your Lunar Storm gets struck for {$450883s1=0} Arcane damage every {$450978t2=0.400} sec. Any target struck by this effect takes {$450884s2=10}% increased damage from you and your pet for {$450884d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Outland Venom1.034.60.0s8.5s299.0s99.66%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_outland_venom
  • max_stacks:8
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:1.0s / 36.0s
  • trigger_pct:100.00%
  • duration_min/max:239.0s / 359.0s
  • uptime_min/max:99.58% / 99.72%

Stack Uptimes

  • outland_venom_1:0.60%
  • outland_venom_2:25.97%
  • outland_venom_3:43.55%
  • outland_venom_4:21.77%
  • outland_venom_5:7.78%

Spelldata

  • id:459941
  • name:Outland Venom
  • tooltip:Damage taken from {$@=}auracaster's critical strikes increased by {$=}w1%.
  • description:{$@spelldesc459939=Each damage over time effect on a target increases the critical strike damage they receive from you by {$459941s1=2}%.}
  • max_stacks:8
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sentinel1.1283.7136.4s1.0s265.3s99.72%0.00%127.2 (127.2)0.0

Buff Details

  • buff initial source:Tiftiv
  • cooldown name:buff_sentinel
  • max_stacks:10
  • base duration:1200.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 348.7s
  • trigger_min/max:0.0s / 27.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.8s
  • uptime_min/max:92.81% / 99.97%

Stack Uptimes

  • sentinel_1:0.17%
  • sentinel_2:0.64%
  • sentinel_3:1.21%
  • sentinel_4:2.23%
  • sentinel_5:4.09%
  • sentinel_6:7.02%
  • sentinel_7:11.20%
  • sentinel_8:16.94%
  • sentinel_9:28.67%
  • sentinel_10:27.56%

Spelldata

  • id:450387
  • name:Sentinel
  • tooltip:Sentinel from {$@=}auracaster has a chance to start dealing {$450412s1=0} Arcane damage every sec.
  • description:{$@spelldesc450369=Your attacks have a chance to apply Sentinel on the target, stacking up to {$450387u=10} times. While Sentinel stacks are higher than {$s1=3}, applying Sentinel has a chance to trigger an implosion, causing a stack to be consumed on the target every sec to deal {$450412s1=0} Arcane damage. }
  • max_stacks:10
  • duration:1200.00
  • cooldown:0.00
  • default_chance:101.00%
duck: Spearhead5.40.061.2s61.2s9.8s17.60%0.00%0.0 (0.0)5.2

Buff Details

  • buff initial source:Tiftiv_duck
  • cooldown name:buff_spearhead
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:2.9s / 67.0s
  • trigger_min/max:60.0s / 67.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:16.02% / 19.66%

Stack Uptimes

  • spearhead_1:17.60%

Spelldata

  • id:1221386
  • name:Spearhead
  • tooltip:{$@=}auracaster has a {$s2=30}% increased chance to critically strike this target{$?s378962=false}[ and their critical strikes deal {$378962s2=30}% increased damage.][.]
  • description:{$@spelldesc360966=You give the signal, and your pet charges your target, bleeding them for {$378957=}o1 damage over {$378957d=10 seconds} and increasing you and your pet's chance to critically strike your target by {$378957s2=30}% for {$378957d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 300.01
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 2116326.93
Minimum 1872647.05
Maximum 2517040.75
Spread ( max - min ) 644393.70
Range [ ( max - min ) / 2 * 100% ] 15.22%
Standard Deviation 78300.1788
5th Percentile 1996621.25
95th Percentile 2254415.03
( 95th Percentile - 5th Percentile ) 257793.78
Mean Distribution
Standard Deviation 783.0409
95.00% Confidence Interval ( 2114792.20 - 2117861.66 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5259
0.1 Scale Factor Error with Delta=300 52337043
0.05 Scale Factor Error with Delta=300 209348170
0.01 Scale Factor Error with Delta=300 5233704238
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health04923824060
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.