Thyraelius missing 'use_item' action for item "fyralath_the_dreamrender" (slot=main_hand)
Disable this warning by adding 'use_item' actions into the action priority list for the actor(s), or add "use_item_verification=0" to your list of options passed to Simulationcraft.

SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.5.57212 Live (hotfix 2024-10-25/57212, git build 09a701d6e5)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Priest

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-10-25 Psychic Link coefficient changed to 30%
Psychic Link (effect#1) base_value 30.00 25.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Thyraelius : 494,195 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
494,194.8494,194.8273.1 / 0.055%54,839.4 / 11.1%550,469.5
Resource Out In Waiting APM Active
Holy Power0.90.97.55%51.6100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/thyraelius
TalentCYEA5ba6OK14IUITjS1kSUVJcBAAAYAgRstNzstsNzYzM2WMbDAAAAAAzWTzwwMjtZwsNMmlZW2GzgZYYZhNAAAyMTbzysNDAYDYAAjZYA
Scale Factors for Thyraelius Damage Per Second
Wdps Str Mastery Crit Haste Vers
Scale Factors 63.54 11.46 8.06 6.75 6.00 5.80
Normalized 5.54 1.00 0.70 0.59 0.52 0.51
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.19 0.17 0.17 0.17 0.17 0.17
Ranking
  • Wdps > Str > Mastery > Crit > Haste > Vers
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, Strength=11.46, CritRating=6.75, HasteRating=6.00, MasteryRating=8.06, Versatility=5.80, Dps=63.54 )

Scale Factors for other metrics

Scale Factors for Thyraelius Priority Target Damage Per Second
Wdps Str Mastery Crit Haste Vers
Scale Factors 63.54 11.46 8.06 6.75 6.00 5.80
Normalized 5.54 1.00 0.70 0.59 0.52 0.51
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.19 0.17 0.17 0.17 0.17 0.17
Ranking
  • Wdps > Str > Mastery > Crit > Haste > Vers
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, Strength=11.46, CritRating=6.75, HasteRating=6.00, MasteryRating=8.06, Versatility=5.80, Dps=63.54 )
Scale Factors for Thyraelius Damage Per Second (Effective)
Wdps Str Mastery Crit Haste Vers
Scale Factors 63.54 11.46 8.06 6.75 6.00 5.80
Normalized 5.54 1.00 0.70 0.59 0.52 0.51
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Str > Mastery > Crit > Haste > Vers
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, Strength=11.46, CritRating=6.75, HasteRating=6.00, MasteryRating=8.06, Versatility=5.80, Dps=63.54 )
Scale Factors for Thyraelius Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Fight Length
Str Haste Vers Wdps Crit Mastery
Scale Factors 0.00 0.00 0.00 0.00 0.00 -0.00
Normalized 1.00 0.33 0.32 0.32 0.01 -0.33
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Str > Haste > Vers > Wdps > Crit > Mastery
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, Strength=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=-0.00, Versatility=0.00, Dps=0.00 )
Scale Factors for Raid Damage Per Second
Wdps Str Mastery Crit Haste Vers
Scale Factors 63.54 11.46 8.06 6.75 6.00 5.80
Normalized 5.54 1.00 0.70 0.59 0.52 0.51
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.19 0.17 0.17 0.17 0.17 0.17
Ranking
  • Wdps > Str > Mastery > Crit > Haste > Vers
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, Strength=11.46, CritRating=6.75, HasteRating=6.00, MasteryRating=8.06, Versatility=5.80, Dps=63.54 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Thyraelius494,195
Blade of Justice 32,8716.6%62.24.75s158,419145,684Direct62.2133,414274,255158,41917.8%

Stats Details: Blade Of Justice

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage62.1962.190.000.000.001.08740.00009,851,995.709,851,995.700.00%145,683.55145,683.55
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.24%51.152974133,413.86106,182194,756133,449.59123,179144,5776,823,7446,823,7440.00%
crit17.76%11.04126274,255.46217,673399,249274,462.29223,682339,6423,028,2513,028,2510.00%

Action Details: Blade Of Justice

  • id:184575
  • school:holy
  • range:12.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:184575
  • name:Blade of Justice
  • school:holy
  • tooltip:
  • description:{$?s403826=true}[Pierce enemies][Pierce an enemy] with a blade of light, dealing {$s1=0} Holy damage{$?s403826=true}[ to your target and {$404358s1=0} Holy damage to nearby enemies.][.] |cFFFFFFFFGenerates {$s2=1} Holy Power.|r

Action Priority List

    generators
    [R]:62.19
  • if_expr:holy_power<=3|!talent.holy_blade

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Cooldown DurationRetribution Paladin1370273SET1.000
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370276SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin13702719SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
(blade_of_justice_) Consecration 0 (6,667)0.0% (1.3%)21.613.90s92,6120

Stats Details: Blade Of Justice Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage21.590.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Blade Of Justice Consecration

  • id:26573
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=true}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=false}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
    (blade_of_justice_) Consecration 6,6671.3%0.00.00s00Periodic346.34,8609,9915,77217.8%0.0%

Stats Details: Blade Of Justice Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00346.320.000.00000.00001,999,062.651,999,062.650.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.22%284.761893864,860.283,9377,2204,860.764,5925,1361,384,0151,384,0150.00%
crit17.78%61.56281069,990.988,07014,8029,997.299,14211,015615,047615,0470.00%

Action Details: Blade Of Justice Consecration Tick

  • id:81297
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:11.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Divine Storm 5,183 (5,865)1.0% (1.2%)7.735.17s229,826208,763Direct7.7 (15.3)170,796351,822203,12817.9% (18.0%)

Stats Details: Divine Storm

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage7.667.660.000.000.001.10090.00001,554,979.131,554,979.130.00%208,762.58208,762.58
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.14%6.29017170,796.06101,935310,224170,441.020259,7261,074,0301,074,0300.00%
crit17.86%1.37010351,822.07208,966641,624263,106.470598,230480,949480,9490.00%

Action Details: Divine Storm

  • id:53385
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Unleashes a whirl of divine energy, dealing {$?s405289=true}[{$=}{{$s1=0}*1.05} Radiant][{$s1=0} Holy] damage to all nearby enemies. Deals reduced damage beyond {$s2=5} targets.

Action Priority List

    finishers
    [J]:7.66
  • if_expr:variable.ds_castable&!buff.hammer_of_light_ready.up&(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Divine Storm (_tempest) 6820.1%7.735.17s26,7090Direct7.722,43246,10926,70718.1%

Stats Details: Divine Storm Tempest

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage7.667.660.000.000.000.00000.0000204,471.90204,471.900.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.93%6.2701822,431.5117,72833,12222,403.90031,828140,699140,6990.00%
crit18.07%1.380846,109.3436,34267,90034,400.71067,11763,77363,7730.00%

Action Details: Divine Storm Tempest

  • id:224239
  • school:holyfire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:224239
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:{$@spelldesc53385=Unleashes a whirl of divine energy, dealing {$?s405289=true}[{$=}{{$s1=0}*1.05} Radiant][{$s1=0} Holy] damage to all nearby enemies. Deals reduced damage beyond {$s2=5} targets.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Divine Toll 0 (10,790)0.0% (2.2%)5.461.75s603,675499,384

Stats Details: Divine Toll

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.360.000.000.000.001.20890.00000.000.000.00%499,383.92499,383.92

Action Details: Divine Toll

  • id:375576
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:375576
  • name:Divine Toll
  • school:holy
  • tooltip:
  • description:Instantly cast {$?a137029=false}[Holy Shock]?a137028[Avenger's Shield]?a137027[Judgment][Holy Shock, Avenger's Shield, or Judgment] on up to {$s1=5} targets within {$=}A2 yds.{$?=}c3[ Divine Toll's Judgment deals {$326011s1=100}% increased damage.][]{$?=}c2[ Generates {$s5=1} Holy Power per target hit.][]

Action Priority List

    generators
    [N]:5.36
  • if_expr:holy_power<=2&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)&(cooldown.avenging_wrath.remains>15|cooldown.crusade.remains>15|talent.radiant_glory|fight_remains<8)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Global CooldownPaladin1370268SET1.000
    (divine_toll_) Judgment 3,9700.8%5.461.75s222,1220Direct5.4188,313385,563222,19717.2%

Stats Details: Divine Toll Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.365.360.000.000.000.00000.00001,190,138.331,190,138.330.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.82%4.4406188,312.64166,668282,141188,272.690257,402835,347835,3470.00%
crit17.18%0.9205385,562.53341,670576,421243,592.790565,042354,791354,7910.00%

Action Details: Divine Toll Judgment

  • id:20271
  • school:holystrike
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.671596
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.11
  • base_multiplier:3.15

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    (divine_resonance_) Judgment 6,8201.4%15.618.71s131,3110Direct15.6110,600228,778131,37117.6%

Stats Details: Divine Resonance Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.5715.560.000.000.000.00000.00002,044,371.342,044,371.340.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.42%12.83618110,600.0383,334160,894110,714.2791,253127,6851,418,5131,418,5130.00%
crit17.58%2.7409228,777.65170,835329,832217,024.970328,735625,858625,8580.00%

Action Details: Divine Resonance Judgment

  • id:20271
  • school:holystrike
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.671596
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.11
  • base_multiplier:1.58

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Empyrean Hammer 100,75120.4%400.60.74s75,4280Direct400.6 (400.6)63,510130,72575,42817.7% (17.7%)

Stats Details: Empyrean Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage400.65400.650.000.000.000.00000.000030,220,017.8730,220,017.870.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.27%329.6022842563,510.1537,133131,10163,526.3859,39868,64920,933,10120,933,1010.00%
crit17.73%71.0434121130,724.9776,123268,757130,829.29111,444155,9729,286,9179,286,9170.00%

Action Details: Empyrean Hammer

  • id:431398
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:431398
  • name:Empyrean Hammer
  • school:holy
  • tooltip:
  • description:A Holy Hammer called down from the skies to deal {$s1=0} Holy damage to its target.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Execution Sentence 42,6458.6%9.731.69s1,322,6101,753,114Direct9.71,322,58001,322,5800.0%

Stats Details: Execution Sentence

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.679.670.000.000.000.75450.000012,787,215.9712,787,215.970.00%1,753,114.341,753,114.34
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%9.678121,322,579.54314,6752,730,5571,323,057.251,050,6561,624,45312,787,21612,787,2160.00%

Action Details: Execution Sentence

  • id:387113
  • school:holy
  • range:150.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:387113
  • name:Execution Sentence
  • school:holy
  • tooltip:
  • description:{$@spelldesc343527=A hammer slowly falls from the sky upon the target, after {$d=8 seconds}, they suffer {$s2=20}% of the damage taken from your abilities as Holy damage during that time. {$?s406158=false} [|cFFFFFFFFGenerates {$406158s1=3} Holy Power.][]}

Action Priority List

    cooldowns
    [H]:9.67
  • if_expr:(!buff.crusade.up&cooldown.crusade.remains>15|buff.crusade.stack=10|cooldown.avenging_wrath.remains<0.75|cooldown.avenging_wrath.remains>15|talent.radiant_glory)&(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(target.time_to_die>8&!talent.executioners_will|target.time_to_die>12)&cooldown.wake_of_ashes.remains<gcd

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Expurgation 28,7875.8%62.24.75s138,6860Periodic127.956,697117,12967,44117.8%92.7%

Stats Details: Expurgation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage62.190.00127.89127.8956.090.00002.17448,624,762.718,624,762.710.00%31,015.070.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.22%105.157114356,697.208236,88956,737.6541,39973,0455,961,3405,961,3400.00%
crit17.78%22.74746117,129.46115483,410117,291.1574,890176,9832,663,4232,663,4230.00%

Action Details: Expurgation

  • id:383346
  • school:holyfire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.229500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.11
  • base_multiplier:1.21
  • dot_duration:9.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:383346
  • name:Expurgation
  • school:holyfire
  • tooltip:Suffering {$=}w1 {$?s403665=false}[Holy][Radiant] damage every {$t1=3} sec.{$?s406545=false}[ Holy damage taken from {$@=}auracaster increased by {$=}w2%.][]
  • description:{$@spelldesc383344=Your Blade of Justice causes the target to burn for {$383346=}o1 {$?s403665=false}[Holy][Radiant] damage over {$383346d=9 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Final Verdict 76,23815.4%83.83.55s272,824244,539Direct83.8229,422472,460272,81617.9%

Stats Details: Final Verdict

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage83.7883.780.000.000.001.11570.000022,858,329.7622,858,329.760.00%244,539.50244,539.50
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.14%68.824596229,422.43137,803445,256229,471.96212,875246,67215,789,37315,789,3730.00%
crit17.86%14.96333472,459.94282,496902,343472,842.55373,745617,0767,068,9577,068,9570.00%

Action Details: Final Verdict

  • id:383328
  • school:holystrike
  • range:12.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:383328
  • name:Final Verdict
  • school:holy
  • tooltip:
  • description:Unleashes a powerful weapon strike that deals {$s1=0} {$?s403664=true}[Holystrike][Holy] damage to an enemy target, Final Verdict has a {$s2=15}% chance to reset the cooldown of Hammer of Wrath and make it usable on any target, regardless of their health.

Action Priority List

    finishers
    [K]:83.78
  • if_expr:(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hammer of Light 61,51112.5%17.317.62s1,068,817888,690Direct17.3903,7821,848,1251,070,09817.6%

Stats Details: Hammer Of Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage17.2717.250.000.000.001.20270.000018,460,749.1518,460,749.150.00%888,689.60888,689.60
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.39%14.21621903,781.62526,3421,603,734903,708.85778,6621,057,40912,845,63312,845,6330.00%
crit17.61%3.040111,848,125.261,079,0023,063,8111,777,917.0002,870,4325,615,1165,615,1160.00%

Action Details: Hammer Of Light

  • id:427453
  • school:holy
  • range:14.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:427453
  • name:Hammer of Light
  • school:holy
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$429826s1=0} Holy damage and {$=}{{$429826s1=0}/2} Holy damage up to 4 nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.

Action Priority List

    finishers
    [I]:17.27

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Global CooldownPaladin1370268SET1.000
Hammer of Wrath 11,7072.4%18.215.99s193,335172,442Direct18.2 (18.2)163,009333,163193,54718.0% (18.0%)

Stats Details: Hammer Of Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage18.1818.160.000.000.001.12120.00003,515,224.063,515,224.060.00%172,441.70172,441.70
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.05%14.90529163,009.2695,136258,556163,434.50126,509201,3272,429,0092,429,0090.00%
crit17.95%3.26012333,163.47195,029528,229321,947.980513,8471,086,2151,086,2150.00%

Action Details: Hammer Of Wrath

  • id:24275
  • school:holystrike
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$=}<damage> {$?s403664=true}[Holystrike][Holy] damage. Only usable on enemies that have less than 20% health{$?s326730=true}[, or during Avenging Wrath][]. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    generators
    [P]:11.52
  • if_expr:(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)&(target.health.pct<35&talent.vengeful_wrath|buff.blessing_of_anshe.up)
    generators
    [S]:6.67
  • if_expr:(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Cooldown DurationRetribution Paladin1370273SET1.000
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin4123147PCT16.0%
Spell Direct AmountRetribution Paladin4123148PCT-14.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Cooldown Duration (Category)Paladin1370266SET1.000
Highlord's Judgment 9,9752.0%28.110.56s106,5400Direct28.190,410181,485106,54017.7%

Stats Details: Highlords Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage28.1028.100.000.000.000.00000.00002,993,240.372,993,240.370.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.29%23.1274390,410.2882,096117,99090,386.0483,16198,3702,090,2672,090,2670.00%
crit17.71%4.98017181,484.73164,192235,980179,948.940235,980902,973902,9730.00%

Action Details: Highlords Judgment

  • id:383921
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383921
  • name:Highlord's Judgment
  • school:holy
  • tooltip:
  • description:Blasts the target with the Light, dealing {$s1=0} Holy damage.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Judgment 13,3792.7%32.09.38s125,288115,221Direct32.0105,475216,699125,34517.9%

Stats Details: Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage32.0132.000.000.000.001.08740.00004,010,730.154,010,730.150.00%115,221.07115,221.07
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.13%26.281438105,475.2383,334159,528105,499.0095,984117,7232,771,9692,771,9690.00%
crit17.87%5.72017216,699.27170,835322,221216,227.710311,1181,238,7611,238,7610.00%

Action Details: Judgment

  • id:20271
  • school:holystrike
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:11.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.671596
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.11
  • base_multiplier:1.58

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Action Priority List

    generators
    [Q]:32.01
  • if_expr:holy_power<=3|!talent.boundless_judgment

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Mark of Fyr'alath 4,0050.8%813.30.37s1,4770Periodic134.87,56515,1488,90817.7%99.6%

Stats Details: Mark Of Fyralath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage813.260.00134.83134.83812.260.00002.21521,201,103.791,201,103.790.00%4,021.600.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.28%110.93771497,564.527,3328,7087,564.277,4227,804839,124839,1240.00%
crit17.72%23.9074815,147.7014,66317,41515,149.8614,67215,853361,979361,9790.00%

Action Details: Mark Of Fyralath

  • id:414532
  • school:shadowflame
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:6168.16
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:414532
  • name:Mark of Fyr'alath
  • school:shadowflame
  • tooltip:Suffering {$s1=12575} Shadowflame damage every {$t1=3} sec.
  • description:{$@spelldesc420248=Your attacks apply Mark of Fyr'alath, dealing {$414532=}o1 Shadowflame damage over {$414532d=15 seconds}. Upon activation, Fyr'alath draws in the flames from all marks to increase its damage by {$s1=10}%.}
melee 0 (27,566)0.0% (5.6%)158.11.89s52,28427,637

Stats Details: Melee

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage158.100.000.000.000.001.89180.00000.000.000.00%27,636.7627,636.76

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
    Crusading Strikes (crusading_strike) 27,5665.6%158.11.89s52,2840Direct158.144,00590,55552,28417.8%

Stats Details: Crusading Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage158.10158.100.000.000.000.00000.00008,265,906.638,265,906.630.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.22%129.989117144,005.1935,59666,50644,007.5241,83746,2445,719,8195,719,8190.00%
crit17.78%28.1295590,554.8372,971136,33790,605.1679,577103,4102,546,0872,546,0870.00%

Action Details: Crusading Strike

  • id:408385
  • school:holystrike
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:408385
  • name:Crusading Strikes
  • school:physical
  • tooltip:
  • description:Strike the target for {$=}<damage> {$?s403664=true} [Holystrike][Physical] damage. |cFFFFFFFFGenerates {$s2=1} Holy Power every other attack.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Searing Light 2,7410.6%4.260.77s196,8560Direct4.2165,955340,661196,84517.7%

Stats Details: Searing Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.184.180.000.000.000.00000.0000822,705.44822,705.440.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.31%3.44010165,955.03137,060255,781163,350.130249,751570,841570,8410.00%
crit17.69%0.7405340,660.62280,972523,216179,690.090512,848251,865251,8650.00%

Action Details: Searing Light

  • id:407478
  • school:holyfire
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:407478
  • name:Searing Light
  • school:holyfire
  • tooltip:
  • description:Calls down a explosion of Holy Fire dealing {$s2=0} Radiant damage to all nearby enemies and leaving a Consecration in its wake.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
(searing_light_) Consecration 0 (1,486)0.0% (0.3%)4.260.77s106,6690

Stats Details: Searing Light Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.180.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Searing Light Consecration

  • id:26573
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=true}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=false}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
    (searing_light_) Consecration 1,4860.3%0.00.00s00Periodic73.45,11810,5276,07717.7%0.0%

Stats Details: Searing Light Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.0073.360.000.00000.0000445,791.13445,791.130.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.26%60.3501735,118.003,9377,3555,066.2406,901308,840308,8400.00%
crit17.74%13.0104610,526.938,07015,07810,396.83014,738136,951136,9510.00%

Action Details: Searing Light Consecration Tick

  • id:81297
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:11.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Shield of Vengeance (_proc) 20,4794.1%4.964.73s1,253,3430Direct4.91,253,33301,253,3330.0%

Stats Details: Shield Of Vengeance Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.914.910.000.000.000.00000.00006,150,267.216,150,267.210.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%4.91461,253,332.831,236,0691,336,7281,253,075.541,236,0691,298,2446,150,2676,150,2670.00%

Action Details: Shield Of Vengeance Proc

  • id:184689
  • school:holy
  • range:8.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1240307.96
  • base_dd_max:1240307.96
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:184689
  • name:Shield of Vengeance
  • school:holy
  • tooltip:
  • description:{$@spelldesc184662=Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.}
Wake of Ashes 9,903 (36,732)2.0% (7.4%)9.931.78s1,113,773878,883Direct9.9 (89.6)253,176519,830300,39317.7% (17.7%)

Stats Details: Wake Of Ashes

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.899.890.000.000.001.26730.00002,969,913.422,969,913.420.00%878,883.40878,883.40
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.29%8.14212253,175.97222,798375,573253,131.42224,962282,7082,059,8252,059,8250.00%
crit17.71%1.7508519,830.27456,736731,166441,142.200708,979910,089910,0890.00%

Action Details: Wake Of Ashes

  • id:255937
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:3.0

Spelldata

  • id:255937
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.

Action Priority List

    generators
    [M]:9.89
  • if_expr:(!talent.lights_guidance|holy_power>=2&talent.lights_guidance)&(cooldown.avenging_wrath.remains>6|cooldown.crusade.remains>6|talent.radiant_glory)&(!talent.execution_sentence|cooldown.execution_sentence.remains>4|target.time_to_die<8)&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Truth's Wake 13,6842.8%9.931.78s414,6200Periodic60.057,363118,74468,35817.9%35.1%

Stats Details: Truths Wake

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.890.0059.9759.970.000.00001.75494,099,216.144,099,216.140.00%38,952.600.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.09%49.23366457,363.181685,13257,391.4852,01363,2422,823,7362,823,7360.00%
crit17.91%10.74030118,743.9237174,521118,565.670164,3891,275,4811,275,4810.00%

Action Details: Truths Wake

  • id:403695
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.544000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.11
  • base_multiplier:1.10
  • dot_duration:9.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:403695
  • name:Truth's Wake
  • school:holyfire
  • tooltip:{$?=}(s403696)[Burning for {$=}w2 damage every {$t2=3} sec and movement speed reduced by {$s1=50}%.] [Movement speed reduced by {$s1=50}%.]
  • description:Burns the targets for an additional {$=}o2 Radiant damage over {$d=9 seconds}, and slows them by {$s1=50}%.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Wake of Ashes (seething_flames_0) 6,5461.3%9.931.78s198,9170Direct9.9167,971344,906198,91717.5%

Stats Details: Seething Flames 0

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.879.870.000.000.000.00000.00001,963,728.221,963,728.220.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.51%8.15312167,971.01148,475242,995167,945.79150,498192,7471,368,1911,368,1910.00%
crit17.49%1.7308344,905.79304,373497,077291,857.390461,083595,537595,5370.00%

Action Details: Seething Flames 0

  • id:405345
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:405345
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:{$@spelldesc255937=Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Wake of Ashes (seething_flames_1) 6,5981.3%9.931.78s200,7930Direct9.9169,075346,902200,77717.8%

Stats Details: Seething Flames 1

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.859.850.000.000.000.00000.00001,978,672.351,978,672.350.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.16%8.10212169,075.45148,475248,942169,047.06149,699190,9841,368,9531,368,9530.00%
crit17.84%1.7609346,901.54304,373507,005295,613.280505,127609,719609,7190.00%

Action Details: Seething Flames 1

  • id:405350
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:405350
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:{$@spelldesc255937=Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Simple Action Stats Execute Interval
Thyraelius
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thyraelius
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thyraelius
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
The Sushi Special 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457302
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thyraelius
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5302.09s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [D]:1.48
  • if_expr:buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up|fight_remains<30
Sacrosanct Crusade (_heal) 17.317.62s

Stats Details: Sacrosanct Crusade Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal17.270.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sacrosanct Crusade Heal

  • id:461885
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thyraelius
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:224936.40
  • base_dd_max:224936.40
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461885
  • name:Sacrosanct Crusade
  • school:holy
  • tooltip:
  • description:{$@spelldesc431730={$?a137028=false}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=false}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=false}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=false}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
Shield of Vengeance 4.964.09s

Stats Details: Shield Of Vengeance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb4.914.910.000.000.000.60070.00000.000.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%4.91460.00000.0000000.00%

Action Details: Shield Of Vengeance

  • id:184662
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.7500
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:62.999
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thyraelius
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs {$=}w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.

Action Priority List

    cooldowns
    [G]:3.91
  • if_expr:fight_remains>15&(!talent.execution_sentence|!debuff.execution_sentence.up)
signet_of_the_priory 2.7126.69s

Stats Details: Signet Of The Priory

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.700.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Signet Of The Priory

  • id:443531
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:443531
  • name:Bolstering Light
  • school:physical
  • tooltip:{$?=}e2[Critical Strike]?e3[Haste]?e4[Mastery]?e5[Versatility][Highest secondary stat] increased by {$=}w1.
  • description:Raise your signet to the Light, increasing your highest secondary stat by {$450877s2=8731} for {$d=20 seconds}. Your act inspires nearby signetbearers within your party, granting them {$450877s1=230} of the same stat for {$450882d=20 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blessing of Dawn69.64.14.3s4.1s1.6s37.02%63.99%0.0 (0.0)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_blessing_of_dawn
  • max_stacks:2
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 18.0s
  • trigger_min/max:0.9s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.1s
  • uptime_min/max:26.42% / 45.66%

Stack Uptimes

  • blessing_of_dawn_1:35.72%
  • blessing_of_dawn_2:1.30%

Spelldata

  • id:385127
  • name:Blessing of Dawn
  • tooltip:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing.
  • description:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing. This effect stacks.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blessing of Dusk1.867.3112.0s4.3s161.4s98.18%0.00%67.3 (67.3)0.8

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_blessing_of_dusk
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 347.9s
  • trigger_min/max:0.5s / 16.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 355.4s
  • uptime_min/max:94.87% / 98.76%

Stack Uptimes

  • blessing_of_dusk_1:98.18%

Spelldata

  • id:385126
  • name:Blessing of Dusk
  • tooltip:Damage taken reduced by {$=}w1%{$?s385129=false}[, armor increased by {$=}w2%, and Holy Power generating abilities cool down {$=}w3% faster.][.]
  • description:Damage taken reduced by {$s1=4}%{$?s385129=false}&c2[, armor increased by {$s2=10}%, and Holy Power generating abilities cool down {$s3=10}% faster]?s385129[ and your Holy Power generating abilities also grant an absorb shield for {$s9=10}% of damage or healing dealt.][] For {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Light (Crit)0.70.0158.4s158.4s19.4s4.40%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_bolstering_light_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:4178.76

Trigger Details

  • interval_min/max:120.6s / 263.9s
  • trigger_min/max:120.6s / 263.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:0.00% / 20.80%

Stack Uptimes

  • bolstering_light_Crit_1:4.40%

Spelldata

  • id:443531
  • name:Bolstering Light
  • tooltip:{$?=}e2[Critical Strike]?e3[Haste]?e4[Mastery]?e5[Versatility][Highest secondary stat] increased by {$=}w1.
  • description:Raise your signet to the Light, increasing your highest secondary stat by {$450877s2=8731} for {$d=20 seconds}. Your act inspires nearby signetbearers within your party, granting them {$450877s1=230} of the same stat for {$450882d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Bolstering Light (Haste)0.70.0155.4s155.4s19.3s4.24%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_bolstering_light_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:4178.76

Trigger Details

  • interval_min/max:120.4s / 265.8s
  • trigger_min/max:120.4s / 265.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:0.00% / 20.53%

Stack Uptimes

  • bolstering_light_Haste_1:4.24%

Spelldata

  • id:443531
  • name:Bolstering Light
  • tooltip:{$?=}e2[Critical Strike]?e3[Haste]?e4[Mastery]?e5[Versatility][Highest secondary stat] increased by {$=}w1.
  • description:Raise your signet to the Light, increasing your highest secondary stat by {$450877s2=8731} for {$d=20 seconds}. Your act inspires nearby signetbearers within your party, granting them {$450877s1=230} of the same stat for {$450882d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Bolstering Light (Mastery)0.70.0155.5s155.5s19.3s4.33%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_bolstering_light_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4178.76

Trigger Details

  • interval_min/max:120.6s / 265.2s
  • trigger_min/max:120.6s / 265.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 20.0s
  • uptime_min/max:0.00% / 20.31%

Stack Uptimes

  • bolstering_light_Mastery_1:4.34%

Spelldata

  • id:443531
  • name:Bolstering Light
  • tooltip:{$?=}e2[Critical Strike]?e3[Haste]?e4[Mastery]?e5[Versatility][Highest secondary stat] increased by {$=}w1.
  • description:Raise your signet to the Light, increasing your highest secondary stat by {$450877s2=8731} for {$d=20 seconds}. Your act inspires nearby signetbearers within your party, granting them {$450877s1=230} of the same stat for {$450882d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Bolstering Light (Vers)0.70.0153.9s153.9s19.4s4.39%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_bolstering_light_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:4178.76

Trigger Details

  • interval_min/max:120.8s / 262.9s
  • trigger_min/max:120.8s / 262.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s
  • uptime_min/max:0.00% / 20.52%

Stack Uptimes

  • bolstering_light_Vers_1:4.39%

Spelldata

  • id:443531
  • name:Bolstering Light
  • tooltip:{$?=}e2[Critical Strike]?e3[Haste]?e4[Mastery]?e5[Versatility][Highest secondary stat] increased by {$=}w1.
  • description:Raise your signet to the Light, increasing your highest secondary stat by {$450877s2=8731} for {$d=20 seconds}. Your act inspires nearby signetbearers within your party, granting them {$450877s1=230} of the same stat for {$450882d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Burnout2.70.0126.6s126.6s54.4s48.87%0.00%0.0 (0.0)2.2

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_burnout
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:-812.83

Trigger Details

  • interval_min/max:120.3s / 144.3s
  • trigger_min/max:120.3s / 144.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 60.0s
  • uptime_min/max:41.82% / 55.21%

Stack Uptimes

  • burnout_1:48.87%

Spelldata

  • id:426897
  • name:Burnout
  • tooltip:Haste decreased by {$=}w1.
  • description:{$@spelldesc423611=Draw power from the remnants of the Embersoul, gaining {$423021s1=15722} {$=}pri for {$d=20 seconds}, decaying every {$t3=2} sec. Once this effect ends, become Burned Out, losing {$423021s2=1915} Haste for 60 sec before recovering. When circumstances are dire your soul ignites, granting this bonus again without decaying. This effect may only occur once per combat.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Crusade15.761.719.6s3.8s10.0s52.48%61.02%34.0 (93.2)15.1

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_crusade
  • max_stacks:10
  • base duration:27.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 42.9s
  • trigger_min/max:0.2s / 30.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:45.13% / 59.14%

Stack Uptimes

  • crusade_1:10.00%
  • crusade_4:3.93%
  • crusade_6:7.70%
  • crusade_7:0.90%
  • crusade_9:6.91%
  • crusade_10:23.03%

Spelldata

  • id:231895
  • name:Crusade
  • tooltip:Damage done and haste increased by {$=}<damage>%.{$?=}{$=}w4>0[ Hammer of Wrath may be cast on any target.][]{$?s53376=false}[ Exploding with Holy light for {$326731s1=0} damage to nearby enemies.][]
  • description:Call upon the Light and begin a crusade, increasing your haste {$?s384376=true}[and damage ][]by {$=}{{$s5=30}/10}% for {$d=27 seconds}. Each Holy Power spent during Crusade increases haste and damage by an additional {$=}{{$s5=30}/10}%. Maximum {$u=10} stacks.{$?s53376=false}[ While active, each Holy Power spent causes you to explode with Holy light for {$326731s1=0} damage to nearby enemies.][]{$?s384376=true}[ Hammer of Wrath may be cast on any target.][]
  • max_stacks:10
  • duration:27.00
  • cooldown:120.00
  • default_chance:100.00%
Divine Purpose10.80.125.3s25.1s2.4s8.46%10.32%0.1 (0.1)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 276.9s
  • trigger_min/max:0.8s / 276.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.0s
  • uptime_min/max:0.38% / 21.05%

Stack Uptimes

  • divine_purpose_1:8.46%

Spelldata

  • id:408458
  • name:Divine Purpose
  • tooltip:Your next Holy Power spending ability is free and deals {$s2=10}% increased damage and healing.
  • description:{$@spelldesc408459=Holy Power spending abilities have a {$s1=10}% chance to make your next Holy Power spending ability free and deal {$408458s2=10}% increased damage and healing.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Resonance5.40.061.9s61.8s14.6s26.17%0.00%10.5 (10.5)5.1

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_divine_resonance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:60.0s / 83.2s
  • trigger_min/max:60.0s / 83.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:22.69% / 29.29%

Stack Uptimes

  • divine_resonance_1:26.17%

Spelldata

  • id:355455
  • name:Divine Resonance
  • tooltip:Casting {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$t1=5} sec for {$s2=15} sec.
  • description:{$@spelldesc355098=After casting Divine Toll, you instantly cast {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$355455t1=5} sec. This effect lasts {$355455s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Empyrean Power7.70.234.3s33.4s1.6s4.08%100.00%0.2 (0.2)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_empyrean_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 307.2s
  • trigger_min/max:1.1s / 307.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.6s
  • uptime_min/max:0.00% / 13.68%

Stack Uptimes

  • empyrean_power_1:4.08%

Spelldata

  • id:326733
  • name:Empyrean Power
  • tooltip:Your next Divine Storm is free and deals {$=}w1% additional damage.
  • description:{$@spelldesc326732={$?s404542=true}[Crusading Strikes has a {$s2=5}%][Crusader Strike has a {$s1=15}%] chance to make your next Divine Storm free and deal {$326733s1=15}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:326732
  • name:Empyrean Power
  • tooltip:
  • description:{$?s404542=true}[Crusading Strikes has a {$s2=5}%][Crusader Strike has a {$s1=15}%] chance to make your next Divine Storm free and deal {$326733s1=15}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Final Verdict11.41.325.0s22.3s3.7s14.01%8.57%1.3 (1.3)0.3

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_final_verdict
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 241.6s
  • trigger_min/max:0.8s / 241.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.9s
  • uptime_min/max:1.48% / 34.43%

Stack Uptimes

  • final_verdict_1:14.01%

Spelldata

  • id:337228
  • name:Final Verdict
  • tooltip:Hammer of Wrath can be used on any target.
  • description:{$@spelldesc336872=Unleashes a powerful weapon strike that deals {$s1=0} Holy damage to an enemy target. Has a {$s2=15}% chance to activate Hammer of Wrath and reset its cooldown.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of Alchemical Chaos (Crit)2.10.6111.8s76.8s35.3s25.02%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 350.2s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 82.90%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.02%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6112.8s77.7s35.3s24.78%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 351.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 225.6s
  • uptime_min/max:0.00% / 87.59%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.78%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6110.9s75.9s35.6s25.17%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 338.4s
  • trigger_min/max:30.0s / 300.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 236.3s
  • uptime_min/max:0.00% / 89.72%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.17%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.6s76.8s35.3s25.03%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 347.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 79.24%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.03%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance (hammer_of_light_free)7.50.037.8s37.8s1.7s4.19%2.25%0.0 (0.0)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_hammer_of_light_free
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • hammer_of_light_free_1:4.19%

Spelldata

  • id:433732
  • name:Light's Deliverance
  • tooltip:
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=false}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hammer of Light (_ready)9.90.031.8s31.8s1.3s4.17%11.50%0.0 (0.0)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_hammer_of_light_ready
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.0s / 44.6s
  • trigger_min/max:30.0s / 44.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.4s
  • uptime_min/max:3.55% / 4.67%

Stack Uptimes

  • hammer_of_light_ready_1:4.17%

Spelldata

  • id:427453
  • name:Hammer of Light
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$429826s1=0} Holy damage and {$=}{{$429826s1=0}/2} Holy damage up to 4 nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance8.5392.237.4s0.7s34.6s97.48%0.00%0.2 (0.2)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_lights_deliverance
  • max_stacks:50
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:27.5s / 58.0s
  • trigger_min/max:0.0s / 9.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.0s
  • uptime_min/max:94.10% / 98.80%

Stack Uptimes

  • lights_deliverance_1:1.53%
  • lights_deliverance_2:1.63%
  • lights_deliverance_3:1.02%
  • lights_deliverance_4:0.87%
  • lights_deliverance_5:0.98%
  • lights_deliverance_6:0.90%
  • lights_deliverance_7:0.82%
  • lights_deliverance_8:1.85%
  • lights_deliverance_9:1.87%
  • lights_deliverance_10:1.91%
  • lights_deliverance_11:2.33%
  • lights_deliverance_12:2.01%
  • lights_deliverance_13:1.98%
  • lights_deliverance_14:2.40%
  • lights_deliverance_15:1.99%
  • lights_deliverance_16:2.04%
  • lights_deliverance_17:2.52%
  • lights_deliverance_18:2.09%
  • lights_deliverance_19:2.09%
  • lights_deliverance_20:2.47%
  • lights_deliverance_21:2.20%
  • lights_deliverance_22:2.08%
  • lights_deliverance_23:2.32%
  • lights_deliverance_24:2.24%
  • lights_deliverance_25:2.09%
  • lights_deliverance_26:2.24%
  • lights_deliverance_27:2.24%
  • lights_deliverance_28:2.14%
  • lights_deliverance_29:2.18%
  • lights_deliverance_30:2.22%
  • lights_deliverance_31:2.16%
  • lights_deliverance_32:2.13%
  • lights_deliverance_33:2.18%
  • lights_deliverance_34:2.15%
  • lights_deliverance_35:2.10%
  • lights_deliverance_36:2.14%
  • lights_deliverance_37:2.15%
  • lights_deliverance_38:2.11%
  • lights_deliverance_39:2.13%
  • lights_deliverance_40:2.11%
  • lights_deliverance_41:2.11%
  • lights_deliverance_42:2.09%
  • lights_deliverance_43:2.10%
  • lights_deliverance_44:2.06%
  • lights_deliverance_45:2.05%
  • lights_deliverance_46:2.08%
  • lights_deliverance_47:2.07%
  • lights_deliverance_48:2.12%
  • lights_deliverance_49:2.09%
  • lights_deliverance_50:0.14%

Spelldata

  • id:433674
  • name:Light's Deliverance
  • tooltip:{$?=}{$=}W1=={$=}U[Ready to deliver Light's justice.][Building up Light's Deliverance. At {$u=60} stacks, your next Hammer of Light cast will activate another Hammer of Light for free.]
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=false}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:60
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sacrosanct Crusade12.414.724.9s11.0s12.8s52.80%54.31%14.7 (14.7)11.9

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_sacrosanct_crusade
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.0s / 47.5s
  • trigger_min/max:0.8s / 40.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.9s
  • uptime_min/max:43.35% / 60.49%

Stack Uptimes

  • sacrosanct_crusade_1:52.80%

Spelldata

  • id:461867
  • name:Sacrosanct Crusade
  • tooltip:Absorbs {$=}w1 damage.
  • description:{$@spelldesc431730={$?a137028=false}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=false}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=false}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=false}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sanctification52.90.083.1s5.7s103.8s98.88%98.23%0.0 (0.0)1.9

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_sanctification
  • max_stacks:20
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 357.4s
  • trigger_min/max:0.0s / 31.7s
  • trigger_pct:99.87%
  • duration_min/max:0.0s / 359.7s
  • uptime_min/max:92.09% / 100.00%

Stack Uptimes

  • sanctification_1:37.62%
  • sanctification_2:28.95%
  • sanctification_3:19.27%
  • sanctification_4:10.73%
  • sanctification_5:2.16%
  • sanctification_6:0.15%

Spelldata

  • id:433671
  • name:Sanctification
  • tooltip:Empyrean Hammer damage increased by {$=}w1%
  • description:{$@spelldesc432977=Casting Judgment increases the damage of Empyrean Hammer by {$433671s1=10}% for {$433671d=10 seconds}. Multiple applications may overlap.}
  • max_stacks:20
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Shake the Heavens4.912.359.3s59.3s57.8s94.58%95.52%151.8 (139.5)3.9

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_shake_the_heavens
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • shake_the_heavens_1:94.58%

Spelldata

  • id:431536
  • name:Shake the Heavens
  • tooltip:Casting Empyrean Hammer on a nearby target every $t sec.
  • description:{$@spelldesc431533=After casting Hammer of Light, you call down an Empyrean Hammer on a nearby target every {$431536=}T sec, for {$431536d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Shield of Vengeance4.94.964.7s27.3s10.0s16.34%0.00%4.9 (4.9)4.9

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:63.0s / 71.9s
  • trigger_min/max:0.0s / 71.7s
  • trigger_pct:100.00%
  • duration_min/max:10.0s / 10.0s
  • uptime_min/max:14.08% / 18.66%

Stack Uptimes

  • shield_of_vengeance_1:16.34%

Spelldata

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs {$=}w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Soul Ignition2.90.0126.1s126.1s19.4s19.03%0.00%28.3 (28.3)2.7

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_soul_ignition
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:8579.87
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:strength
  • amount:8579.87

Trigger Details

  • interval_min/max:120.0s / 144.3s
  • trigger_min/max:120.0s / 144.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:15.25% / 22.69%

Stack Uptimes

  • soul_ignition_1:19.03%

Spelldata

  • id:423611
  • name:Soul Ignition
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Draw power from the remnants of the Embersoul, gaining {$423021s1=15722} {$=}pri for {$d=20 seconds}, decaying every {$t3=2} sec. Once this effect ends, become Burned Out, losing {$423021s2=1915} Haste for 60 sec before recovering. When circumstances are dire your soul ignites, granting this bonus again without decaying. This effect may only occur once per combat.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Tempered Potion1.50.0302.2s302.2s27.4s13.30%0.00%0.0 (0.0)1.2

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 320.4s
  • trigger_min/max:300.0s / 320.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.91% / 18.07%

Stack Uptimes

  • tempered_potion_1:13.30%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Undisputed Ruling13.43.822.9s17.6s9.1s40.79%39.01%3.8 (3.8)13.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_undisputed_ruling
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • undisputed_ruling_1:40.79%

Spelldata

  • id:432629
  • name:Undisputed Ruling
  • tooltip:Haste increased by {$=}w1%
  • description:{$@spelldesc432626=Hammer of Light applies Judgment to its targets, and increases your Haste by {$432629s1=12}% for {$432629d=6 seconds}.{$?a137028=false}[ Additionally, Eye of Tyr grants {$s2=3} Holy Power.][]}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion4.31.260.6s45.2s16.5s23.77%0.00%1.2 (1.2)4.1

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1742.15
  • stat:speed_rating
  • amount:555.47

Trigger Details

  • interval_min/max:15.0s / 226.7s
  • trigger_min/max:0.0s / 217.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.1s
  • uptime_min/max:4.86% / 59.77%

Stack Uptimes

  • wafting_devotion_1:23.77%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
The Sushi Special

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_the_sushi_special
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:470.00

Spelldata

  • id:461957
  • name:Well Fed
  • tooltip:Mastery increased by {$=}w9.
  • description:Increases Mastery by {$s1=0} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Art of War34.415.060.08.5s1.1s100.5s
Divine Purpose10.91.025.025.1s0.8s276.9s
Empyrean Power7.90.020.033.4s1.1s307.2s
Uptime Avg % Min Max Avg Dur Min Max
Holy Power Cap17.05%8.90%27.03%1.3s0.0s10.2s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Searing Light24.1290.000322.614121.6080.142350.898
(blade_of_justice_) Consecration0.4070.00024.5558.8665.16534.166
(searing_light_) Consecration42.9670.000322.614220.08185.017350.898
Shield of Vengeance1.3410.0008.8998.6590.00040.115
Execution Sentence1.6260.00416.75417.2604.22438.220
Blade of Justice0.5120.00025.27532.4704.70773.006
Wake of Ashes1.7820.00014.55717.6704.97936.716
Divine Toll1.5250.00023.1598.2530.00030.641
Hammer of Wrath2.9400.000191.16853.6716.537220.897
Judgment1.3480.00026.44543.67417.28489.470

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Thyraelius
Blade of JusticeHoly Power62.1962.1522.84%1.000.050.07%
Crusading StrikesHoly Power78.8168.4825.16%0.8710.3313.10%
Hammer of WrathHoly Power18.1818.176.68%1.000.010.04%
JudgmentHoly Power52.9499.1536.44%1.876.726.35%
Wake of AshesHoly Power9.8924.188.89%2.455.4818.48%
Usage Type Count Total Tot% Avg RPE APR
Thyraelius
Final VerdictHoly Power83.78223.5983.04%2.672.67102,233.26
Hammer of LightHoly Power17.2745.6616.96%2.642.64404,326.83
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Holy Power0.00.910.9022.62.90.05.0

Statistics & Data Analysis

Fight Length
Thyraelius Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Thyraelius Damage Per Second
Count 9999
Mean 494194.85
Minimum 442983.71
Maximum 557373.60
Spread ( max - min ) 114389.88
Range [ ( max - min ) / 2 * 100% ] 11.57%
Standard Deviation 13934.9635
5th Percentile 471439.74
95th Percentile 517169.67
( 95th Percentile - 5th Percentile ) 45729.93
Mean Distribution
Standard Deviation 139.3566
95.00% Confidence Interval ( 493921.71 - 494467.98 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3055
0.1 Scale Factor Error with Delta=300 1657660
0.05 Scale Factor Error with Delta=300 6630639
0.01 Scale Factor Error with Delta=300 165765955
Priority Target DPS
Thyraelius Priority Target Damage Per Second
Count 9999
Mean 494194.85
Minimum 442983.71
Maximum 557373.60
Spread ( max - min ) 114389.88
Range [ ( max - min ) / 2 * 100% ] 11.57%
Standard Deviation 13934.9635
5th Percentile 471439.74
95th Percentile 517169.67
( 95th Percentile - 5th Percentile ) 45729.93
Mean Distribution
Standard Deviation 139.3566
95.00% Confidence Interval ( 493921.71 - 494467.98 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3055
0.1 Scale Factor Error with Delta=300 1657660
0.05 Scale Factor Error with Delta=300 6630639
0.01 Scale Factor Error with Delta=300 165765955
DPS(e)
Thyraelius Damage Per Second (Effective)
Count 9999
Mean 494194.85
Minimum 442983.71
Maximum 557373.60
Spread ( max - min ) 114389.88
Range [ ( max - min ) / 2 * 100% ] 11.57%
Damage
Thyraelius Damage
Count 9999
Mean 148212593.43
Minimum 110734027.23
Maximum 188265916.62
Spread ( max - min ) 77531889.39
Range [ ( max - min ) / 2 * 100% ] 26.16%
DTPS
Thyraelius Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Thyraelius Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Thyraelius Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Thyraelius Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Thyraelius Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 shield_of_vengeance
5 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
6 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
7 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%cooldown.crusade.duration=0|cooldown.crusade.duration%%trinket.1.cooldown.duration=0|trinket.1.cooldown.duration%%cooldown.avenging_wrath.duration=0|cooldown.avenging_wrath.duration%%trinket.1.cooldown.duration=0)
8 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%cooldown.crusade.duration=0|cooldown.crusade.duration%%trinket.2.cooldown.duration=0|trinket.2.cooldown.duration%%cooldown.avenging_wrath.duration=0|cooldown.avenging_wrath.duration%%trinket.2.cooldown.duration=0)
9 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 auto_attack
0.00 rebuke
B 0.00 call_action_list,name=cooldowns
C 0.00 call_action_list,name=generators
actions.cooldowns
# count action,conditions
D 1.48 potion,if=buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up|fight_remains<30
0.00 invoke_external_buff,name=power_infusion,if=buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up
0.00 lights_judgment,if=spell_targets.lights_judgment>=2|!raid_event.adds.exists|raid_event.adds.in>75|raid_event.adds.up
0.00 fireblood,if=buff.avenging_wrath.up|buff.crusade.up&buff.crusade.stack=10|debuff.execution_sentence.up
0.00 use_item,slot=trinket1,if=((buff.avenging_wrath.up&cooldown.avenging_wrath.remains>40|buff.crusade.up&buff.crusade.stack=10)&!talent.radiant_glory|talent.radiant_glory&(!talent.execution_sentence&cooldown.wake_of_ashes.remains=0|debuff.execution_sentence.up))&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
E 2.93 use_item,slot=trinket2,if=((buff.avenging_wrath.up&cooldown.avenging_wrath.remains>40|buff.crusade.up&buff.crusade.stack=10)&!talent.radiant_glory|talent.radiant_glory&(!talent.execution_sentence&cooldown.wake_of_ashes.remains=0|debuff.execution_sentence.up))&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
F 2.70 use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!buff.crusade.up&cooldown.crusade.remains>20|!buff.avenging_wrath.up&cooldown.avenging_wrath.remains>20)
0.00 use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!buff.crusade.up&cooldown.crusade.remains>20|!buff.avenging_wrath.up&cooldown.avenging_wrath.remains>20)
G 3.91 shield_of_vengeance,if=fight_remains>15&(!talent.execution_sentence|!debuff.execution_sentence.up)
H 9.67 execution_sentence,if=(!buff.crusade.up&cooldown.crusade.remains>15|buff.crusade.stack=10|cooldown.avenging_wrath.remains<0.75|cooldown.avenging_wrath.remains>15|talent.radiant_glory)&(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(target.time_to_die>8&!talent.executioners_will|target.time_to_die>12)&cooldown.wake_of_ashes.remains<gcd
0.00 avenging_wrath,if=(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&talent.divine_auxiliary&(cooldown.execution_sentence.remains=0|cooldown.final_reckoning.remains=0))&(!raid_event.adds.up|target.time_to_die>10)
0.00 crusade,if=holy_power>=5&time<5|holy_power>=3&time>5
0.00 final_reckoning,if=(holy_power>=4&time<8|holy_power>=3&time>=8|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(cooldown.avenging_wrath.remains>10|cooldown.crusade.remains&(!buff.crusade.up|buff.crusade.stack>=10)|talent.radiant_glory&(buff.avenging_wrath.up|talent.crusade&cooldown.wake_of_ashes.remains<gcd))&(!raid_event.adds.exists|raid_event.adds.up|raid_event.adds.in>40)
actions.finishers
# count action,conditions
0.00 variable,name=ds_castable,value=(spell_targets.divine_storm>=2|buff.empyrean_power.up|!talent.final_verdict&talent.tempest_of_the_lightbringer)&!buff.empyrean_legacy.up&!(buff.divine_arbiter.up&buff.divine_arbiter.stack>24)
I 17.27 hammer_of_light
0.00 divine_hammer,if=holy_power=5
J 7.66 divine_storm,if=variable.ds_castable&!buff.hammer_of_light_ready.up&(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
0.00 justicars_vengeance,if=(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
K 83.78 templars_verdict,if=(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
actions.generators
# count action,conditions
L 0.00 call_action_list,name=finishers,if=holy_power=5|holy_power=4&buff.divine_resonance.up
0.00 templar_slash,if=buff.templar_strikes.remains<gcd*2
0.00 blade_of_justice,if=!dot.expurgation.ticking&talent.holy_flames
M 9.89 wake_of_ashes,if=(!talent.lights_guidance|holy_power>=2&talent.lights_guidance)&(cooldown.avenging_wrath.remains>6|cooldown.crusade.remains>6|talent.radiant_glory)&(!talent.execution_sentence|cooldown.execution_sentence.remains>4|target.time_to_die<8)&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)
N 5.36 divine_toll,if=holy_power<=2&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)&(cooldown.avenging_wrath.remains>15|cooldown.crusade.remains>15|talent.radiant_glory|fight_remains<8)
O 0.00 call_action_list,name=finishers,if=holy_power>=3&buff.crusade.up&buff.crusade.stack<10
0.00 templar_slash,if=buff.templar_strikes.remains<gcd&spell_targets.divine_storm>=2
0.00 blade_of_justice,if=(holy_power<=3|!talent.holy_blade)&(spell_targets.divine_storm>=2&talent.blade_of_vengeance)
P 11.52 hammer_of_wrath,if=(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)&(target.health.pct<35&talent.vengeful_wrath|buff.blessing_of_anshe.up)
0.00 templar_strike
Q 32.01 judgment,if=holy_power<=3|!talent.boundless_judgment
R 62.19 blade_of_justice,if=holy_power<=3|!talent.holy_blade
S 6.67 hammer_of_wrath,if=(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)
0.00 templar_slash
T 0.00 call_action_list,name=finishers,if=(target.health.pct<=20|buff.avenging_wrath.up|buff.crusade.up|buff.empyrean_power.up)
0.00 crusader_strike,if=cooldown.crusader_strike.charges_fractional>=1.75&(holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2)
U 0.00 call_action_list,name=finishers
0.00 hammer_of_wrath,if=holy_power<=3|target.health.pct>20|!talent.vanguards_momentum
0.00 crusader_strike
0.00 arcane_torrent

Sample Sequence

012456789ANHDEMIQKRKRKQRKRKRQKRRKRKQFKRKSQRKHMIRQKRIKSRQKRKRKQKRQKHMINKRQKGRKRRKKQIKKRQRKRHMIRQKRRKQRKRKQRKKIQHEMINJKRQJKGRKRKQKRRFKRKSKQKHMIRRIQKRRJKRQKRKRRRKQSKHKMINQJKRRKIGQKKPRKKKQRRKKKRKQHMIRRKQKPRKRRKQIKRPKQKPRHEMINKPQKKPKGRRKPKQKRFRKPRIJKHKMIPQKRRPJKRRKPJKQ

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0flask
[precombat]
Thyraelius 0.0/5 0% HoPo
Pre1food
[precombat]
Thyraelius 0.0/5 0% HoPo
Pre2augmentation
[precombat]
Thyraelius 0.0/5 0% HoPo
Pre4shield_of_vengeance
[precombat]
Thyraelius 0.0/5 0% HoPo
Pre5trinket_1_buffs
[precombat]
Thyraelius 0.0/5 0% HoPo shield_of_vengeance
Pre6trinket_2_buffs
[precombat]
Thyraelius 0.0/5 0% HoPo shield_of_vengeance
Pre7trinket_1_sync
[precombat]
Thyraelius 0.0/5 0% HoPo shield_of_vengeance
Pre8trinket_2_sync
[precombat]
Thyraelius 0.0/5 0% HoPo shield_of_vengeance
Pre9trinket_priority
[precombat]
Thyraelius 0.0/5 0% HoPo shield_of_vengeance
0:00.000Aauto_attack
[default]
Fluffy_Pillow 0.0/5 0% HoPo shield_of_vengeance
0:00.000Ndivine_toll
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, shield_of_vengeance
0:01.075Hexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, shield_of_vengeance, divine_resonance, sanctification
0:01.829Dpotion
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, shield_of_vengeance, divine_resonance, sanctification
0:01.829Euse_item_ashes_of_the_embersoul
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, shield_of_vengeance, divine_resonance, sanctification, tempered_potion
0:01.829Mwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, shield_of_vengeance, divine_resonance, sanctification, soul_ignition, tempered_potion
0:02.865Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade, shield_of_vengeance, divine_resonance, hammer_of_light_ready, sanctification, sacrosanct_crusade, soul_ignition, tempered_potion
0:03.872Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(6), shield_of_vengeance, blessing_of_dawn, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(4), sacrosanct_crusade, soul_ignition, tempered_potion
0:04.638Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(6), shield_of_vengeance, blessing_of_dawn, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(5), sacrosanct_crusade, soul_ignition, tempered_potion
0:05.403Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(9), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), sacrosanct_crusade, soul_ignition, tempered_potion
0:06.157Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, crusade(9), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), sacrosanct_crusade, soul_ignition, tempered_potion
0:06.912Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(10), sacrosanct_crusade, soul_ignition, tempered_potion
0:07.666 Waiting0.707s 2.0/5 40% HoPo bloodlust, crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(11), sacrosanct_crusade, soul_ignition, tempered_potion
0:08.373Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(10), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(11), sacrosanct_crusade, soul_ignition, tempered_potion
0:09.129Qjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(14), sacrosanct_crusade, soul_ignition, tempered_potion
0:09.883Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(14), sacrosanct_crusade, soul_ignition, tempered_potion
0:10.782Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade(10), blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(14), sacrosanct_crusade, soul_ignition, tempered_potion
0:11.537 Waiting0.441s 2.0/5 40% HoPo bloodlust, crusade(10), blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(17), sacrosanct_crusade, soul_ignition, tempered_potion
0:11.978Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(10), blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(17), sacrosanct_crusade, soul_ignition, tempered_potion
0:12.777Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(10), blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(17), sacrosanct_crusade, soul_ignition, tempered_potion
0:13.574Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(10), blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(20), soul_ignition, tempered_potion
0:14.372 Waiting0.113s 2.0/5 40% HoPo bloodlust, crusade(10), blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(20), soul_ignition, tempered_potion
0:14.485Qjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(10), blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(20), soul_ignition, tempered_potion
0:15.459Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade(10), blessing_of_dawn(2), blessing_of_dusk, shake_the_heavens, sanctification(6), lights_deliverance(21), soul_ignition, tempered_potion
0:16.256Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(10), blessing_of_dusk, shake_the_heavens, sanctification(5), lights_deliverance(23), soul_ignition, wafting_devotion, tempered_potion
0:17.037Rblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(23), soul_ignition, wafting_devotion, tempered_potion
0:18.051Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(24), soul_ignition, wafting_devotion, tempered_potion
0:19.060Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(26), soul_ignition, wafting_devotion, tempered_potion
0:20.071Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(27), soul_ignition, wafting_devotion, tempered_potion
0:21.080 Waiting0.086s 1.0/5 20% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(29), soul_ignition, wafting_devotion, tempered_potion
0:21.166Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(30), soul_ignition, wafting_devotion, tempered_potion
0:22.424Fuse_item_signet_of_the_priory
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(30), burnout, wafting_devotion, tempered_potion
0:22.424Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(30), bolstering_light_Vers, burnout, wafting_devotion, tempered_potion
0:23.445Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(33), bolstering_light_Vers, burnout, wafting_devotion, tempered_potion
0:24.466 Waiting1.748s 2.0/5 40% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(33), bolstering_light_Vers, burnout, wafting_devotion, tempered_potion
0:26.214Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(34), bolstering_light_Vers, burnout, wafting_devotion, tempered_potion
0:27.232Shammer_of_wrath
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(37), bolstering_light_Vers, burnout, wafting_devotion, tempered_potion
0:28.253 Waiting0.389s 1.0/5 20% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(37), bolstering_light_Vers, burnout, wafting_devotion, tempered_potion
0:28.642Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(37), bolstering_light_Vers, burnout, wafting_devotion, tempered_potion
0:29.883Rblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(38), bolstering_light_Vers, burnout, wafting_devotion, tempered_potion
0:30.903Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(38), bolstering_light_Vers, burnout, wafting_devotion, tempered_potion
0:31.924Hexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(41), bolstering_light_Vers, burnout, wafting_devotion
0:32.677Mwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(41), bolstering_light_Vers, burnout, wafting_devotion
0:33.734Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(42), sacrosanct_crusade, bolstering_light_Vers, burnout, wafting_devotion
0:34.760Rblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(46), sacrosanct_crusade, bolstering_light_Vers, burnout, wafting_devotion
0:35.541Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(48), sacrosanct_crusade, bolstering_light_Vers, burnout, wafting_devotion
0:36.547Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, crusade(6), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(48), sacrosanct_crusade, bolstering_light_Vers, burnout, wafting_devotion
0:37.328Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(9), blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance, sacrosanct_crusade, bolstering_light_Vers, burnout, wafting_devotion
0:38.083Ihammer_of_light
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(9), blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance, sacrosanct_crusade, bolstering_light_Vers, burnout
0:38.837Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(9), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(4), sacrosanct_crusade, bolstering_light_Vers, burnout
0:39.593Shammer_of_wrath
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, crusade(10), blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(9), sacrosanct_crusade, bolstering_light_Vers, burnout
0:40.347 Waiting0.319s 1.0/5 20% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(9), sacrosanct_crusade, bolstering_light_Vers, burnout
0:40.666Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(9), sacrosanct_crusade, bolstering_light_Vers, burnout
0:41.839Qjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(10), sacrosanct_crusade, bolstering_light_Vers, burnout
0:42.784Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dawn(2), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(10), sacrosanct_crusade, burnout
0:43.728Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(13), sacrosanct_crusade, burnout, wafting_devotion
0:44.649Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(13), sacrosanct_crusade, burnout, wafting_devotion
0:45.570 Waiting1.443s 1.0/5 20% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(16), sacrosanct_crusade, burnout, wafting_devotion
0:47.013Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(16), sacrosanct_crusade, burnout, wafting_devotion
0:48.243Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(17), burnout, wafting_devotion
0:49.622Qjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(20), burnout, wafting_devotion
0:51.000 Waiting1.721s 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(20), burnout, wafting_devotion
0:52.721Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(21), burnout, wafting_devotion
0:54.100 Waiting1.938s 0.0/5 0% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(24), burnout, wafting_devotion
0:56.038Rblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(25), burnout, wafting_devotion
0:57.584 Waiting1.954s 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(26), burnout, wafting_devotion
0:59.538Qjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(27), burnout
1:01.156Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(28), burnout
1:02.571Hexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo crusade, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(30), burnout
1:03.326Mwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade, blessing_of_dusk, sanctification, lights_deliverance(31), burnout
1:04.699Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance(31), sacrosanct_crusade, burnout
1:06.073Ndivine_toll
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(36), sacrosanct_crusade, burnout
1:07.118Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(6), blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(37), sacrosanct_crusade, burnout
1:08.163Rblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(9), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(39), sacrosanct_crusade, burnout
1:09.133Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(40), sacrosanct_crusade, burnout
1:10.101Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(9), blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(40), sacrosanct_crusade, burnout
1:11.071Gshield_of_vengeance
[cooldowns]
Thyraelius 1.0/5 20% HoPo crusade(10), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(43), sacrosanct_crusade, burnout
1:11.827Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(43), sacrosanct_crusade, burnout
1:12.773Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(43), sacrosanct_crusade, burnout
1:13.720Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(46), sacrosanct_crusade, burnout
1:14.806Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(46), burnout
1:15.895Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(47), burnout
1:16.985Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(49), burnout
1:18.399Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo shield_of_vengeance, blessing_of_dusk, divine_resonance, hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance(2), burnout, flask_of_alchemical_chaos_mastery
1:19.807Ihammer_of_light
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, hammer_of_light_free, shake_the_heavens, sanctification(4), lights_deliverance(3), burnout, flask_of_alchemical_chaos_mastery
1:21.216Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(9), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_mastery
1:22.441Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(11), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:23.652Rblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:24.863 Waiting2.474s 1.0/5 20% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:27.337Qjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(16), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:28.735Rblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(16), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:30.126Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn(2), blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(17), flask_of_alchemical_chaos_mastery
1:31.519Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(20), flask_of_alchemical_chaos_mastery
1:32.998Hexecution_sentence
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo crusade, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(20), flask_of_alchemical_chaos_mastery
1:33.752Mwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(21), flask_of_alchemical_chaos_mastery
1:35.105Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(22), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:36.456Rblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(27), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:37.481Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(28), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:38.506Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(6), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(28), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:39.532Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(31), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:40.488Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(31), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:41.442Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(32), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:42.396 Waiting1.957s 1.0/5 20% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(34), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:44.353Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(35), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:45.675Rblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(36), flask_of_alchemical_chaos_mastery
1:47.066Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(37), flask_of_alchemical_chaos_mastery
1:48.458Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(39), flask_of_alchemical_chaos_haste
1:49.785Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(40), flask_of_alchemical_chaos_haste
1:51.111 Waiting3.014s 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(43), flask_of_alchemical_chaos_haste
1:54.125Qjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(44), flask_of_alchemical_chaos_haste
1:55.600Rblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(45), flask_of_alchemical_chaos_haste
1:56.924Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(45), flask_of_alchemical_chaos_haste
1:58.250 Waiting0.333s 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(48), flask_of_alchemical_chaos_haste
1:58.583Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(48), flask_of_alchemical_chaos_haste
1:59.910Ihammer_of_light
[finishers]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification, lights_deliverance, flask_of_alchemical_chaos_haste
2:01.236 Waiting1.978s 0.0/5 0% HoPo crusade, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(6), sacrosanct_crusade, flask_of_alchemical_chaos_haste
2:03.214Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(8), sacrosanct_crusade, flask_of_alchemical_chaos_haste
2:04.505Hexecution_sentence
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo crusade, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(8), sacrosanct_crusade, flask_of_alchemical_chaos_haste
2:05.259Euse_item_ashes_of_the_embersoul
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(9), sacrosanct_crusade, flask_of_alchemical_chaos_haste
2:05.259Mwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(9), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:06.413Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(9), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:07.534Ndivine_toll
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(14), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:08.513Jdivine_storm
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(6), empyrean_power, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(15), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:09.492Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(18), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:10.401Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(18), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:11.291Qjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), empyrean_power, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(19), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:12.180Jdivine_storm
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), empyrean_power, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(19), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:13.069Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(22), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:13.957Gshield_of_vengeance
[cooldowns]
Thyraelius 2.0/5 40% HoPo crusade(10), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(22), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:14.826Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(22), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:15.848Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(23), sacrosanct_crusade, soul_ignition, flask_of_alchemical_chaos_haste
2:17.174Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(26), soul_ignition, flask_of_alchemical_chaos_haste
2:18.500Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(26), soul_ignition, flask_of_alchemical_chaos_mastery
2:19.893Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(29), soul_ignition, flask_of_alchemical_chaos_mastery
2:21.284Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(30), soul_ignition, flask_of_alchemical_chaos_mastery
2:22.677Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(5), lights_deliverance(32), soul_ignition, flask_of_alchemical_chaos_mastery
2:24.070Rblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(33), soul_ignition, flask_of_alchemical_chaos_mastery
2:25.462Fuse_item_signet_of_the_priory
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(34), burnout, flask_of_alchemical_chaos_mastery
2:25.462Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(34), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:26.871Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(36), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:28.282Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(37), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:29.690Shammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(40), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:31.058Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(41), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:32.425Qjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(4), divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(43), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:33.685Kfinal_verdict
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo divine_purpose, blessing_of_dusk, sanctification(2), lights_deliverance(45), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:35.093Hexecution_sentence
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, sanctification, lights_deliverance(46), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:35.849Mwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, sanctification, lights_deliverance(46), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:37.258Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance(46), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:38.626Rblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(9), divine_purpose, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance, sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:39.592Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), divine_purpose, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance, sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:40.555Ihammer_of_light
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), divine_purpose, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(2), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:41.522Qjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(5), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:42.465Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(8), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:43.410 Waiting0.512s 2.0/5 40% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(10), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:43.922Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(11), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:44.866Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(11), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
2:45.878Jdivine_storm
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo empyrean_power, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(12), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_mastery
2:47.104Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(14), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_mastery
2:48.331Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(17), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
2:49.555Qjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(17), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
2:50.963Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(18), burnout, flask_of_alchemical_chaos_crit
2:52.372Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(21), burnout, flask_of_alchemical_chaos_crit
2:53.778Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(22), burnout, flask_of_alchemical_chaos_crit
2:55.187Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(24), burnout, flask_of_alchemical_chaos_crit
2:56.596 Waiting0.295s 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(25), burnout, flask_of_alchemical_chaos_crit
2:56.891Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(25), burnout, flask_of_alchemical_chaos_crit
2:58.301Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(26), burnout, flask_of_alchemical_chaos_crit
2:59.711Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(27), burnout, flask_of_alchemical_chaos_crit
3:01.121Qjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_purpose, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(29), burnout, flask_of_alchemical_chaos_crit
3:02.529Shammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo divine_purpose, blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(30), burnout, flask_of_alchemical_chaos_crit
3:03.937Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_purpose, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(31), burnout, flask_of_alchemical_chaos_crit
3:05.345Hexecution_sentence
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(33), burnout, flask_of_alchemical_chaos_crit
3:06.100Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(34), burnout, flask_of_alchemical_chaos_crit
3:07.468Mwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(4), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(36), burnout, flask_of_alchemical_chaos_crit
3:08.727Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(4), empyrean_power, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance(38), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
3:09.987Ndivine_toll
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(9), empyrean_power, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(42), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
3:10.953Qjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), empyrean_power, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(43), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
3:11.918Jdivine_storm
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(9), empyrean_power, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(44), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
3:12.883Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(46), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
3:13.825Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(47), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
3:14.768Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(47), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
3:15.713Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(48), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
3:16.657Ihammer_of_light
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dusk, divine_resonance, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(3), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
3:17.601Gshield_of_vengeance
[cooldowns]
Thyraelius 2.0/5 40% HoPo crusade(10), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(4), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_mastery
3:18.354Qjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(6), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_mastery
3:19.303Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(7), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_mastery
3:20.251Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(9), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_mastery
3:21.199Phammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), divine_purpose, shield_of_vengeance, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(5), lights_deliverance(10), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_mastery
3:22.146Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), divine_purpose, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(10), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_mastery
3:23.095Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), divine_purpose, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(11), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_mastery
3:24.043Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(13), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_mastery
3:25.273Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
3:26.669Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo divine_purpose, shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(16), flask_of_alchemical_chaos_mastery
3:28.067Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(17), flask_of_alchemical_chaos_mastery
3:29.463Rblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo divine_purpose, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(18), flask_of_alchemical_chaos_mastery
3:30.860Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_purpose, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(18), flask_of_alchemical_chaos_mastery
3:32.256Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(21), flask_of_alchemical_chaos_mastery
3:33.654Kfinal_verdict
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(24), flask_of_alchemical_chaos_mastery
3:35.052Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(27), flask_of_alchemical_chaos_mastery
3:36.449Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(27), flask_of_alchemical_chaos_mastery
3:37.846Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(30), flask_of_alchemical_chaos_mastery
3:39.243Hexecution_sentence
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(31), flask_of_alchemical_chaos_mastery
3:40.000Mwake_of_ashes
[generators]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(31), flask_of_alchemical_chaos_mastery
3:41.398Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance(32), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
3:42.756Rblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(37), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
3:43.789 Waiting1.319s 2.0/5 40% HoPo crusade(6), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(38), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
3:45.108Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(6), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(38), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
3:46.313Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(6), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(39), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
3:47.343Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(41), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:48.251Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(42), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:49.160Phammer_of_wrath
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(10), blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(44), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:50.048 Waiting0.089s 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(45), sacrosanct_crusade, flask_of_alchemical_chaos_haste
3:50.137Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(45), sacrosanct_crusade, wafting_devotion, flask_of_alchemical_chaos_haste
3:51.433Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(45), wafting_devotion, flask_of_alchemical_chaos_haste
3:52.730Rblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(48), wafting_devotion, flask_of_alchemical_chaos_haste
3:53.989Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(49), wafting_devotion, flask_of_alchemical_chaos_haste
3:55.246Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(49), wafting_devotion, flask_of_alchemical_chaos_haste
3:56.503Qjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification, lights_deliverance(2), wafting_devotion, flask_of_alchemical_chaos_haste
3:57.800Ihammer_of_light
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(3), wafting_devotion, flask_of_alchemical_chaos_haste
3:59.095Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(7), sacrosanct_crusade, wafting_devotion, flask_of_alchemical_chaos_haste
4:00.223 Waiting0.291s 0.0/5 0% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(11), sacrosanct_crusade, wafting_devotion, flask_of_alchemical_chaos_haste
4:00.514Rblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(11), sacrosanct_crusade, wafting_devotion, flask_of_alchemical_chaos_haste
4:01.864Phammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(12), sacrosanct_crusade, wafting_devotion, flask_of_alchemical_chaos_haste
4:02.992Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(12), sacrosanct_crusade, wafting_devotion, flask_of_alchemical_chaos_haste
4:04.119 Waiting0.661s 0.0/5 0% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(15), sacrosanct_crusade, wafting_devotion, flask_of_alchemical_chaos_haste
4:04.780Qjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(15), sacrosanct_crusade, wafting_devotion, flask_of_alchemical_chaos_haste
4:06.084 Waiting0.298s 2.0/5 40% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(16), sacrosanct_crusade, flask_of_alchemical_chaos_haste
4:06.382Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(16), sacrosanct_crusade, flask_of_alchemical_chaos_haste
4:07.708Phammer_of_wrath
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(18), sacrosanct_crusade, flask_of_alchemical_chaos_haste
4:09.068Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(19), wafting_devotion, flask_of_alchemical_chaos_haste
4:10.364Hexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(20), wafting_devotion, flask_of_alchemical_chaos_haste
4:11.120Euse_item_ashes_of_the_embersoul
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(20), wafting_devotion, flask_of_alchemical_chaos_haste
4:11.120Mwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(20), soul_ignition, wafting_devotion, flask_of_alchemical_chaos_haste
4:12.417Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(21), sacrosanct_crusade, soul_ignition, wafting_devotion, flask_of_alchemical_chaos_haste
4:13.674Ndivine_toll
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(25), sacrosanct_crusade, soul_ignition, wafting_devotion, flask_of_alchemical_chaos_haste
4:14.632Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(6), blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(27), sacrosanct_crusade, soul_ignition, wafting_devotion, flask_of_alchemical_chaos_haste
4:15.589Phammer_of_wrath
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(9), divine_purpose, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(29), sacrosanct_crusade, soul_ignition, wafting_devotion, flask_of_alchemical_chaos_haste
4:16.477Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), divine_purpose, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(30), sacrosanct_crusade, soul_ignition, wafting_devotion, flask_of_alchemical_chaos_haste
4:17.368Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), divine_purpose, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(30), sacrosanct_crusade, soul_ignition, wafting_devotion, flask_of_alchemical_chaos_mastery
4:18.304Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(33), sacrosanct_crusade, soul_ignition, wafting_devotion, flask_of_alchemical_chaos_mastery
4:19.219Phammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(33), sacrosanct_crusade, soul_ignition, wafting_devotion, flask_of_alchemical_chaos_mastery
4:20.133Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(34), sacrosanct_crusade, soul_ignition, wafting_devotion, flask_of_alchemical_chaos_mastery
4:21.047Gshield_of_vengeance
[cooldowns]
Thyraelius 2.0/5 40% HoPo crusade(10), blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(36), sacrosanct_crusade, soul_ignition, wafting_devotion, flask_of_alchemical_chaos_mastery
4:21.800Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(37), sacrosanct_crusade, soul_ignition, wafting_devotion, flask_of_alchemical_chaos_mastery
4:22.851Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(37), soul_ignition, wafting_devotion, flask_of_alchemical_chaos_mastery
4:23.901Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(38), soul_ignition, flask_of_alchemical_chaos_mastery
4:24.978Phammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(40), soul_ignition, flask_of_alchemical_chaos_mastery
4:26.053Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(41), soul_ignition, flask_of_alchemical_chaos_mastery
4:27.130Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(43), soul_ignition, flask_of_alchemical_chaos_mastery
4:28.526Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo shield_of_vengeance, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(44), soul_ignition, flask_of_alchemical_chaos_mastery
4:29.924Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(47), soul_ignition, flask_of_alchemical_chaos_mastery
4:31.320Fuse_item_signet_of_the_priory
[cooldowns]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(47), burnout, flask_of_alchemical_chaos_mastery
4:31.320Rblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(47), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:32.735Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(48), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:34.150Phammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo empyrean_power, divine_purpose, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:35.565Rblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo empyrean_power, divine_purpose, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(3), lights_deliverance, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:36.979Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo empyrean_power, divine_purpose, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(2), bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:38.393Jdivine_storm
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo empyrean_power, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(8), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:39.625Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_purpose, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(10), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:40.856Hexecution_sentence
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dusk, undisputed_ruling, shake_the_heavens, lights_deliverance(13), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:41.610Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dusk, undisputed_ruling, shake_the_heavens, lights_deliverance(13), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:42.805Mwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(4), blessing_of_dusk, undisputed_ruling, shake_the_heavens, lights_deliverance(16), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:43.906Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(4), blessing_of_dusk, hammer_of_light_ready, undisputed_ruling, shake_the_heavens, lights_deliverance(17), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:45.005Phammer_of_wrath
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(9), blessing_of_dusk, undisputed_ruling, shake_the_heavens, lights_deliverance(21), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:45.976Qjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, lights_deliverance(23), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:46.946Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(9), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(23), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_mastery
4:47.915Rblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(26), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_crit
4:48.858Rblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(26), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_crit
4:49.802Phammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(27), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_crit
4:50.745Jdivine_storm
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), empyrean_power, blessing_of_dawn(2), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(27), sacrosanct_crusade, bolstering_light_Mastery, burnout, flask_of_alchemical_chaos_crit
4:51.688Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(29), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
4:52.634Rblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(30), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
4:53.720Rblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(30), sacrosanct_crusade, burnout, flask_of_alchemical_chaos_crit
4:54.806Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(31), burnout, flask_of_alchemical_chaos_crit
4:56.215Phammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo empyrean_power, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(34), burnout, flask_of_alchemical_chaos_crit
4:57.623Jdivine_storm
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo empyrean_power, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(34), burnout, flask_of_alchemical_chaos_crit
4:59.032Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dusk, shake_the_heavens, lights_deliverance(37), burnout, flask_of_alchemical_chaos_crit
5:00.441Qjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, lights_deliverance(40), burnout, flask_of_alchemical_chaos_crit

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength176470357793497814385 (12945)
Agility61760617661760
Stamina86452018744717852175840
Intellect17647018176176470
Spirit00000
Health374894035704200
Holy Power550
Spell Power18176402710
Crit15.56%15.56%4593
Haste7.61%8.05%5315
Swing Speed50.65%51.27%5315
Versatility9.90%7.28%5679
Attack Power3806035447469
Mastery36.55%26.11%5136
Armor300933009330093
Run Speed700

Gear

Source Slot Average Item Level: 541.00
Local Head Derill's Unused Visor
ilevel: 532, stats: { 3,437 Armor, +7,192 Sta, +651 Crit, +597 Haste, +1,400 StrInt }
Local Neck The Flame's Remembrance
ilevel: 532, stats: { +4,045 Sta, +1,607 Crit, +1,277 Vers }
Local Shoulders Heartfire Sentinel's Steelwings
ilevel: 506, stats: { 2,506 Armor, +3,858 Sta, +286 Crit, +567 Vers, +824 StrInt }
Local Shirt Formal White Shirt
ilevel: 1
Local Chest Sedimentary Breastplate of the Harmonious (sedimentary_breastplate)
ilevel: 574, stats: { 6,869 Armor, +9,290 Sta, +2,071 StrInt, +1,020 Mastery, +408 Vers }
Local Waist Scrit's Handmade Girdle
ilevel: 532, stats: { 2,578 Armor, +5,394 Sta, +428 Vers, +508 Mastery, +1,050 StrInt }
Local Legs Sedimentary Legguards of the Aurora (sedimentary_legguards)
ilevel: 538, stats: { 4,130 Armor, +7,624 Sta, +1,481 StrInt, +454 Haste, +817 Vers }
Local Feet Spore Giant's Stompers
ilevel: 571, stats: { 4,232 Armor, +6,712 Sta, +465 Vers, +585 Mastery, +1,510 StrInt }
Local Wrists Corrupted Earthen Wristguards
ilevel: 535, stats: { 2,325 Armor, +4,191 Sta, +294 Crit, +415 Vers, +810 StrInt }
Local Hands Arathi Officer's Gauntlets
ilevel: 548, stats: { 2,794 Armor, +5,994 Sta, +407 Haste, +575 Mastery, +1,219 StrInt }
Local Finger1 Spinner's Circlet of the Fireflash (spinners_circlet)
ilevel: 545, stats: { +4,435 Sta, +859 Crit, +2,148 Haste }
Local Finger2 Radiant Necromancer's Band
ilevel: 554, stats: { +4,620 Sta, +1,191 Vers, +1,897 Mastery }
Local Trinket1 Signet of the Priory
ilevel: 541, stats: { +1,447 StrAgiInt }
item effects: { use: Bolstering Light, equip: Signet of the Priory }
Local Trinket2 Ashes of the Embersoul
ilevel: 506, stats: { +813 Haste }
item effects: { equip: Ashes of the Embersoul, use: Soul Ignition }
Local Back Gem-Woven Shawl of the Peerless (gemwoven_shawl)
ilevel: 571, stats: { 1,222 Armor, +5,034 Sta, +1,133 StrAgiInt, +338 Crit, +450 Mastery }
Local Main Hand Fyr'alath the Dreamrender
ilevel: 535, weapon: { 2,536 - 5,268, 3.6 }, stats: { +1,440 Str, +7,451 Sta, +468 Crit, +792 Haste }, enchant: wafting_devotion_3, temporary_enchant: Ironclaw Sharpened Weapon
item effects: { use: Rage of Fyr'alath, equip: Fyr'alath the Dreamrender }
Local Tabard Argent Crusader's Tabard
ilevel: 1
item effects: { use: }

Talents

Talent Tables

Paladin Talents [31]
1
2
3
4
5
6
7
8
9
10
Retribution Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

paladin="Thyraelius"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/thyraelius"
spec=retribution
level=80
race=human
role=attack
position=back
talents=CYEA5ba6OK14IUITjS1kSUVJcBAAAYAgRstNzstsNzYzM2WMbDAAAAAAzWTzwwMjtZwsNMmlZW2GzgZYYZhNAAAyMTbzysNDAYDYAAjZYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=the_sushi_special
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3

head=derills_unused_visor,id=228438,bonus_id=11128,drop_level=77
neck=the_flames_remembrance,id=226140,bonus_id=11128,drop_level=77
shoulders=heartfire_sentinels_steelwings,id=217200,bonus_id=6652/10329/7980/10884/8094/10869/1498
back=gemwoven_shawl,id=224663,bonus_id=10297/6652/1687/1643/10254
chest=sedimentary_breastplate,id=224690,bonus_id=6652/1711/10296/1646/10254
shirt=formal_white_shirt,id=4334
tabard=argent_crusaders_tabard,id=46874
wrists=corrupted_earthen_wristguards,id=223402,bonus_id=11061,drop_level=77
hands=arathi_officers_gauntlets,id=226139,bonus_id=11061,drop_level=79
waist=scrits_handmade_girdle,id=228657,bonus_id=11128,drop_level=77
legs=sedimentary_legguards,id=224694,bonus_id=10382/6652/1709,drop_level=78
feet=spore_giants_stompers,id=221204,bonus_id=10297/6652/1606/10254
finger1=spinners_circlet,id=224593,bonus_id=10382/6652/10394/10393/1762/10844,drop_level=79
finger2=radiant_necromancers_band,id=221200,bonus_id=11338/10386/6652/10395/10392
trinket1=signet_of_the_priory,id=219308,bonus_id=10385/10387/6652,drop_level=78
trinket2=ashes_of_the_embersoul,id=207167,bonus_id=6652/7979/10884/10317/1537/8767
main_hand=fyralath_the_dreamrender,id=206448,bonus_id=10351/10964/1507,enchant=wafting_devotion_3

# Gear Summary
# gear_ilvl=541.33
# gear_strength=14385
# gear_stamina=75840
# gear_attack_power=469
# gear_crit_rating=4503
# gear_haste_rating=5211
# gear_mastery_rating=5035
# gear_versatility_rating=5568
# gear_armor=30093

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 57542197
Max Event Queue: 94
Sim Seconds: 3006776
CPU Seconds: 64.3317
Physical Seconds: 34.7862
Speed Up: 46739

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Thyraelius Thyraelius augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Thyraelius Thyraelius blade_of_justice 184575 9851996 32841 12.44 133414 274255 62.2 62.2 17.8% 0.0% 0.0% 0.0% 4.75sec 9851996 299.99sec
Thyraelius Thyraelius blade_of_justice_consecration 26573 0 0 0.00 0 0 21.6 0.0 0.0% 0.0% 0.0% 0.0% 13.90sec 0 299.99sec
Thyraelius Thyraelius blade_of_justice_consecration_tick ticks -81297 1999063 6664 0.00 4860 9991 0.0 0.0 17.8% 0.0% 0.0% 0.0% 0.00sec 1999063 299.99sec
Thyraelius Thyraelius divine_storm 53385 1554979 5183 1.53 170796 351822 7.7 7.7 17.9% 0.0% 0.0% 0.0% 35.17sec 1554979 299.99sec
Thyraelius Thyraelius divine_storm_tempest 224239 204472 682 1.53 22432 46109 7.7 7.7 18.1% 0.0% 0.0% 0.0% 35.17sec 204472 299.99sec
Thyraelius Thyraelius divine_toll 375576 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.75sec 0 299.99sec
Thyraelius Thyraelius divine_toll_judgment 20271 1190138 3967 1.07 188313 385563 5.4 5.4 17.2% 0.0% 0.0% 0.0% 61.75sec 1190138 299.99sec
Thyraelius Thyraelius divine_resonance_judgment 20271 2044371 6815 3.11 110600 228778 15.6 15.6 17.6% 0.0% 0.0% 0.0% 18.71sec 2044371 299.99sec
Thyraelius Thyraelius empyrean_hammer 431398 30220018 100738 80.13 63510 130725 400.6 400.6 17.7% 0.0% 0.0% 0.0% 0.74sec 30220018 299.99sec
Thyraelius Thyraelius execution_sentence 387113 12787216 42626 1.93 1322580 0 9.7 9.7 0.0% 0.0% 0.0% 0.0% 31.69sec 12787216 299.99sec
Thyraelius Thyraelius expurgation ticks -383346 8624763 28749 25.58 56697 117129 62.2 127.9 17.8% 0.0% 0.0% 0.0% 4.75sec 8624763 299.99sec
Thyraelius Thyraelius final_verdict 383328 22858330 76198 16.76 229422 472460 83.8 83.8 17.9% 0.0% 0.0% 0.0% 3.55sec 22858330 299.99sec
Thyraelius Thyraelius flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Thyraelius Thyraelius food 457302 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Thyraelius Thyraelius hammer_of_light 427453 18460749 61538 3.45 903782 1848125 17.3 17.3 17.6% 0.0% 0.0% 0.0% 17.62sec 18460749 299.99sec
Thyraelius Thyraelius hammer_of_wrath 24275 3515224 11718 3.63 163009 333163 18.2 18.2 18.0% 0.0% 0.0% 0.0% 15.99sec 3515224 299.99sec
Thyraelius Thyraelius highlords_judgment 383921 2993240 9978 5.62 90410 181485 28.1 28.1 17.7% 0.0% 0.0% 0.0% 10.56sec 2993240 299.99sec
Thyraelius Thyraelius judgment 20271 4010730 13370 6.40 105475 216699 32.0 32.0 17.9% 0.0% 0.0% 0.0% 9.38sec 4010730 299.99sec
Thyraelius Thyraelius mark_of_fyralath ticks -414532 1201104 4004 26.97 7565 15148 813.3 134.8 17.7% 0.0% 0.0% 0.0% 0.37sec 1201104 299.99sec
Thyraelius Thyraelius melee 0 0 0 0.00 0 0 158.1 0.0 0.0% 0.0% 0.0% 0.0% 1.89sec 0 299.99sec
Thyraelius Thyraelius crusading_strike 408385 8265907 27554 31.62 44005 90555 158.1 158.1 17.8% 0.0% 0.0% 0.0% 1.89sec 8265907 299.99sec
Thyraelius Thyraelius potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.09sec 0 299.99sec
Thyraelius Thyraelius sacrosanct_crusade_heal 461885 0 0 0.00 0 0 17.3 0.0 0.0% 0.0% 0.0% 0.0% 17.62sec 0 299.99sec
Thyraelius Thyraelius searing_light 407478 822705 2742 0.84 165955 340661 4.2 4.2 17.7% 0.0% 0.0% 0.0% 60.77sec 822705 299.99sec
Thyraelius Thyraelius searing_light_consecration 26573 0 0 0.00 0 0 4.2 0.0 0.0% 0.0% 0.0% 0.0% 60.77sec 0 299.99sec
Thyraelius Thyraelius searing_light_consecration_tick ticks -81297 445791 1486 0.00 5118 10527 0.0 0.0 17.7% 0.0% 0.0% 0.0% 0.00sec 445791 299.99sec
Thyraelius Thyraelius shield_of_vengeance 184662 0 0 0.98 0 0 4.9 4.9 0.0% 0.0% 0.0% 0.0% 64.09sec 0 299.99sec
Thyraelius Thyraelius shield_of_vengeance_proc 184689 6150267 20502 0.98 1253333 0 4.9 4.9 0.0% 0.0% 0.0% 0.0% 64.73sec 6150267 299.99sec
Thyraelius Thyraelius signet_of_the_priory 443531 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 126.69sec 0 299.99sec
Thyraelius Thyraelius wake_of_ashes 255937 2969913 9900 1.98 253176 519830 9.9 9.9 17.7% 0.0% 0.0% 0.0% 31.78sec 2969913 299.99sec
Thyraelius Thyraelius truths_wake ticks -403695 4099216 13664 11.99 57363 118744 9.9 60.0 17.9% 0.0% 0.0% 0.0% 31.78sec 4099216 299.99sec
Thyraelius Thyraelius seething_flames_0 405345 1963728 6546 1.97 167971 344906 9.9 9.9 17.5% 0.0% 0.0% 0.0% 31.78sec 1963728 299.99sec
Thyraelius Thyraelius seething_flames_1 405350 1978672 6596 1.97 169075 346902 9.9 9.9 17.8% 0.0% 0.0% 0.0% 31.78sec 1978672 299.99sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health484,678.70.00.00%0.0100.0%

Scale Factors for other metrics

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Execution Sentence9.70.031.7s31.7s8.0s25.79%0.00%0.0 (0.0)9.7

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_execution_sentence
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 46.8s
  • trigger_min/max:30.0s / 46.8s
  • trigger_pct:100.00%
  • duration_min/max:8.0s / 8.0s
  • uptime_min/max:23.58% / 28.16%

Stack Uptimes

  • execution_sentence_1:25.79%

Spelldata

  • id:343527
  • name:Execution Sentence
  • tooltip:Sentenced to suffer {$s2=20}% of the damage your abilities deal during its duration as Holy damage.
  • description:A hammer slowly falls from the sky upon the target, after {$d=8 seconds}, they suffer {$s2=20}% of the damage taken from your abilities as Holy damage during that time. {$?s406158=false} [|cFFFFFFFFGenerates {$406158s1=3} Holy Power.][]
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:100.00%
Judgment70.00.010.8s4.3s11.4s79.20%87.22%0.0 (0.0)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_judgment
  • max_stacks:20
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 46.8s
  • trigger_min/max:0.0s / 26.2s
  • trigger_pct:99.80%
  • duration_min/max:0.0s / 36.6s
  • uptime_min/max:67.33% / 88.16%

Stack Uptimes

  • judgment_1:16.99%
  • judgment_2:21.85%
  • judgment_3:14.27%
  • judgment_4:10.53%
  • judgment_5:7.12%
  • judgment_6:4.70%
  • judgment_7:2.50%
  • judgment_8:0.98%
  • judgment_9:0.23%
  • judgment_10:0.03%
  • judgment_11:0.00%
  • judgment_12:0.00%

Spelldata

  • id:197277
  • name:Judgment
  • tooltip:Taking {$=}w1% increased damage from {$@=}auracaster's next Holy Power ability.
  • description:{$@spelldesc20271=Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]}
  • max_stacks:20
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 494194.85
Minimum 442983.71
Maximum 557373.60
Spread ( max - min ) 114389.88
Range [ ( max - min ) / 2 * 100% ] 11.57%
Standard Deviation 13934.9635
5th Percentile 471439.74
95th Percentile 517169.67
( 95th Percentile - 5th Percentile ) 45729.93
Mean Distribution
Standard Deviation 139.3566
95.00% Confidence Interval ( 493921.71 - 494467.98 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3055
0.1 Scale Factor Error with Delta=300 1657660
0.05 Scale Factor Error with Delta=300 6630639
0.01 Scale Factor Error with Delta=300 165765955
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health01175509100
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.