SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.5.57534 Live (hotfix 2024-11-14/57534, git build 9abb449df1)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Swissly : 913,732 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
913,732.3913,732.3490.7 / 0.054%98,916.5 / 10.8%34.2
Resource Out In Waiting APM Active
Mana26,087.426,015.10.00%49.9100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/swissly
TalentCAEAjd9IgsSkCmGQ8vOmZtyV7YGYzCmZmxsYYMzoxYegxMzMmZMjZYmZmxMzMzMzMDmZWmpZmtZBCAAaBAAAAAAAAAAAAAAA
Set Bonus
Scale Factors for Swissly Damage Per Second
Int Haste Vers Crit Mastery
Scale Factors 15.99 12.68 10.39 10.20 7.91
Normalized 1.00 0.79 0.65 0.64 0.49
Scale Deltas 2310 2310 2310 2310 2310
Error 0.31 0.30 0.31 0.30 0.31
Ranking
  • Int > Haste > Vers ~= Crit > Mastery
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, Intellect=15.99, CritRating=10.20, HasteRating=12.68, MasteryRating=7.91, Versatility=10.39 )

Scale Factors for other metrics

Scale Factors for Swissly Priority Target Damage Per Second
Int Haste Vers Crit Mastery
Scale Factors 15.99 12.68 10.39 10.20 7.91
Normalized 1.00 0.79 0.65 0.64 0.49
Scale Deltas 2310 2310 2310 2310 2310
Error 0.31 0.30 0.31 0.30 0.31
Ranking
  • Int > Haste > Vers ~= Crit > Mastery
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, Intellect=15.99, CritRating=10.20, HasteRating=12.68, MasteryRating=7.91, Versatility=10.39 )
Scale Factors for Swissly Damage Per Second (Effective)
Int Haste Vers Crit Mastery
Scale Factors 15.99 12.68 10.39 10.20 7.91
Normalized 1.00 0.79 0.65 0.64 0.49
Scale Deltas 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00
Ranking
  • Int > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, Intellect=15.99, CritRating=10.20, HasteRating=12.68, MasteryRating=7.91, Versatility=10.39 )
Scale Factors for Swissly Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Swissly Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Swissly Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Swissly Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Swissly Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Swissly Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Swissly Fight Length
Int Haste Mastery Vers Crit
Scale Factors -0.00 -0.00 0.00 0.00 0.00
Normalized 1.00 0.99 -0.01 -0.99 -1.00
Scale Deltas 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00
Ranking
  • Int > Haste > Mastery > Vers > Crit
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, Intellect=0.00, CritRating=-0.00, HasteRating=0.00, MasteryRating=-0.00, Versatility=-0.00 )
Scale Factors for Raid Damage Per Second
Int Haste Vers Crit Mastery
Scale Factors 15.99 12.68 10.39 10.20 7.91
Normalized 1.00 0.79 0.65 0.64 0.49
Scale Deltas 2310 2310 2310 2310 2310
Error 0.31 0.30 0.31 0.30 0.31
Ranking
  • Int > Haste > Vers ~= Crit > Mastery
Pawn string ( Pawn: v1: "Swissly-Frost": Class=Mage, Spec=Frost, Intellect=15.99, CritRating=10.20, HasteRating=12.68, MasteryRating=7.91, Versatility=10.39 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Swissly913,732
(cold_front_) Frozen Orb 0 (6,904)0.0% (0.8%)2.798.29s775,9480

Stats Details: Cold Front Frozen Orb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.680.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Front Frozen Orb

  • id:84714
  • school:frost
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches an orb of swirling ice up to {$s1=40} yds forward which deals up to {$=}{20*{$84721s1=0}} Frost damage to all enemies it passes through over {$d=15 seconds}. Deals reduced damage beyond {$84721s2=8} targets. Grants 1 charge of Fingers of Frost when it first damages an enemy.{$?a382103=false}[ While Frozen Orb is active, you gain Fingers of Frost every {$382106t1=3} sec.][] Enemies damaged by the Frozen Orb are slowed by {$289308s1=30}% for {$289308d=3 seconds}.
    (cold_front_) Frozen Orb 6,9040.8%63.12.80s32,9720Direct63.120,05142,36132,97257.9%

Stats Details: Cold Front Frozen Orb Bolt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage63.0563.050.000.000.000.00000.00002,078,973.102,078,973.100.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit42.08%26.5355020,050.7915,58836,77120,085.6818,05529,121532,022532,0220.00%
crit57.92%36.52116142,361.3532,14877,59542,368.0338,11361,1551,546,9511,546,9510.00%

Action Details: Cold Front Frozen Orb Bolt

  • id:84721
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:9.5
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.132000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.30

Spelldata

  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=0}%.
  • description:{$@spelldesc84714=Launches an orb of swirling ice up to {$s1=40} yds forward which deals up to {$=}{20*{$84721s1=0}} Frost damage to all enemies it passes through over {$d=15 seconds}. Deals reduced damage beyond {$84721s2=8} targets. Grants 1 charge of Fingers of Frost when it first damages an enemy.{$?a382103=false}[ While Frozen Orb is active, you gain Fingers of Frost every {$382106t1=3} sec.][] Enemies damaged by the Frozen Orb are slowed by {$289308s1=30}% for {$289308d=3 seconds}.}
Comet Storm 0 (43,981)0.0% (4.8%)14.022.06s942,553942,681

Stats Details: Comet Storm

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.990.000.000.000.000.99990.00000.000.000.00%942,681.11942,681.11

Action Details: Comet Storm

  • id:153595
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:25000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:153595
  • name:Comet Storm
  • school:frost
  • tooltip:
  • description:Calls down a series of 7 icy comets on and around the target, that deals up to {$=}{7*{$153596s1=0}} Frost damage to all enemies within {$228601=}A1 yds of its impacts.

Action Priority List

    st_aoebuild
    [P]:13.99
  • if_expr:prev_gcd.1.flurry&(buff.icy_veins.down|talent.frostfire_bolt)
    Comet Storm (_projectile) 43,9814.8%97.42.97s135,3660Direct97.472,847150,788135,36480.2%

Stats Details: Comet Storm Projectile

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage97.4497.440.000.000.000.00000.000013,189,994.1013,189,994.100.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit19.79%19.2843872,847.4550,758120,80772,810.4362,29989,5481,404,7161,404,7160.00%
crit80.21%78.1650109150,787.60105,273254,253150,815.13139,204166,51111,785,27811,785,2780.00%

Action Details: Comet Storm Projectile

  • id:153596
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:153596
  • name:Comet Storm
  • school:frost
  • tooltip:
  • description:{$@spelldesc153595=Calls down a series of 7 icy comets on and around the target, that deals up to {$=}{7*{$153596s1=0}} Frost damage to all enemies within {$228601=}A1 yds of its impacts.}
(excess_) Ice Nova 16,6541.8%23.612.61s211,2980Direct23.6152,700323,274211,29234.4%

Stats Details: Excess Ice Nova

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage23.6423.640.000.000.000.00000.00004,995,590.064,995,590.060.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit65.65%15.52527152,700.27116,230255,090152,673.23135,486176,6502,370,0852,370,0850.00%
crit34.35%8.12018323,274.12245,413536,188323,505.340434,1292,625,5052,625,5050.00%

Action Details: Excess Ice Nova

  • id:157997
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.380000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.25

Spelldata

  • id:157997
  • name:Ice Nova
  • school:frost
  • tooltip:Frozen.
  • description:Causes a whirl of icy wind around the enemy, dealing {$s1=0} Frost damage to the target and all other enemies within {$=}a2 yds, freezing them in place for {$d=2 seconds}. Damage reduced beyond {$s3=8} targets.
Flurry 0 (78,507)0.0% (8.6%)47.66.38s494,760495,124

Stats Details: Flurry

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage47.560.000.000.000.000.99930.00000.000.000.00%495,124.05495,124.05

Action Details: Flurry

  • id:44614
  • school:frost
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:25000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:44614
  • name:Flurry
  • school:frost
  • tooltip:
  • description:Unleash a flurry of ice, striking the target {$s1=3} times for a total of {$=}{{$228354s2=0}*{$m1=3}} Frost damage. Each hit reduces the target's movement speed by {$228354s1=70}% for {$228354d=1 second}{$?a378947=true}[, has a {$378947s1=25}% chance to activate Glacial Assault,][] and applies Winter's Chill to the target. Winter's Chill causes the target to take damage from your spells as if it were frozen.

Action Priority List

    cds
    [L]:1.00
  • if_expr:time=0&active_enemies<=2
    st_aoebuild
    [Q]:46.56
  • if_expr:cooldown_react&(buff.icicles.react<5|talent.splinterstorm)&(remaining_winters_chill=0&debuff.winters_chill.down&(prev_gcd.1.frostbolt|prev_gcd.1.frostfire_bolt|prev_gcd.1.glacial_spike)|buff.excess_frost.react)
    Flurry (_bolt) 70,7567.7%142.52.09s148,8570Direct142.585,221179,644148,85567.4%

Stats Details: Flurry Bolt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage142.46142.460.000.000.000.00000.000021,206,619.0521,206,619.050.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit32.61%46.46267185,221.0046,293153,08185,204.7476,58294,2973,959,1543,959,1540.00%
crit67.39%96.0161132179,644.3796,620321,767179,654.83167,015193,99117,247,46517,247,4650.00%

Action Details: Flurry Bolt

  • id:228354
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.595000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.15

Spelldata

  • id:228354
  • name:Flurry
  • school:frost
  • tooltip:Movement slowed by {$=}w1%.
  • description:{$@spelldesc44614=Unleash a flurry of ice, striking the target {$s1=3} times for a total of {$=}{{$228354s2=0}*{$m1=3}} Frost damage. Each hit reduces the target's movement speed by {$228354s1=70}% for {$228354d=1 second}{$?a378947=true}[, has a {$378947s1=25}% chance to activate Glacial Assault,][] and applies Winter's Chill to the target. Winter's Chill causes the target to take damage from your spells as if it were frozen.}
    (flurry_) Icicle 9040.1%2.670.81s103,5920Direct2.673,352171,439103,72731.0%

Stats Details: Flurry Icicle

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.622.620.000.000.000.00000.0000271,489.81271,489.810.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.04%1.810873,352.1840,524148,60862,742.740144,032132,543132,5430.00%
crit30.96%0.8106171,438.6294,591352,45696,646.290337,407138,947138,9470.00%

Action Details: Flurry Icicle

  • id:148022
  • school:frost
  • range:100.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.001000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.10

Spelldata

  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=false}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched. Increases the damage of Frozen Orb, Blizzard,{$?a443739=false}[ Frost Splinters,][] and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.}
    Glacial Assault 6,8470.7%35.58.23s57,7990Direct35.529,57362,68357,79785.2%

Stats Details: Glacial Assault

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage35.5035.500.000.000.000.00000.00002,051,671.372,051,671.370.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit14.75%5.2401729,572.6822,88649,08829,390.63048,300154,887154,8870.00%
crit85.25%30.26125262,683.3448,060104,47962,675.3856,50671,1881,896,7841,896,7840.00%

Action Details: Glacial Assault

  • id:379029
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.333270
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:379029
  • name:Glacial Assault
  • school:frost
  • tooltip:
  • description:{$@spelldesc378947=Your Comet Storm now increases the damage enemies take from you by {$417490s1=6}% for {$417490d=6 seconds} and Flurry has a {$s1=25}% chance each hit to call down an icy comet, crashing into your target and nearby enemies for {$379029s1=0} Frost damage.}
Frostfire Bolt 66,978 (67,756)7.3% (7.4%)44.36.47s458,597401,593Direct45.2 (47.5)174,230440,396333,91760.0% (58.6%)
Periodic373.5 (47.5)7,72417,31813,28958.0% (58.0%)79.5%

Stats Details: Frostfire Bolt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage44.2645.23373.53373.5331.501.14190.638320,066,128.4720,066,128.470.00%70,250.12401,593.26
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit40.00%18.09342174,229.57107,600431,281175,063.50131,378252,2143,152,0553,152,0550.00%
crit60.00%27.131347440,395.84249,1331,004,350440,619.84357,755539,41111,950,27111,950,2710.00%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit42.00%156.88922287,724.31544,1637,721.685,93311,5551,211,7411,211,7410.00%
crit58.00%216.6613630317,318.1112110,80717,343.1513,37023,2623,752,0623,752,0620.00%

Action Details: Frostfire Bolt

  • id:431044
  • school:frostfire
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:50000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.265000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26
  • base_multiplier:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.057500
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:431044
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:
  • description:Launches a bolt of frostfire at the enemy, causing {$468655s1=0} Frostfire damage, slowing movement speed by {$468655s3=50}%, and causing an additional {$468655=}o2 Frostfire damage over {$d=0 milliseconds}. Frostfire Bolt generates stacks for both Fire Mastery and Frost Mastery.

Action Priority List

    st_aoebuild
    [W]:44.40
    (frostbolt_) Icicle 7780.1%2.348.50s101,3790Direct2.372,357167,892101,47130.5%

Stats Details: Frostbolt Icicle

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.302.300.000.000.000.00000.0000233,206.11233,206.110.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.50%1.6001172,356.9740,303147,50653,391.430146,919115,549115,5490.00%
crit30.50%0.7008167,892.4094,462339,24277,314.870332,198117,657117,6570.00%

Action Details: Frostbolt Icicle

  • id:148022
  • school:frost
  • range:100.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.001000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.10

Spelldata

  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=false}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched. Increases the damage of Frozen Orb, Blizzard,{$?a443739=false}[ Frost Splinters,][] and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.}
Frostfire Burst 15,2571.7%22.513.21s203,0840Direct22.5110,629238,649203,07272.2%

Stats Details: Frostfire Burst

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.5422.540.000.000.000.00000.00004,576,825.874,576,825.870.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit27.78%6.26015110,628.9586,853185,194110,422.750170,257692,707692,7070.00%
crit72.22%16.28627238,649.11180,503388,542238,710.85214,552268,8973,884,1193,884,1190.00%

Action Details: Frostfire Burst

  • id:470596
  • school:frostfire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:470596
  • name:Frostfire Burst
  • school:frostfire
  • tooltip:
  • description:{$@spelldesc438595=Reaching maximum stacks of Fire Mastery causes your next {$?=}c2[Fire Blast]?c3[Ice Lance][] to explode in a Frostfire Burst, dealing {$470596s1=0} Frostfire damage to nearby enemies. Damage reduced beyond 8 targets. Frostfire Burst, {$?=}c2[reduces the cooldown of Phoenix Flames by {$s2=10} sec]?c3[grants Brain Freeze][].}
Frostfire Infusion 47,0675.2%211.01.41s66,8720Direct210.840,12585,26666,94559.4%

Stats Details: Frostfire Infusion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage211.02210.790.000.000.000.00000.000014,111,504.4914,111,504.490.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit40.59%85.564812540,125.0730,19866,67040,131.8437,65942,9843,433,0673,433,0670.00%
crit59.41%125.237718485,266.1163,543141,07485,280.7180,88190,41710,678,43810,678,4380.00%

Action Details: Frostfire Infusion

  • id:431171
  • school:frostfire
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:431171
  • name:Frostfire Infusion
  • school:frostfire
  • tooltip:
  • description:{$@spelldesc431166=Your Frost and Fire spells have a chance to trigger an additional bolt of Frostfire, dealing {$431171s1=0} damage. This effect generates Frostfire Mastery when activated.}
Frozen Orb 0 (17,483)0.0% (1.9%)6.052.94s879,776879,834

Stats Details: Frozen Orb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.960.000.000.000.001.00000.00000.000.000.00%879,834.39879,834.39

Action Details: Frozen Orb

  • id:84714
  • school:frost
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:25000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches an orb of swirling ice up to {$s1=40} yds forward which deals up to {$=}{20*{$84721s1=0}} Frost damage to all enemies it passes through over {$d=15 seconds}. Deals reduced damage beyond {$84721s2=8} targets. Grants 1 charge of Fingers of Frost when it first damages an enemy.{$?a382103=false}[ While Frozen Orb is active, you gain Fingers of Frost every {$382106t1=3} sec.][] Enemies damaged by the Frozen Orb are slowed by {$289308s1=30}% for {$289308d=3 seconds}.

Action Priority List

    st_aoebuild
    [R]:5.96
  • if_expr:cooldown_react&(talent.splinterstorm|(!talent.ray_of_frost|buff.fingers_of_frost.down&cooldown.ray_of_frost.remains&buff.icicles.react<5))
    Frozen Orb (_bolt) 17,4831.9%140.51.95s37,3240Direct140.522,70748,74137,32356.1%

Stats Details: Frozen Orb Bolt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage140.47140.470.000.000.000.00000.00005,242,933.165,242,933.160.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit43.86%61.61329422,707.1715,67337,61722,718.9720,08026,0141,398,9621,398,9620.00%
crit56.14%78.863911948,740.9032,86979,32748,760.7343,40555,6873,843,9713,843,9710.00%

Action Details: Frozen Orb Bolt

  • id:84721
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:9.5
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.132000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.30

Spelldata

  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=0}%.
  • description:{$@spelldesc84714=Launches an orb of swirling ice up to {$s1=40} yds forward which deals up to {$=}{20*{$84721s1=0}} Frost damage to all enemies it passes through over {$d=15 seconds}. Deals reduced damage beyond {$84721s2=8} targets. Grants 1 charge of Fingers of Frost when it first damages an enemy.{$?a382103=false}[ While Frozen Orb is active, you gain Fingers of Frost every {$382106t1=3} sec.][] Enemies damaged by the Frozen Orb are slowed by {$289308s1=30}% for {$289308d=3 seconds}.}
Glacial Spike 294,78232.3%33.38.88s2,657,7251,458,308Direct33.21,223,8512,863,2502,659,90087.6%

Stats Details: Glacial Spike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage33.2533.230.000.000.001.82250.000088,382,186.0088,382,186.000.00%1,458,307.531,458,307.53
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit12.40%4.120121,223,851.19822,2762,126,1971,205,110.3002,111,9835,044,6535,044,6530.00%
crit87.60%29.1117412,863,249.561,865,8725,005,1812,863,654.252,656,1773,107,84083,337,53383,337,5330.00%

Action Details: Glacial Spike

  • id:199786
  • school:frost
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:25000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.540000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.10

Spelldata

  • id:199786
  • name:Glacial Spike
  • school:frost
  • tooltip:Frozen in place.
  • description:Conjures a massive spike of ice, and merges your current Icicles into it. It impales your target, dealing {$228600s1=0} damage plus all of the damage stored in your Icicles, and freezes the target in place for {$228600d=4 seconds}. Damage may interrupt the freeze effect. Requires 5 Icicles to cast. |cFFFFFFFFPassive:|r Ice Lance no longer launches Icicles.

Action Priority List

    st_aoebuild
    [T]:33.46
  • if_expr:buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill)
Ice Lance 185,188 (193,898)20.3% (21.2%)85.93.43s677,201677,365Direct85.8 (140.8)328,144702,491647,22585.2% (72.5%)

Stats Details: Ice Lance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage85.8685.800.000.000.000.99980.000055,533,603.5655,533,603.560.00%677,365.30677,365.30
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit14.77%12.67329328,144.0569,649666,697328,012.42233,978442,4134,157,0594,157,0590.00%
crit85.23%73.1348102702,490.92150,0991,403,824702,723.30653,347762,74051,376,54551,376,5450.00%

Action Details: Ice Lance

  • id:30455
  • school:frost
  • range:40.0
  • travel_speed:47.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:25000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.605000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.24

Spelldata

  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Quickly fling a shard of ice at the target, dealing {$228598s1=0} Frost damage{$?s56377=false}[, and {$=}{{$228598s1=0}*{$56377m2=90}/100} Frost damage to a second nearby target][]. Ice Lance damage is tripled against frozen targets.

Action Priority List

    st_aoebuild
    [V]:85.86
  • if_expr:buff.fingers_of_frost.react&!prev_gcd.1.glacial_spike|remaining_winters_chill
    (ice_lance_) Icicle 1,3770.2%4.141.21s100,2660Direct4.172,064167,703100,42129.7%

Stats Details: Ice Lance Icicle

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.114.110.000.000.000.00000.0000412,555.07412,555.070.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.35%2.8901772,064.1540,303148,95666,170.260143,381208,291208,2910.00%
crit29.65%1.2208167,702.5194,016340,020113,821.120333,838204,264204,2640.00%

Action Details: Ice Lance Icicle

  • id:148022
  • school:frost
  • range:100.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.001000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.10

Spelldata

  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=false}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched. Increases the damage of Frozen Orb, Blizzard,{$?a443739=false}[ Frost Splinters,][] and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.}
    Frigid Pulse 7,3340.8%50.95.75s43,2150Direct50.926,74656,93643,21454.5%

Stats Details: Frigid Pulse

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage50.9050.900.000.000.000.00000.00002,199,556.212,199,556.210.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit45.45%23.1384226,745.7920,39844,44726,743.0523,89130,823618,732618,7320.00%
crit54.55%27.76124756,935.7143,32193,33856,941.3151,77963,2791,580,8241,580,8240.00%

Action Details: Frigid Pulse

  • id:460623
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:460623
  • name:Frigid Pulse
  • school:frost
  • tooltip:
  • description:{$@spelldesc453720=Damage dealt by Fingers of Frost enhanced Ice Lances invoke a Frigid Pulse, dealing {$460623s1=0} Frost damage to nearby targets. Damage reduced beyond {$s1=8} targets.}
(isothermic_) Meteor 0 (32,108)0.0% (3.5%)14.022.06s687,9700

Stats Details: Isothermic Meteor

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.990.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Isothermic Meteor

  • id:153561
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:153561
  • name:Meteor
  • school:fire
  • tooltip:
  • description:Calls down a meteor which lands at the target location after {$177345d=3 seconds}, dealing {$351140s1=0} Fire damage{$?a416719=false}[, split evenly between all targets within 8 yds][ to all enemies hit reduced beyond 8 targets], and burns the ground, dealing {$=}{8*{$155158s1=0}} Fire damage over {$175396d=8.500 seconds} to all enemies in the area.
    (isothermic_) Meteor Burn 4,5210.5%109.72.67s12,3610Periodic109.77,66616,17512,36055.2%0.0%

Stats Details: Isothermic Meteor Burn

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage109.670.00109.67109.670.000.00000.00101,355,635.381,355,635.380.00%12,437,021.790.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit44.83%49.1724797,665.805,73812,7477,667.947,0858,368376,912376,9120.00%
crit55.17%60.51349516,175.3012,09926,76916,179.4215,03017,718978,723978,7230.00%

Action Details: Isothermic Meteor Burn

  • id:155158
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.085387
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:0.00
  • base_tick_time:0.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:155158
  • name:Meteor Burn
  • school:fire
  • tooltip:Burning for {$=}w1 Fire damage every {$t1=1} sec.
  • description:{$@spelldesc153561=Calls down a meteor which lands at the target location after {$177345d=3 seconds}, dealing {$351140s1=0} Fire damage{$?a416719=false}[, split evenly between all targets within 8 yds][ to all enemies hit reduced beyond 8 targets], and burns the ground, dealing {$=}{8*{$155158s1=0}} Fire damage over {$175396d=8.500 seconds} to all enemies in the area.}
    (isothermic_) Meteor 27,5873.0%13.922.08s594,7230Direct13.9305,292646,776594,73584.8%

Stats Details: Isothermic Meteor Impact

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.9113.910.000.000.000.00000.00008,271,753.808,271,753.800.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit15.25%2.1209305,292.27248,113499,531272,411.230496,554647,358647,3580.00%
crit84.75%11.79417646,775.99518,6531,066,164646,954.97584,661755,6557,624,3967,624,3960.00%

Action Details: Isothermic Meteor Impact

  • id:438607
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.404000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:438607
  • name:Meteor
  • school:fire
  • tooltip:
  • description:{$@spelldesc153561=Calls down a meteor which lands at the target location after {$177345d=3 seconds}, dealing {$351140s1=0} Fire damage{$?a416719=false}[, split evenly between all targets within 8 yds][ to all enemies hit reduced beyond 8 targets], and burns the ground, dealing {$=}{8*{$155158s1=0}} Fire damage over {$175396d=8.500 seconds} to all enemies in the area.}
Ray of Frost 70,9027.8%6.252.32s3,461,784975,133Periodic30.6371,388773,921696,25980.7%6.8%

Stats Details: Ray Of Frost

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.150.0030.5830.580.003.55010.663621,291,062.1021,291,062.100.00%975,133.37975,133.37
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit19.29%5.90017371,387.95232,620702,213369,881.100564,1152,190,8492,190,8490.00%
crit80.71%24.681235773,921.11475,2311,527,456772,906.24690,467894,50619,100,21419,100,2140.00%

Action Details: Ray Of Frost

  • id:205021
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:50000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.691000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:205021
  • name:Ray of Frost
  • school:frost
  • tooltip:Movement slowed by {$=}w1%. Taking {$=}w2 Frost damage every {$t2=1} sec.
  • description:Channel an icy beam at the enemy for {$d=5 seconds}, dealing {$s2=0} Frost damage every {$t2=1} sec and slowing movement by {$s4=60}%. Each time Ray of Frost deals damage, its damage and snare increases by {$208141s1=10}%. Generates {$s3=2} charges of Fingers of Frost over its duration.

Action Priority List

    st_aoebuild
    [U]:6.15
  • if_expr:remaining_winters_chill&talent.frostfire_bolt|remaining_winters_chill=1
Shifting Power 6,2180.7%4.767.84s394,904137,605Periodic18.853,674115,33599,29674.0%4.1%

Stats Details: Shifting Power

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.720.0018.7618.760.002.86990.65831,863,303.581,863,303.580.00%137,604.58137,604.58
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit26.00%4.8801653,673.9742,74490,28452,859.53088,741261,843261,8430.00%
crit74.00%13.89324115,335.0189,762191,045115,346.3598,799160,7051,601,4611,601,4610.00%

Action Details: Shifting Power

  • id:382440
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:125000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:382440
  • name:Shifting Power
  • school:arcane
  • tooltip:Every {$t1=1} sec, deal {$382445s1=0 + 61.0%} Arcane damage to enemies within {$382445=}A1 yds and reduce the remaining cooldown of your abilities by {$=}{-{$s2=3000}/1000} sec.
  • description:Draw power from within, dealing {$=}{{$382445s1=0 + 61.0%}*{$d=4 seconds}/$t} Arcane damage over {$d=4 seconds} to enemies within {$382445=}A1 yds. While channeling, your Mage ability cooldowns are reduced by {$=}{-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:382445
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.609960
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:382445
  • name:Shifting Power
  • school:arcane
  • tooltip:
  • description:{$@spelldesc382440=Draw power from within, dealing {$=}{{$382445s1=0 + 61.0%}*{$d=4 seconds}/$t} Arcane damage over {$d=4 seconds} to enemies within {$382445=}A1 yds. While channeling, your Mage ability cooldowns are reduced by {$=}{-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    st_aoebuild
    [S]:4.72
  • if_expr:(cooldown.icy_veins.remains>10&cooldown.flurry.remains&(fight_remains+10>cooldown.icy_veins.remains)|talent.frostfire_bolt)&(talent.splinterstorm|(buff.icy_veins.down|!talent.deaths_chill)&cooldown.frozen_orb.remains>10&(!talent.comet_storm|cooldown.comet_storm.remains>10)&(!talent.ray_of_frost|cooldown.ray_of_frost.remains>10)&buff.icicles.react<5)
pet - water_elemental 42343 / 22215
Water Jet 12,6780.7%9.532.34s210,77373,409Periodic45.335,75271,80644,10923.2%7.2%

Stats Details: Water Jet

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.470.0045.2745.270.002.87130.47521,996,788.011,996,788.010.00%73,408.6373,408.63
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit76.82%34.77136035,752.2128,72054,68935,767.4333,13638,5961,243,2421,243,2420.00%
crit23.18%10.4912571,806.4657,727109,37871,885.0963,55988,652753,546753,5460.00%

Action Details: Water Jet

  • id:135029
  • school:frost
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.566000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking {$=}w1 damage every {$t1=1} sec.
  • description:Channels a jet of icy water at the target, {$?s198146=false}[slowing the target by {$m2=0}% and ][]dealing {$=}o1 Frost damage to the target over {$d=4 seconds}. Water Jet automatically activates Brain Freeze.

Action Priority List

    default
    [ ]:9.71
Waterbolt 29,6651.7%85.93.28s54,14237,518Direct85.843,89188,05454,22023.4%

Stats Details: Waterbolt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage85.9385.810.000.000.001.44310.00004,652,333.624,652,333.620.00%37,518.2137,518.21
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit76.62%65.74429743,891.3234,87466,82443,888.9941,19146,3402,885,4752,885,4750.00%
crit23.38%20.0754088,054.4971,721133,50888,087.8979,024103,0811,766,8591,766,8590.00%

Action Details: Waterbolt

  • id:31707
  • school:frost
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.687000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals $sw1 Frost damage to the target.

Action Priority List

    default
    [ ]:89.82
Simple Action Stats Execute Interval
Swissly
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Swissly
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Swissly
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Midnight Masquerade 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457285
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Swissly
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Frostfire Empowerment 12.921.97s

Stats Details: Frostfire Empowerment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage12.940.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Frostfire Empowerment

  • id:431186
  • school:frostfire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:541437.55
  • base_dd_max:541437.55
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:431186
  • name:Frostfire Empowerment
  • school:frostfire
  • tooltip:
  • description:{$@spelldesc431176=Your Frost and Fire spells have a chance to activate Frostfire Empowerment, causing your next Frostfire Bolt to be instant cast, deal {$431177s3=60}% increased damage, explode for {$s2=80}% of its damage to nearby enemies, and grant you maximum benefit of Frostfire Mastery and refresh its duration.}
Icy Veins 3.4101.83s

Stats Details: Icy Veins

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.430.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Icy Veins

  • id:12472
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:Haste increased by {$=}w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=25 seconds}, granting {$m1=20}% haste and preventing damage from delaying your spellcasts. Activating Icy Veins summons a water elemental to your side for its duration. The water elemental's abilities grant you Frigid Empowerment, increasing the Frost damage you deal by {$417488s1=3}%, up to {$=}{{$417488s1=3}*{$417488u=5}}%.

Action Priority List

    cds
    [M]:3.43
  • if_expr:buff.icy_veins.remains<gcd.max*2
Tempered Potion 1.4303.93s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.360.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [K]:1.36
  • if_expr:fight_remains<35|buff.icy_veins.remains>10&(fight_remains>315|cooldown.icy_veins.remains+12>fight_remains)
spymasters_web 2.645.96s

Stats Details: Spymasters Web

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Spymasters Web

  • id:444959
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:444959
  • name:Spymaster's Web
  • school:shadow
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Use your accumulated knowledge to strike when the time is right, granting {$444958s2=515} Intellect per report for {$d=20 seconds} and consuming their passive effect.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance (Haste)7.02.339.7s29.1s10.4s24.28%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_Ascendance_Haste
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:89.00

Trigger Details

  • interval_min/max:16.0s / 304.0s
  • trigger_min/max:8.0s / 296.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.0s
  • uptime_min/max:0.00% / 51.10%

Stack Uptimes

  • Ascendance_Haste_1:0.67%
  • Ascendance_Haste_2:0.69%
  • Ascendance_Haste_3:0.68%
  • Ascendance_Haste_4:0.70%
  • Ascendance_Haste_5:0.67%
  • Ascendance_Haste_6:0.70%
  • Ascendance_Haste_7:0.68%
  • Ascendance_Haste_8:0.68%
  • Ascendance_Haste_9:0.68%
  • Ascendance_Haste_10:18.12%

Spelldata

  • id:458503
  • name:Ascendance
  • tooltip:Haste increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Ascendance (Vers)7.02.339.6s29.0s10.5s24.32%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_Ascendance_Vers
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:89.00

Trigger Details

  • interval_min/max:16.0s / 288.0s
  • trigger_min/max:8.0s / 288.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.0s
  • uptime_min/max:2.27% / 61.23%

Stack Uptimes

  • Ascendance_Vers_1:0.69%
  • Ascendance_Vers_2:0.68%
  • Ascendance_Vers_3:0.67%
  • Ascendance_Vers_4:0.65%
  • Ascendance_Vers_5:0.69%
  • Ascendance_Vers_6:0.66%
  • Ascendance_Vers_7:0.65%
  • Ascendance_Vers_8:0.69%
  • Ascendance_Vers_9:0.67%
  • Ascendance_Vers_10:18.26%

Spelldata

  • id:458524
  • name:Ascendance
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Ascension (Crit)7.02.339.5s29.0s10.5s24.40%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_Ascension_Crit
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:89.00

Trigger Details

  • interval_min/max:16.0s / 240.0s
  • trigger_min/max:8.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.0s
  • uptime_min/max:0.00% / 56.22%

Stack Uptimes

  • Ascension_Crit_1:0.67%
  • Ascension_Crit_2:0.65%
  • Ascension_Crit_3:0.68%
  • Ascension_Crit_4:0.66%
  • Ascension_Crit_5:0.69%
  • Ascension_Crit_6:0.68%
  • Ascension_Crit_7:0.67%
  • Ascension_Crit_8:0.66%
  • Ascension_Crit_9:0.68%
  • Ascension_Crit_10:18.35%

Spelldata

  • id:458502
  • name:Ascension
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Ascension (Mastery)7.02.239.6s29.1s10.4s24.31%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_Ascension_Mastery
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:89.00

Trigger Details

  • interval_min/max:16.0s / 232.0s
  • trigger_min/max:8.0s / 232.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.0s
  • uptime_min/max:0.00% / 55.29%

Stack Uptimes

  • Ascension_Mastery_1:0.67%
  • Ascension_Mastery_2:0.68%
  • Ascension_Mastery_3:0.67%
  • Ascension_Mastery_4:0.68%
  • Ascension_Mastery_5:0.66%
  • Ascension_Mastery_6:0.66%
  • Ascension_Mastery_7:0.70%
  • Ascension_Mastery_8:0.67%
  • Ascension_Mastery_9:0.67%
  • Ascension_Mastery_10:18.25%

Spelldata

  • id:458525
  • name:Ascension
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bone Chilling1.4426.5145.5s0.7s219.7s99.85%0.00%414.2 (414.3)0.4

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_bone_chilling
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.1s / 358.9s
  • trigger_min/max:0.0s / 11.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.8s
  • uptime_min/max:98.44% / 99.94%

Stack Uptimes

  • bone_chilling_1:0.06%
  • bone_chilling_2:0.11%
  • bone_chilling_3:0.20%
  • bone_chilling_4:0.73%
  • bone_chilling_5:0.25%
  • bone_chilling_6:0.24%
  • bone_chilling_7:0.33%
  • bone_chilling_8:0.29%
  • bone_chilling_9:0.27%
  • bone_chilling_10:97.37%

Spelldata

  • id:205766
  • name:Bone Chilling
  • tooltip:Spell damage done increased by {$=}{{$=}W1}.1%.
  • description:{$@spelldesc205027=Whenever you attempt to chill a target, you gain Bone Chilling, increasing spell damage you deal by {$=}{{$m1=5}/10}.1% for {$205766d=8 seconds}, stacking up to {$205766u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Brain Freeze38.29.87.9s6.3s3.3s41.30%79.33%9.8 (9.8)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_brain_freeze
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • brain_freeze_1:41.30%

Spelldata

  • id:190446
  • name:Brain Freeze
  • tooltip:Your next Flurry deals {$s2=50}% increased damage.
  • description:{$@spelldesc190447=Frostbolt has a {$m1=25}% chance to reset the remaining cooldown on Flurry and cause your next Flurry to deal {$190446s2=50}% increased damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Chain Reaction3.582.086.0s3.4s83.4s96.34%0.00%68.9 (68.9)2.5

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_chain_reaction
  • max_stacks:5
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 352.3s
  • trigger_min/max:0.8s / 31.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 352.8s
  • uptime_min/max:88.94% / 98.71%

Stack Uptimes

  • chain_reaction_1:1.63%
  • chain_reaction_2:5.11%
  • chain_reaction_3:3.46%
  • chain_reaction_4:3.31%
  • chain_reaction_5:82.83%

Spelldata

  • id:278310
  • name:Chain Reaction
  • tooltip:Ice Lance damage increased by {$278309s1=2}%.
  • description:{$@spelldesc278309=Your Ice Lances against frozen targets increase the damage of your Ice Lances by {$s1=2}% for {$278310d=10 seconds}, stacking up to {$278310u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Cold Front3.686.493.6s3.3s79.5s96.67%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_cold_front
  • max_stacks:30
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:48.5s / 133.5s
  • trigger_min/max:0.0s / 26.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 127.6s
  • uptime_min/max:89.79% / 99.91%

Stack Uptimes

  • cold_front_1:3.38%
  • cold_front_2:4.83%
  • cold_front_3:4.43%
  • cold_front_4:4.64%
  • cold_front_5:3.43%
  • cold_front_6:4.24%
  • cold_front_7:3.05%
  • cold_front_8:3.81%
  • cold_front_9:3.02%
  • cold_front_10:3.07%
  • cold_front_11:3.17%
  • cold_front_12:2.78%
  • cold_front_13:2.94%
  • cold_front_14:2.89%
  • cold_front_15:2.65%
  • cold_front_16:2.84%
  • cold_front_17:2.78%
  • cold_front_18:2.88%
  • cold_front_19:3.09%
  • cold_front_20:3.24%
  • cold_front_21:3.71%
  • cold_front_22:3.90%
  • cold_front_23:4.04%
  • cold_front_24:3.87%
  • cold_front_25:3.71%
  • cold_front_26:3.58%
  • cold_front_27:3.45%
  • cold_front_28:3.24%

Spelldata

  • id:382113
  • name:Cold Front
  • tooltip:Building up a Frozen Orb.
  • description:{$@spelldesc382110=Casting {$s1=30} Frostbolts or Flurries calls down a Frozen Orb toward your target. Hitting an enemy player counts as double.}
  • max_stacks:30
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Cold Front (_ready)2.70.098.3s98.3s0.7s0.60%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_cold_front_ready
  • max_stacks:15
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:63.2s / 128.9s
  • trigger_min/max:63.2s / 128.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.2s
  • uptime_min/max:0.02% / 3.84%

Stack Uptimes

  • cold_front_ready_1:0.60%

Spelldata

  • id:382114
  • name:Cold Front
  • tooltip:Your next Frostbolt or Flurry will also cast a Frozen Orb at your target.
  • description:{$@spelldesc382110=Casting {$s1=30} Frostbolts or Flurries calls down a Frozen Orb toward your target. Hitting an enemy player counts as double.}
  • max_stacks:15
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Excess Fire22.81.113.2s12.6s3.7s26.70%0.00%1.1 (1.1)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_excess_fire
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 39.8s
  • trigger_min/max:0.0s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 31.2s
  • uptime_min/max:13.34% / 40.75%

Stack Uptimes

  • excess_fire_1:26.70%

Spelldata

  • id:438624
  • name:Excess Fire
  • tooltip:Your next {$?=}c2[Fire Blast]?c3[Ice Lance][] generates a Frostfire Burst.
  • description:{$@spelldesc438595=Reaching maximum stacks of Fire Mastery causes your next {$?=}c2[Fire Blast]?c3[Ice Lance][] to explode in a Frostfire Burst, dealing {$470596s1=0} Frostfire damage to nearby enemies. Damage reduced beyond 8 targets. Frostfire Burst, {$?=}c2[reduces the cooldown of Phoenix Flames by {$s2=10} sec]?c3[grants Brain Freeze][].}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Excess Frost23.81.212.7s12.1s2.1s16.32%0.00%1.2 (1.2)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_excess_frost
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 35.0s
  • trigger_min/max:0.0s / 27.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.3s
  • uptime_min/max:6.72% / 30.15%

Stack Uptimes

  • excess_frost_1:16.32%

Spelldata

  • id:438611
  • name:Excess Frost
  • tooltip:Your next {$?=}c2[Phoenix Flames]?c3[Flurry][] also casts Ice Nova at {$s1=125}% effectiveness.
  • description:{$@spelldesc438600=Reaching maximum stacks of Frost Mastery causes your next {$?=}c2[Phoenix Flames]?c3[Flurry][] to also cast Ice Nova at {$s1=125}% effectiveness. When you consume Excess Frost, the cooldown of {$?=}c2[Meteor]?c3[Comet Storm][] is reduced by {$s2=5} sec.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Fingers of Frost34.324.18.7s5.1s2.9s33.59%59.32%7.1 (7.1)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 57.8s
  • trigger_min/max:0.0s / 56.3s
  • trigger_pct:13.13%
  • duration_min/max:0.0s / 23.6s
  • uptime_min/max:19.45% / 52.21%

Stack Uptimes

  • fingers_of_frost_1:25.18%
  • fingers_of_frost_2:8.41%

Spelldata

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance deals damage as if the target were frozen.
  • description:{$@spelldesc112965=Frostbolt has a {$s1=15}% chance and Frozen Orb damage has a {$s2=10}% to grant a charge of Fingers of Frost. Fingers of Frost causes your next Ice Lance to deal damage as if the target were frozen. Maximum {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Fire Mastery26.7256.611.4s1.1s10.7s95.05%0.00%198.4 (198.4)13.3

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_fire_mastery
  • max_stacks:6
  • base duration:14.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:0.0s / 23.3s
  • trigger_min/max:0.0s / 10.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s
  • uptime_min/max:89.23% / 98.60%

Stack Uptimes

  • fire_mastery_1:4.85%
  • fire_mastery_2:4.97%
  • fire_mastery_3:4.64%
  • fire_mastery_4:4.43%
  • fire_mastery_5:4.19%
  • fire_mastery_6:71.97%

Spelldata

  • id:431040
  • name:Fire Mastery
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc431038=Your damaging Fire spells generate {$s1=1} stack of Fire Mastery and Frost spells generate {$s1=1} stack of Frost Mastery. Fire Mastery increases your haste by {$431040s1=1}%, and Frost Mastery increases your Mastery by {$431039s1=2}% for {$431039d=14 seconds}, stacking up to {$431039u=6} times each. Adding stacks does not refresh duration.}
  • max_stacks:6
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6111.5s76.6s35.4s25.28%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 344.8s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 87.86%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.28%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6113.0s77.3s35.3s24.60%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 339.0s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 192.1s
  • uptime_min/max:0.00% / 78.81%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.60%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.8s76.8s35.2s24.95%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 341.9s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 81.63%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.95%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.9s76.6s35.4s25.17%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 347.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 78.06%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.17%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Freezing Rain6.00.053.0s53.0s11.8s23.43%0.00%0.0 (0.0)5.8

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_freezing_rain
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:48.0s / 81.9s
  • trigger_min/max:48.0s / 81.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:19.20% / 26.33%

Stack Uptimes

  • freezing_rain_1:23.43%

Spelldata

  • id:270232
  • name:Freezing Rain
  • tooltip:Blizzard is instant cast and deals {$s2=60}% increased damage.
  • description:{$@spelldesc270233=Frozen Orb makes Blizzard instant cast and increases its damage done by {$270232s2=60}% for {$270232d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Frigid Empowerment5.1134.363.5s2.1s30.2s51.03%0.00%114.1 (114.1)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_frigid_empowerment
  • max_stacks:5
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.8s / 122.2s
  • trigger_min/max:0.0s / 75.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.5s
  • uptime_min/max:38.85% / 66.81%

Stack Uptimes

  • frigid_empowerment_1:0.32%
  • frigid_empowerment_2:1.17%
  • frigid_empowerment_3:1.14%
  • frigid_empowerment_4:1.11%
  • frigid_empowerment_5:47.29%

Spelldata

  • id:417488
  • name:Frigid Empowerment
  • tooltip:Your elemental is empowering you increasing your Frost damage dealt by {$s1=3}%.
  • description:{$@spelldesc417487=Your water elemental's abilities apply Frigid Empowerment increasing the Frost damage you deal by {$417488s1=3}%, up to {$=}{{$417488s1=3}*{$417488u=5}}%.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Frost Mastery27.1458.711.2s0.6s10.7s96.47%0.00%395.4 (395.4)13.7

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_frost_mastery
  • max_stacks:6
  • base duration:14.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:2.00%

Trigger Details

  • interval_min/max:0.0s / 21.5s
  • trigger_min/max:0.0s / 8.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s
  • uptime_min/max:91.68% / 99.21%

Stack Uptimes

  • frost_mastery_1:2.22%
  • frost_mastery_2:2.86%
  • frost_mastery_3:3.40%
  • frost_mastery_4:2.97%
  • frost_mastery_5:2.79%
  • frost_mastery_6:82.23%

Spelldata

  • id:431039
  • name:Frost Mastery
  • tooltip:Mastery increased by {$=}w1%.
  • description:{$@spelldesc431038=Your damaging Fire spells generate {$s1=1} stack of Fire Mastery and Frost spells generate {$s1=1} stack of Frost Mastery. Fire Mastery increases your haste by {$431040s1=1}%, and Frost Mastery increases your Mastery by {$431039s1=2}% for {$431039d=14 seconds}, stacking up to {$431039u=6} times each. Adding stacks does not refresh duration.}
  • max_stacks:6
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
Frostfire Empowerment10.92.928.1s21.8s7.2s25.92%0.00%0.4 (0.4)0.2

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_frostfire_empowerment
  • max_stacks:2
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:-100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.00
  • modifier:1.00

Trigger Details

  • interval_min/max:0.1s / 144.1s
  • trigger_min/max:0.0s / 110.0s
  • trigger_pct:1.41%
  • duration_min/max:0.0s / 72.2s
  • uptime_min/max:6.88% / 53.89%

Stack Uptimes

  • frostfire_empowerment_1:21.73%
  • frostfire_empowerment_2:4.18%

Spelldata

  • id:431177
  • name:Frostfire Empowerment
  • tooltip:Your next Frostfire Bolt always critically strikes, deals {$s3=60}% additional damage, explodes for {$431176s2=80}% of its damage to nearby enemies, and is instant cast.
  • description:{$@spelldesc431176=Your Frost and Fire spells have a chance to activate Frostfire Empowerment, causing your next Frostfire Bolt to be instant cast, deal {$431177s3=60}% increased damage, explode for {$s2=80}% of its damage to nearby enemies, and grant you maximum benefit of Frostfire Mastery and refresh its duration.}
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:431176
  • name:Frostfire Empowerment
  • tooltip:
  • description:Your Frost and Fire spells have a chance to activate Frostfire Empowerment, causing your next Frostfire Bolt to be instant cast, deal {$431177s3=60}% increased damage, explode for {$s2=80}% of its damage to nearby enemies, and grant you maximum benefit of Frostfire Mastery and refresh its duration.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icicles34.2144.38.9s1.7s8.4s96.10%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_icicles
  • max_stacks:5
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 29.0s
  • trigger_min/max:0.0s / 12.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.0s
  • uptime_min/max:88.29% / 99.96%

Stack Uptimes

  • icicles_1:19.02%
  • icicles_2:14.16%
  • icicles_3:16.78%
  • icicles_4:11.94%
  • icicles_5:34.20%

Spelldata

  • id:205473
  • name:Icicles
  • tooltip:{$=}w1 |4Icicle:Icicles; stored.
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=false}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched. Increases the damage of Frozen Orb, Blizzard,{$?a443739=false}[ Frost Splinters,][] and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Veins5.10.363.4s59.1s31.0s52.50%0.00%0.3 (0.3)4.6

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:20.00%

Trigger Details

  • interval_min/max:8.0s / 122.7s
  • trigger_min/max:0.0s / 112.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.0s
  • uptime_min/max:39.61% / 70.37%

Stack Uptimes

  • icy_veins_1:52.50%

Spelldata

  • id:12472
  • name:Icy Veins
  • tooltip:Haste increased by {$=}w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=25 seconds}, granting {$m1=20}% haste and preventing damage from delaying your spellcasts. Activating Icy Veins summons a water elemental to your side for its duration. The water elemental's abilities grant you Frigid Empowerment, increasing the Frost damage you deal by {$417488s1=3}%, up to {$=}{{$417488s1=3}*{$417488u=5}}%.
  • max_stacks:0
  • duration:25.00
  • cooldown:120.00
  • default_chance:0.00%
Incanter's Flow1.00.00.0s0.0s300.0s100.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_incanters_flow
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • incanters_flow_1:20.00%
  • incanters_flow_2:20.00%
  • incanters_flow_3:20.00%
  • incanters_flow_4:20.00%
  • incanters_flow_5:20.00%

Spelldata

  • id:116267
  • name:Incanter's Flow
  • tooltip:Increases spell damage by {$=}w1%.
  • description:{$@spelldesc1463=Magical energy flows through you while in combat, building up to {$=}{{$116267m1=2}*5}% increased damage and then diminishing down to {$116267s1=2}% increased damage, cycling every 10 sec.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Keen Prowess5.71.648.1s36.5s13.8s26.30%0.00%1.6 (1.6)5.4

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_keen_prowess
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:3325.00

Trigger Details

  • interval_min/max:15.6s / 157.4s
  • trigger_min/max:5.2s / 141.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.4s
  • uptime_min/max:7.60% / 56.66%

Stack Uptimes

  • keen_prowess_1:26.30%

Spelldata

  • id:449091
  • name:Keen Prowess
  • tooltip:Your mind is sharpened, granting {$=}w1 Critical Strike rating.
  • description:{$@spelldesc445379=|cnNORMAL_FONT_COLOR:Earthen Enhancements - Wondrous Weapons|R Permanently enchants a weapon to sometimes grant you Keen Prowess, bestowing {$=}ec1s1 Critical Strike to you for {$449091d=12 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Overflowing Energy105.168.12.9s1.7s0.8s29.02%0.00%7.1 (7.1)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_overflowing_energy
  • max_stacks:5
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 25.9s
  • trigger_min/max:0.0s / 24.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.7s
  • uptime_min/max:17.72% / 42.75%

Stack Uptimes

  • overflowing_energy_1:16.98%
  • overflowing_energy_2:6.13%
  • overflowing_energy_3:2.52%
  • overflowing_energy_4:1.21%
  • overflowing_energy_5:2.18%

Spelldata

  • id:394195
  • name:Overflowing Energy
  • tooltip:Spell critical strike chance increased by {$=}w1%.
  • description:{$@spelldesc390218=Your spell critical strike damage is increased by {$s1=10}%. When your direct damage spells fail to critically strike a target, your spell critical strike chance is increased by {$394195s1=2}%, up to {$=}{{$394195u=5}*{$394195s1=2}}% for {$394195d=8 seconds}. When your spells critically strike Overflowing Energy is reset.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Permafrost Lances7.80.939.1s35.0s15.7s40.68%0.00%0.9 (0.9)7.4

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_permafrost_lances
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 85.6s
  • trigger_min/max:0.5s / 74.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:30.13% / 46.21%

Stack Uptimes

  • permafrost_lances_1:40.68%

Spelldata

  • id:455122
  • name:Permafrost Lances
  • tooltip:The damage of Ice Lance is increased by {$s1=15}%.
  • description:{$@spelldesc453720=Damage dealt by Fingers of Frost enhanced Ice Lances invoke a Frigid Pulse, dealing {$460623s1=0} Frost damage to nearby targets. Damage reduced beyond {$s1=8} targets.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ray of Frost6.124.452.4s9.2s2.6s5.41%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_ray_of_frost
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.6s / 77.2s
  • trigger_min/max:0.4s / 74.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.4s
  • uptime_min/max:4.09% / 6.68%

Stack Uptimes

  • ray_of_frost_1:1.36%
  • ray_of_frost_2:1.35%
  • ray_of_frost_3:1.35%
  • ray_of_frost_4:1.35%

Spelldata

  • id:208141
  • name:Ray of Frost
  • tooltip:Ray of Frost's damage increased by {$s1=10}%. Ray of Frost's snare increased by {$s2=10}%.
  • description:{$@spelldesc205021=Channel an icy beam at the enemy for {$d=5 seconds}, dealing {$s2=0} Frost damage every {$t2=1} sec and slowing movement by {$s4=60}%. Each time Ray of Frost deals damage, its damage and snare increases by {$208141s1=10}%. Generates {$s3=2} charges of Fingers of Frost over its duration.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Spymaster's Report3.145.9133.2s6.2s93.2s97.71%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_spymasters_report
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:73.79

Trigger Details

  • interval_min/max:13.3s / 245.5s
  • trigger_min/max:6.0s / 9.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 239.6s
  • uptime_min/max:94.96% / 100.00%

Stack Uptimes

  • spymasters_report_1:6.24%
  • spymasters_report_2:6.04%
  • spymasters_report_3:5.38%
  • spymasters_report_4:3.78%
  • spymasters_report_5:3.56%
  • spymasters_report_6:3.43%
  • spymasters_report_7:3.32%
  • spymasters_report_8:3.22%
  • spymasters_report_9:3.12%
  • spymasters_report_10:3.00%
  • spymasters_report_11:2.85%
  • spymasters_report_12:2.78%
  • spymasters_report_13:2.70%
  • spymasters_report_14:2.58%
  • spymasters_report_15:2.47%
  • spymasters_report_16:2.36%
  • spymasters_report_17:2.25%
  • spymasters_report_18:2.13%
  • spymasters_report_19:2.06%
  • spymasters_report_20:2.07%
  • spymasters_report_21:2.09%
  • spymasters_report_22:2.09%
  • spymasters_report_23:2.11%
  • spymasters_report_24:2.11%
  • spymasters_report_25:2.11%
  • spymasters_report_26:2.12%
  • spymasters_report_27:2.08%
  • spymasters_report_28:2.07%
  • spymasters_report_29:2.09%
  • spymasters_report_30:2.09%
  • spymasters_report_31:2.08%
  • spymasters_report_32:2.09%
  • spymasters_report_33:2.09%
  • spymasters_report_34:2.08%
  • spymasters_report_35:1.80%
  • spymasters_report_36:1.06%
  • spymasters_report_37:0.19%
  • spymasters_report_38:0.03%
  • spymasters_report_39:0.00%
  • spymasters_report_40:0.00%

Spelldata

  • id:451199
  • name:Spymaster's Report
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc444958=Your damaging spells dispatch a spider to spy on your foes, increasing your Intellect by {$s1=56} per report received. Stacks up to {$451199u=40} times. This effect may only occur every {$=}proccooldown sec. }
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Spymaster's Web2.60.044.9s44.9s15.0s13.27%0.00%0.0 (0.0)1.8

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_spymasters_web
  • max_stacks:40
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:674.21

Trigger Details

  • interval_min/max:20.0s / 122.2s
  • trigger_min/max:20.0s / 122.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:7.80% / 17.20%

Stack Uptimes

  • spymasters_web_2:0.00%
  • spymasters_web_3:0.83%
  • spymasters_web_4:0.78%
  • spymasters_web_5:0.38%
  • spymasters_web_6:0.39%
  • spymasters_web_7:0.35%
  • spymasters_web_8:0.36%
  • spymasters_web_9:0.34%
  • spymasters_web_10:0.35%
  • spymasters_web_11:0.32%
  • spymasters_web_12:0.32%
  • spymasters_web_13:0.34%
  • spymasters_web_14:0.31%
  • spymasters_web_15:0.35%
  • spymasters_web_16:0.45%
  • spymasters_web_17:0.35%
  • spymasters_web_18:0.29%
  • spymasters_web_19:0.02%
  • spymasters_web_34:0.16%
  • spymasters_web_35:1.79%
  • spymasters_web_36:3.16%
  • spymasters_web_37:1.45%
  • spymasters_web_38:0.21%
  • spymasters_web_39:0.04%
  • spymasters_web_40:0.02%

Spelldata

  • id:444959
  • name:Spymaster's Web
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Use your accumulated knowledge to strike when the time is right, granting {$444958s2=515} Intellect per report for {$d=20 seconds} and consuming their passive effect.
  • max_stacks:0
  • duration:20.00
  • cooldown:20.00
  • default_chance:0.00%
Tempered Potion1.40.0303.3s303.3s29.3s13.06%0.00%0.0 (0.0)1.2

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 322.3s
  • trigger_min/max:300.0s / 322.3s
  • trigger_pct:100.00%
  • duration_min/max:13.2s / 30.0s
  • uptime_min/max:9.31% / 18.11%

Stack Uptimes

  • tempered_potion_1:13.06%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Time Warp5.10.054.3s54.3s5.9s10.01%0.00%0.0 (0.0)5.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_time_warp
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:30.00%

Trigger Details

  • interval_min/max:6.0s / 336.0s
  • trigger_min/max:6.0s / 336.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:0.00% / 19.59%

Stack Uptimes

  • time_warp_1:10.01%

Spelldata

  • id:342242
  • name:Time Warp
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc210805=At any moment, you have a chance to gain Arcane Power for {$s1=8} sec, gain Evocation for {$s2=1} sec, or gain Time Warp for {$342242d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Unstable Power Suit Core (_crit)3.90.060.8s59.5s19.3s24.81%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_unstable_power_suit_core_crit
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1250.17

Trigger Details

  • interval_min/max:10.0s / 334.8s
  • trigger_min/max:10.0s / 303.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:0.00% / 76.26%

Stack Uptimes

  • unstable_power_suit_core_crit_1:24.81%

Spelldata

  • id:455454
  • name:Unstable Power Suit Core
  • tooltip:Increases Critical Strike Rating by {$=}w1.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Unstable Power Suit Core (_haste)3.90.060.5s59.0s19.3s25.01%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_unstable_power_suit_core_haste
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1250.17

Trigger Details

  • interval_min/max:10.0s / 318.4s
  • trigger_min/max:10.0s / 318.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:0.00% / 71.21%

Stack Uptimes

  • unstable_power_suit_core_haste_1:25.01%

Spelldata

  • id:455455
  • name:Unstable Power Suit Core
  • tooltip:Increases Haste Rating by {$=}w1.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Unstable Power Suit Core (_mastery)3.90.060.3s59.2s19.4s25.26%0.00%0.0 (0.0)3.7

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_unstable_power_suit_core_mastery
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1250.17

Trigger Details

  • interval_min/max:10.0s / 333.8s
  • trigger_min/max:10.0s / 302.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:0.00% / 76.59%

Stack Uptimes

  • unstable_power_suit_core_mastery_1:25.26%

Spelldata

  • id:455441
  • name:Unstable Power Suit Core
  • tooltip:Increases Mastery Rating by {$=}w1.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Unstable Power Suit Core (_vers)3.90.060.4s59.1s19.3s24.92%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_unstable_power_suit_core_vers
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:1250.17

Trigger Details

  • interval_min/max:10.0s / 335.5s
  • trigger_min/max:10.0s / 313.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:0.00% / 81.30%

Stack Uptimes

  • unstable_power_suit_core_vers_1:24.92%

Spelldata

  • id:455456
  • name:Unstable Power Suit Core
  • tooltip:Increases Versatility Rating by {$=}w1.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Ascendance (_darkmoon)

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_ascendance_darkmoon
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:8.00

Spelldata

  • id:457594
  • name:Ascendance
  • tooltip:
  • description:{$@spelldesc453575=Gain {$@=}spellname453575 every $457594t seconds spent in combat. {$@=}spellname453575 grants {$458573s2=89} of a random secondary stat for {$457596d=15 seconds}, stacking up to {$457594s1=10} times. This is a Nerubian embellishment.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Midnight Masquerade

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Brain Freeze47.931.072.06.3s0.0s39.8s
Brain Freeze from Excess Fire22.514.032.013.3s0.8s48.3s
Brain Freeze from Frostbolt13.63.026.021.1s0.0s193.6s
Brain Freeze from Time Anomaly2.30.08.081.8s2.0s332.0s
Brain Freeze from Water Jet9.56.015.032.4s20.3s92.2s
Fingers of Frost58.430.090.05.2s0.0s56.3s
Fingers of Frost from Flash Freeze8.70.021.033.5s0.0s274.4s
Fingers of Frost from Frostbolt8.50.021.031.8s0.0s326.7s
Fingers of Frost from Frozen Orb Initial Impact8.66.011.035.0s0.5s73.4s
Fingers of Frost from Frozen Orb Tick20.36.043.013.5s0.0s162.7s
Fingers of Frost from Ray of Frost12.210.015.024.1s0.7s76.2s
Fingers of Frost wasted due to Winter's Chill36.016.057.08.1s0.8s96.1s
Flurry cast47.635.063.06.4s1.5s29.0s
Icicles generated178.5139.0222.01.7s0.0s12.7s
Icicles overflowed9.00.033.021.2s0.0s321.0s
Winter's Chill stacks applied284.9210.0374.02.1s0.1s28.5s
Winter's Chill stacks consumed119.787.0157.02.5s0.0s26.9s
Winter's Chill stacks consumed by Frostfire Bolt15.96.028.019.1s3.2s164.3s
Winter's Chill stacks consumed by Glacial Spike33.224.042.08.9s4.7s38.4s
Winter's Chill stacks consumed by Ice Lance70.648.096.04.2s0.8s38.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap31.79%25.25%37.27%1.0s0.0s3.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Frozen Orb4.1860.00030.53725.11512.34655.418
Comet Storm2.4240.00025.59934.2138.42274.585
Shifting Power8.3840.00055.88441.3559.939119.802
Flurry1.3990.00017.15267.06117.806145.983
Icy Veins1.2260.00016.1214.2241.17522.230
Ray of Frost2.2540.00021.50513.9442.49638.369

Shatter

None Winter's Chill Fingers of Frost Other effects
Ability Count Percent Count Percent Utilization Count Percent Count Percent
(frostbolt_) Icicle2.3100.0%
(flurry_) Icicle2.6100.0%
(ice_lance_) Icicle4.1100.0%
Frostfire Bolt29.364.9%15.935.1%33.4%
Glacial Spike0.10.2%33.299.8%69.7%
Ice Lance0.30.3%70.682.3%148.5%14.917.3%
Thermal Void extension43.786.2%91.9%7.013.8%

Icy Veins

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Swissly
Mana RegenMana1,064.687,804,520.71100.00%7,330.407,178,395.1547.91%
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Mana2,575,000.026,015.1326,087.377,178,374.82,603,329.02,474,350.02,625,000.0
Usage Type Count Total Tot% Avg RPE APR
Swissly
Comet StormMana13.99349,850.344.47%25,000.0025,000.2037.70
FlurryMana47.561,188,915.4915.19%25,000.0024,999.3019.79
Frostfire BoltMana45.262,263,179.6928.92%50,000.0051,129.108.97
Frozen OrbMana5.96148,987.331.90%25,000.0025,000.4135.19
Glacial SpikeMana33.25831,340.4210.62%25,000.0024,999.09106.31
Ice LanceMana85.862,146,515.5127.43%25,000.0024,999.6627.09
Ray of FrostMana6.15307,497.763.93%50,000.0049,997.0769.24
Shifting PowerMana4.72589,880.777.54%125,000.00125,017.873.16

Statistics & Data Analysis

Fight Length
Swissly Fight Length
Count 9999
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Swissly Damage Per Second
Count 9999
Mean 913732.33
Minimum 819046.12
Maximum 1009578.97
Spread ( max - min ) 190532.84
Range [ ( max - min ) / 2 * 100% ] 10.43%
Standard Deviation 25035.5331
5th Percentile 873323.24
95th Percentile 955125.75
( 95th Percentile - 5th Percentile ) 81802.51
Mean Distribution
Standard Deviation 250.3678
95.00% Confidence Interval ( 913241.62 - 914223.04 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2884
0.1 Scale Factor Error with Delta=300 5350537
0.05 Scale Factor Error with Delta=300 21402148
0.01 Scale Factor Error with Delta=300 535053679
Priority Target DPS
Swissly Priority Target Damage Per Second
Count 9999
Mean 913732.33
Minimum 819046.12
Maximum 1009578.97
Spread ( max - min ) 190532.84
Range [ ( max - min ) / 2 * 100% ] 10.43%
Standard Deviation 25035.5331
5th Percentile 873323.24
95th Percentile 955125.75
( 95th Percentile - 5th Percentile ) 81802.51
Mean Distribution
Standard Deviation 250.3678
95.00% Confidence Interval ( 913241.62 - 914223.04 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2884
0.1 Scale Factor Error with Delta=300 5350537
0.05 Scale Factor Error with Delta=300 21402148
0.01 Scale Factor Error with Delta=300 535053679
DPS(e)
Swissly Damage Per Second (Effective)
Count 9999
Mean 913732.33
Minimum 819046.12
Maximum 1009578.97
Spread ( max - min ) 190532.84
Range [ ( max - min ) / 2 * 100% ] 10.43%
Damage
Swissly Damage
Count 9999
Mean 267334591.28
Minimum 201046103.81
Maximum 338515318.88
Spread ( max - min ) 137469215.07
Range [ ( max - min ) / 2 * 100% ] 25.71%
DTPS
Swissly Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Swissly Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Swissly Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Swissly Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Swissly Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 snapshot_stats
5 0.00 variable,name=st_aoebuild,value=talent.splinterstorm&!(talent.cold_front&talent.slick_ice&talent.deaths_chill&talent.frozen_touch)|talent.frostfire_bolt&!(talent.deep_shatter&talent.slick_ice&talent.deaths_chill)
6 0.00 variable,name=st_ff,value=talent.frostfire_bolt
7 0.00 blizzard,if=active_enemies>=2&talent.ice_caller&!talent.fractured_frost|active_enemies>=4
8 0.00 frostbolt,if=active_enemies<=3
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell
9 0.00 call_action_list,name=cds
A 0.00 run_action_list,name=aoe_ff,if=talent.frostfire_bolt&active_enemies>=4
B 0.00 run_action_list,name=aoe_ss,if=talent.splinterstorm&active_enemies>=3
C 0.00 run_action_list,name=cleave_ff,if=talent.frostfire_bolt&active_enemies>=2&active_enemies<=3
D 0.00 run_action_list,name=cleave_ss,if=talent.splinterstorm&active_enemies=2
E 0.00 run_action_list,name=st_aoebuild,if=variable.st_aoebuild
F 0.00 run_action_list,name=st_ff,if=variable.st_ff
G 0.00 run_action_list,name=st_ss
actions.cds
# count action,conditions
0.00 use_item,name=imperfect_ascendancy_serum,if=buff.icy_veins.remains>19|fight_remains<25
0.00 use_item,name=treacherous_transmitter,if=equipped.spymasters_web&(fight_remains<50|cooldown.icy_veins.remains<12)|!equipped.spymasters_web&(fight_remains<30|prev_off_gcd.icy_veins)
0.00 do_treacherous_transmitter_task,if=fight_remains<18|(buff.cryptic_instructions.remains<?buff.realigning_nexus_convergence_divergence.remains<?buff.errant_manaforge_emission.remains)<(action.shifting_power.execute_time+1*talent.ray_of_frost)
0.00 use_item,name=burst_of_knowledge,if=buff.icy_veins.remains<21|fight_remains<25
J 2.65 use_item,name=spymasters_web,if=fight_remains<22|buff.icy_veins.remains<19&(fight_remains<105|buff.spymasters_report.stack>=32)&(buff.icy_veins.remains>15|equipped.treacherous_transmitter&buff.icy_veins.remains>9)
K 1.36 potion,if=fight_remains<35|buff.icy_veins.remains>10&(fight_remains>315|cooldown.icy_veins.remains+12>fight_remains)
L 1.00 flurry,if=time=0&active_enemies<=2
M 3.43 icy_veins,if=buff.icy_veins.remains<gcd.max*2
0.00 use_items
0.00 invoke_external_buff,name=power_infusion,if=buff.power_infusion.down
0.00 invoke_external_buff,name=blessing_of_summer,if=buff.blessing_of_summer.down
0.00 blood_fury
0.00 berserking
0.00 lights_judgment
0.00 fireblood
0.00 ancestral_call
actions.st_aoebuild
# count action,conditions
P 13.99 comet_storm,if=prev_gcd.1.flurry&(buff.icy_veins.down|talent.frostfire_bolt)
Q 46.56 flurry,if=cooldown_react&(buff.icicles.react<5|talent.splinterstorm)&(remaining_winters_chill=0&debuff.winters_chill.down&(prev_gcd.1.frostbolt|prev_gcd.1.frostfire_bolt|prev_gcd.1.glacial_spike)|buff.excess_frost.react)
R 5.96 frozen_orb,if=cooldown_react&(talent.splinterstorm|(!talent.ray_of_frost|buff.fingers_of_frost.down&cooldown.ray_of_frost.remains&buff.icicles.react<5))
S 4.72 shifting_power,if=(cooldown.icy_veins.remains>10&cooldown.flurry.remains&(fight_remains+10>cooldown.icy_veins.remains)|talent.frostfire_bolt)&(talent.splinterstorm|(buff.icy_veins.down|!talent.deaths_chill)&cooldown.frozen_orb.remains>10&(!talent.comet_storm|cooldown.comet_storm.remains>10)&(!talent.ray_of_frost|cooldown.ray_of_frost.remains>10)&buff.icicles.react<5)
T 33.46 glacial_spike,if=buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill)
U 6.15 ray_of_frost,if=remaining_winters_chill&talent.frostfire_bolt|remaining_winters_chill=1
V 85.86 ice_lance,if=buff.fingers_of_frost.react&!prev_gcd.1.glacial_spike|remaining_winters_chill
W 44.40 frostbolt
X 0.00 call_action_list,name=movement

Sample Sequence

012568LMPUVQVTRSVVWQPVTWQVVWTQVVWQTVWWWWWTQVVWQPTVWQVVTQVUVVRVTQPVVWQTSVQPVVWQTVWQVVTQVVMVWTQPUVVRVVTQVVQVTWQVVWTQVVWWWTQPSVVWQTVQPVVWTQUVVRVWTQVQPVVTQVVWQTVWQVVTQVVWWWVTQPSMKUVVRQVTWQPVVWTJQVVWQTVWQVVTQPVVWWWWTQVVWQTVWWWQTQPVVWQTUVVRSJVWQPTVVVWQTVWQV

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0flask
[precombat]
Swissly 2625000.0/2625000 100% mana incanters_flow, unstable_power_suit_core_haste
Pre1food
[precombat]
Swissly 2625000.0/2625000 100% mana incanters_flow, unstable_power_suit_core_haste
Pre2augmentation
[precombat]
Swissly 2625000.0/2625000 100% mana incanters_flow, unstable_power_suit_core_haste
Pre5st_aoebuild
[precombat]
Swissly 2625000.0/2625000 100% mana incanters_flow, unstable_power_suit_core_haste
Pre6st_ff
[precombat]
Swissly 2625000.0/2625000 100% mana incanters_flow, unstable_power_suit_core_haste
Pre8frostfire_bolt
[precombat]
Fluffy_Pillow 2625000.0/2625000 100% mana incanters_flow, unstable_power_suit_core_haste
0:00.000Lflurry
[cds]
Fluffy_Pillow 2575000.0/2625000 98% mana icicles, incanters_flow, unstable_power_suit_core_haste
0:01.236Micy_veins
[cds]
Fluffy_Pillow 2611800.0/2625000 99% mana bloodlust, bone_chilling(4), cold_front(2), icicles(2), fire_mastery, frost_mastery(2), incanters_flow(2), unstable_power_suit_core_haste, spymasters_report
0:01.236Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2611800.0/2625000 99% mana bloodlust, bone_chilling(4), cold_front(2), icicles(2), icy_veins, fire_mastery, frost_mastery(2), incanters_flow(2), unstable_power_suit_core_haste, spymasters_report
0:02.022Uray_of_frost
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(4), brain_freeze, cold_front(2), frigid_empowerment(2), icicles(2), icy_veins, fire_mastery, frost_mastery(3), frostfire_empowerment, incanters_flow(3), unstable_power_suit_core_haste, spymasters_report
0:04.917Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), brain_freeze, cold_front(2), fingers_of_frost(2), frigid_empowerment(5), icicles(2), icy_veins, fire_mastery(3), frost_mastery(5), frostfire_empowerment, incanters_flow(5), unstable_power_suit_core_haste, spymasters_report
0:05.688Qflurry
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction, brain_freeze, cold_front(2), fingers_of_frost, frigid_empowerment(5), icicles(3), icy_veins, excess_frost, fire_mastery(4), frost_mastery(6), frostfire_empowerment, incanters_flow(5), unstable_power_suit_core_haste, spymasters_report
0:06.453Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction, cold_front(3), fingers_of_frost, frigid_empowerment(5), icicles(4), icy_veins, fire_mastery(4), frost_mastery(6), frostfire_empowerment, incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(2)
0:07.217Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(3), frigid_empowerment(5), icicles(5), icy_veins, fire_mastery(5), frost_mastery(6), frostfire_empowerment, incanters_flow(3), unstable_power_suit_core_haste, spymasters_report(2)
0:08.603Rfrozen_orb
[st_aoebuild]
Fluffy_Pillow 2600250.0/2625000 99% mana bloodlust, bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(3), frigid_empowerment(5), icy_veins, fire_mastery(5), frost_mastery(6), frostfire_empowerment, incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(2), Ascension_Mastery
0:09.361Sshifting_power
[st_aoebuild]
Fluffy_Pillow 2613150.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(3), fingers_of_frost, freezing_rain, frigid_empowerment(5), icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow, unstable_power_suit_core_haste, spymasters_report(2), Ascension_Mastery
0:11.650Vice_lance
[st_aoebuild]
Fluffy_Pillow 2602600.0/2625000 99% mana bloodlust, bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(3), fingers_of_frost(2), freezing_rain, frigid_empowerment(5), icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(2), Ascension_Mastery
0:12.405Vice_lance
[st_aoebuild]
Fluffy_Pillow 2615350.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(3), brain_freeze, cold_front(3), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles, icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(3), unstable_power_suit_core_haste, spymasters_report(3), keen_prowess, Ascension_Mastery
0:13.157Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(4), brain_freeze, cold_front(3), freezing_rain, frigid_empowerment(5), icicles(2), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(4), overflowing_energy, unstable_power_suit_core_haste, spymasters_report(3), keen_prowess, Ascension_Mastery
0:13.912Qflurry
[st_aoebuild]
Fluffy_Pillow 2612750.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(4), brain_freeze, cold_front(4), freezing_rain, frigid_empowerment(5), icicles(3), icy_veins, permafrost_lances, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(4), overflowing_energy, unstable_power_suit_core_haste, spymasters_report(3), keen_prowess, Ascension_Mastery
0:14.666Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(4), cold_front(5), freezing_rain, frigid_empowerment(5), icicles(4), icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_haste, spymasters_report(3), keen_prowess, Ascension_Mastery
0:15.420Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(4), cold_front(5), freezing_rain, frigid_empowerment(5), icicles(4), icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_haste, spymasters_report(3), keen_prowess, Ascension_Mastery
0:16.175Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(5), freezing_rain, frigid_empowerment(5), icicles(5), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(3), keen_prowess, Ascendance_Vers(2)
0:17.554Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2600250.0/2625000 99% mana bloodlust, bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(5), freezing_rain, frigid_empowerment(5), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_haste, spymasters_report(3), keen_prowess, Ascendance_Vers(2)
0:18.458Qflurry
[st_aoebuild]
Fluffy_Pillow 2575250.0/2625000 98% mana bloodlust, bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(5), freezing_rain, frigid_empowerment(5), icicles, icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(4), keen_prowess, Ascendance_Vers(2)
0:19.225Vice_lance
[st_aoebuild]
Fluffy_Pillow 2588600.0/2625000 99% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(7), freezing_rain, frigid_empowerment(5), icicles(2), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_haste, spymasters_report(4), keen_prowess, Ascendance_Vers(2)
0:19.992Vice_lance
[st_aoebuild]
Fluffy_Pillow 2601950.0/2625000 99% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(7), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles(3), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_haste, spymasters_report(4), keen_prowess, Ascendance_Vers(2)
0:20.760Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2615350.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(7), fingers_of_frost, frigid_empowerment(5), icicles(4), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_haste, spymasters_report(4), keen_prowess, Ascendance_Vers(2)
0:21.680Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2575150.0/2625000 98% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(7), fingers_of_frost, frigid_empowerment(5), icicles(5), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(2), overflowing_energy(2), unstable_power_suit_core_haste, spymasters_report(4), keen_prowess, Ascendance_Vers(2)
0:23.180Qflurry
[st_aoebuild]
Fluffy_Pillow 2600150.0/2625000 99% mana bloodlust, bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(8), fingers_of_frost, frigid_empowerment(5), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(4), overflowing_energy(4), unstable_power_suit_core_haste, spymasters_report(4), keen_prowess, Ascendance_Vers(2)
0:23.948Vice_lance
[st_aoebuild]
Fluffy_Pillow 2613550.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(9), fingers_of_frost, frigid_empowerment(5), icicles, icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(4), keen_prowess, Ascendance_Vers(2)
0:24.716Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(9), frigid_empowerment(5), icicles(2), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_haste, spymasters_report(5), Ascension_Crit(3)
0:25.482Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(9), frigid_empowerment(5), icicles(3), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_haste, spymasters_report(5), Ascension_Crit(3)
0:26.403Qflurry
[st_aoebuild]
Fluffy_Pillow 2575200.0/2625000 98% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(9), frigid_empowerment(5), icicles(4), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(5), Ascension_Crit(3)
0:27.170Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2588550.0/2625000 99% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(11), frigid_empowerment(5), icicles(5), icy_veins, incanters_flow(3), unstable_power_suit_core_haste, spymasters_report(5), Ascension_Crit(3)
0:28.657Vice_lance
[st_aoebuild]
Fluffy_Pillow 2600150.0/2625000 99% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(11), frigid_empowerment(5), icy_veins, fire_mastery, frost_mastery(2), incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(5), Ascension_Crit(3)
0:29.462Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2615400.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(11), frigid_empowerment(5), icicles, icy_veins, fire_mastery(2), frost_mastery(4), incanters_flow, overflowing_energy, unstable_power_suit_core_haste, spymasters_report(5), Ascension_Crit(3)
0:30.418Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2575150.0/2625000 98% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(11), frigid_empowerment(5), icicles(2), icy_veins, fire_mastery(2), frost_mastery(4), incanters_flow, overflowing_energy, unstable_power_suit_core_haste, spymasters_report(6), Ascension_Crit(3)
0:31.374Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2572950.0/2625000 98% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(12), frigid_empowerment(5), icicles(3), icy_veins, excess_frost, fire_mastery(4), frost_mastery(6), incanters_flow(2), overflowing_energy(3), unstable_power_suit_core_haste, spymasters_report(6), Ascension_Crit(3)
0:32.311Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2569800.0/2625000 98% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(13), frigid_empowerment(5), icicles(4), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(3), overflowing_energy(4), unstable_power_suit_core_haste, spymasters_report(6), Ascendance_Haste(4)
0:33.229Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2565700.0/2625000 98% mana bloodlust, bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(14), fingers_of_frost, frigid_empowerment(5), icicles(5), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(4), overflowing_energy(5), unstable_power_suit_core_haste, spymasters_report(6), Ascendance_Haste(4)
0:34.143Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2561400.0/2625000 98% mana bloodlust, bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(15), fingers_of_frost, frigid_empowerment(5), icicles(5), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(5), overflowing_energy(5), unstable_power_suit_core_haste, spymasters_report(6), Ascendance_Haste(4)
0:35.639Qflurry
[st_aoebuild]
Fluffy_Pillow 2600250.0/2625000 99% mana bloodlust, bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(16), fingers_of_frost, frigid_empowerment(5), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(5), overflowing_energy(5), unstable_power_suit_core_haste, spymasters_report(6), Ascendance_Haste(4)
0:36.401Vice_lance
[st_aoebuild]
Fluffy_Pillow 2613350.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(5), cold_front(17), fingers_of_frost, frigid_empowerment(5), icicles, icy_veins, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(7), Ascendance_Haste(4)
0:37.163Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(17), frigid_empowerment(5), icicles(2), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_haste, spymasters_report(7), Ascendance_Haste(4)
0:37.928Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bloodlust, bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(17), frigid_empowerment(5), icicles(3), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(3), overflowing_energy, unstable_power_suit_core_haste, spymasters_report(7), Ascendance_Haste(4)
0:38.846Qflurry
[st_aoebuild]
Fluffy_Pillow 2575300.0/2625000 98% mana bloodlust, bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(17), fingers_of_frost, frigid_empowerment(5), icicles(4), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(2), overflowing_energy(2), unstable_power_suit_core_haste, spymasters_report(7), Ascendance_Haste(4)
0:39.610Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2588500.0/2625000 99% mana bloodlust, bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(19), fingers_of_frost, frigid_empowerment(5), icicles(5), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow, time_warp, unstable_power_suit_core_haste, spymasters_report(7), Ascendance_Haste(4)
0:40.421Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2604050.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(19), fingers_of_frost, frigid_empowerment(5), icicles(5), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow, time_warp, unstable_power_suit_core_haste, spymasters_report(7), Ascendance_Vers(5)
0:41.825Vice_lance
[st_aoebuild]
Fluffy_Pillow 2600200.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(19), fingers_of_frost, frigid_empowerment(5), icy_veins, frost_mastery, frostfire_empowerment, incanters_flow(2), time_warp, unstable_power_suit_core_haste, spymasters_report(7), Ascendance_Vers(5)
0:42.638Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2615850.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(19), frigid_empowerment(5), icicles, icy_veins, fire_mastery(2), frost_mastery(4), frostfire_empowerment, incanters_flow(3), time_warp, unstable_power_suit_core_mastery, spymasters_report(8), Ascendance_Vers(5)
0:43.435Qflurry
[st_aoebuild]
Fluffy_Pillow 2605700.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(20), frigid_empowerment(5), icicles(2), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(4), overflowing_energy, time_warp, unstable_power_suit_core_mastery, spymasters_report(8), Ascendance_Vers(5)
0:44.202Vice_lance
[st_aoebuild]
Fluffy_Pillow 2619050.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(21), icicles(3), excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(5), time_warp, unstable_power_suit_core_mastery, spymasters_report(8), Ascendance_Vers(5)
0:45.122Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(21), icicles(4), fire_mastery(6), frost_mastery(6), incanters_flow(5), time_warp, unstable_power_suit_core_mastery, spymasters_report(8), Ascendance_Vers(5), flask_of_alchemical_chaos_crit
0:46.041Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(21), icicles(5), fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report(8), Ascendance_Vers(5), flask_of_alchemical_chaos_crit
0:48.231Qflurry
[st_aoebuild]
Fluffy_Pillow 2600250.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(21), fire_mastery(6), frost_mastery(6), incanters_flow(2), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(8), Ascension_Crit(6), flask_of_alchemical_chaos_crit
0:49.426Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(22), icicles, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_mastery, spymasters_report(9), Ascension_Crit(6), flask_of_alchemical_chaos_crit
0:50.620Uray_of_frost
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(22), icicles(2), fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_mastery, spymasters_report(9), Ascension_Crit(6), flask_of_alchemical_chaos_crit
0:54.826Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(22), fingers_of_frost(2), icicles(2), fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report(10), Ascension_Crit(6), flask_of_alchemical_chaos_crit
0:56.021Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(22), fingers_of_frost, icicles(3), fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report(10), Ascendance_Vers(7), flask_of_alchemical_chaos_crit
0:57.218Rfrozen_orb
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(22), icicles(4), incanters_flow(3), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(10), Ascendance_Vers(7), flask_of_alchemical_chaos_crit
0:58.486Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(22), fingers_of_frost, freezing_rain, icicles(4), permafrost_lances, fire_mastery, frost_mastery(2), incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report(10), Ascendance_Vers(7), flask_of_alchemical_chaos_crit
0:59.739Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(22), fingers_of_frost, freezing_rain, icicles(5), permafrost_lances, fire_mastery(2), frost_mastery(4), incanters_flow, overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(10), Ascendance_Vers(7), flask_of_alchemical_chaos_crit
1:02.016Qflurry
[st_aoebuild]
Fluffy_Pillow 2600350.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(22), fingers_of_frost, freezing_rain, permafrost_lances, fire_mastery(2), frost_mastery(5), incanters_flow(3), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(11), Ascendance_Vers(7), flask_of_alchemical_chaos_crit
1:03.258Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(23), fingers_of_frost(2), freezing_rain, icicles, permafrost_lances, fire_mastery(3), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report(11), Ascendance_Vers(7), flask_of_alchemical_chaos_crit
1:04.489Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(23), fingers_of_frost(2), freezing_rain, icicles, permafrost_lances, fire_mastery(4), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report(11), Ascension_Crit(8), flask_of_alchemical_chaos_crit
1:05.707Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(23), fingers_of_frost, freezing_rain, icicles(2), permafrost_lances, fire_mastery(5), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report(11), keen_prowess, Ascension_Crit(8), flask_of_alchemical_chaos_crit
1:06.914Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(23), freezing_rain, icicles(3), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(4), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(12), keen_prowess, Ascension_Crit(8), flask_of_alchemical_chaos_crit
1:08.347Qflurry
[st_aoebuild]
Fluffy_Pillow 2575150.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(23), freezing_rain, icicles(4), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report(12), keen_prowess, Ascension_Crit(8), flask_of_alchemical_chaos_crit
1:09.544Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2610000.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(25), icicles(5), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_mastery, spymasters_report(12), keen_prowess, Ascension_Crit(8), flask_of_alchemical_chaos_crit
1:11.733Sshifting_power
[st_aoebuild]
Fluffy_Pillow 2600200.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(25), permafrost_lances, frost_mastery, incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report(12), keen_prowess, Ascension_Crit(8), flask_of_alchemical_chaos_crit
1:15.386Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(25), fire_mastery(4), frost_mastery(5), incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report(13), keen_prowess, Ascension_Crit(9), flask_of_alchemical_chaos_crit
1:16.604Qflurry
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), brain_freeze, cold_front(25), excess_frost, fire_mastery(5), frost_mastery(6), incanters_flow(4), overflowing_energy(2), unstable_power_suit_core_mastery, spymasters_report(13), keen_prowess, Ascension_Crit(9), flask_of_alchemical_chaos_crit
1:17.811Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), cold_front(26), icicles, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_mastery, spymasters_report(13), keen_prowess, Ascension_Crit(9), flask_of_alchemical_chaos_crit
1:19.006Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), cold_front(26), icicles, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_mastery, spymasters_report(13), keen_prowess, Ascension_Crit(9), flask_of_alchemical_chaos_crit
1:20.203Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction, brain_freeze, cold_front(26), icicles(2), fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_crit, spymasters_report(14), keen_prowess, Ascension_Crit(10), flask_of_alchemical_chaos_crit
1:21.400Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(26), icicles(3), fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_crit, spymasters_report(14), keen_prowess, Ascension_Crit(10), flask_of_alchemical_chaos_crit
1:22.833Qflurry
[st_aoebuild]
Fluffy_Pillow 2575150.0/2625000 98% mana bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(26), icicles(4), fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_crit, spymasters_report(14), keen_prowess, Ascension_Crit(10), flask_of_alchemical_chaos_crit
1:24.029Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2609950.0/2625000 99% mana bone_chilling(10), chain_reaction(2), cold_front(28), icicles(5), fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_crit, spymasters_report(14), keen_prowess, Ascension_Crit(10), flask_of_alchemical_chaos_crit
1:26.216Vice_lance
[st_aoebuild]
Fluffy_Pillow 2600100.0/2625000 99% mana bone_chilling(10), chain_reaction(2), cold_front(28), fingers_of_frost, frost_mastery, incanters_flow(4), unstable_power_suit_core_crit, spymasters_report(15), keen_prowess, Ascension_Crit(10), flask_of_alchemical_chaos_crit
1:27.483Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(3), cold_front(28), icicles, fire_mastery, frost_mastery(3), frostfire_empowerment, incanters_flow(3), unstable_power_suit_core_crit, spymasters_report(15), Ascension_Crit(10), flask_of_alchemical_chaos_crit
1:28.736Qflurry
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(3), cold_front_ready, icicles(2), excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_crit, spymasters_report(15), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
1:29.930Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(3), cold_front, fingers_of_frost, icicles(3), permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_crit, spymasters_report(15), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
1:31.127Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(4), brain_freeze, cold_front, fingers_of_frost, icicles(4), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_crit, spymasters_report(15), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
1:32.322Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front, icicles(5), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_crit, spymasters_report(16), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
1:34.513Qflurry
[st_aoebuild]
Fluffy_Pillow 2600300.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front, fingers_of_frost(2), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(5), overflowing_energy, unstable_power_suit_core_crit, spymasters_report(16), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
1:35.708Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(2), fingers_of_frost(2), icicles, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_crit, spymasters_report(16), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
1:36.903Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(2), fingers_of_frost, icicles(2), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_crit, spymasters_report(16), Ascendance_Vers(10), flask_of_alchemical_chaos_crit
1:38.100Micy_veins
[cds]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(2), fingers_of_frost, icicles(3), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_crit, spymasters_report(17), Ascendance_Vers(10), flask_of_alchemical_chaos_crit
1:38.100Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(2), fingers_of_frost, icicles(3), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_crit, spymasters_report(17), Ascendance_Vers(10), flask_of_alchemical_chaos_crit
1:39.095Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(2), frigid_empowerment(2), icicles(4), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow, unstable_power_suit_core_crit, spymasters_report(17), Ascendance_Vers(10), flask_of_alchemical_chaos_crit
1:40.093Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2624900.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(3), frigid_empowerment(3), icicles(5), icy_veins, permafrost_lances, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow, overflowing_energy(2), unstable_power_suit_core_crit, spymasters_report(17), Ascendance_Vers(10), flask_of_alchemical_chaos_crit
1:41.919Qflurry
[st_aoebuild]
Fluffy_Pillow 2600250.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(3), frigid_empowerment(5), icy_veins, permafrost_lances, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(2), overflowing_energy(2), unstable_power_suit_core_crit, spymasters_report(17), Ascendance_Vers(10), flask_of_alchemical_chaos_crit
1:42.917Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(4), frigid_empowerment(5), icicles, icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_crit, spymasters_report(17), Ascendance_Vers(10), flask_of_alchemical_chaos_crit
1:43.914Uray_of_frost
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(4), frigid_empowerment(5), icicles, icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(17), Ascendance_Vers(10), flask_of_alchemical_chaos_crit
1:47.352Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(4), fingers_of_frost(2), frigid_empowerment(5), icicles, icy_veins, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_haste, spymasters_report(18), Ascendance_Haste(10), flask_of_alchemical_chaos_vers
1:48.316Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(4), fingers_of_frost, frigid_empowerment(5), icicles(2), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(2), overflowing_energy, unstable_power_suit_core_haste, spymasters_report(18), Ascendance_Haste(10), flask_of_alchemical_chaos_vers
1:49.282Rfrozen_orb
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(4), frigid_empowerment(5), icicles(3), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_haste, spymasters_report(18), Ascendance_Haste(10), flask_of_alchemical_chaos_vers
1:50.246Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(4), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles(3), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_haste, spymasters_report(18), Ascendance_Haste(10), flask_of_alchemical_chaos_vers
1:51.211Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(4), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles(4), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(2), overflowing_energy, unstable_power_suit_core_haste, spymasters_report(19), Ascendance_Haste(10), flask_of_alchemical_chaos_vers
1:52.176Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(4), freezing_rain, frigid_empowerment(5), icicles(5), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(3), overflowing_energy, unstable_power_suit_core_haste, spymasters_report(19), Ascension_Crit(10), flask_of_alchemical_chaos_vers
1:53.968Qflurry
[st_aoebuild]
Fluffy_Pillow 2600300.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(4), fingers_of_frost, freezing_rain, frigid_empowerment(5), icy_veins, permafrost_lances, frost_mastery, incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(19), Ascension_Crit(10), flask_of_alchemical_chaos_vers
1:55.003Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(5), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles, icy_veins, permafrost_lances, fire_mastery(2), frost_mastery(4), incanters_flow(5), unstable_power_suit_core_haste, spymasters_report(19), Ascension_Crit(10), flask_of_alchemical_chaos_vers
1:56.019Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(5), freezing_rain, frigid_empowerment(5), icicles(2), icy_veins, permafrost_lances, fire_mastery(2), frost_mastery(5), incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(19), Ascension_Crit(10), flask_of_alchemical_chaos_vers
1:57.034Qflurry
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(5), freezing_rain, frigid_empowerment(5), icicles(3), icy_veins, permafrost_lances, excess_frost, fire_mastery(3), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_haste, spymasters_report(20), Ascension_Crit(10), flask_of_alchemical_chaos_vers
1:58.041Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(6), freezing_rain, frigid_empowerment(5), icicles(4), icy_veins, permafrost_lances, fire_mastery(4), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(20), Ascension_Crit(10), flask_of_alchemical_chaos_vers
1:59.036Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(6), freezing_rain, frigid_empowerment(5), icicles(5), icy_veins, permafrost_lances, fire_mastery(5), frost_mastery(6), incanters_flow, unstable_power_suit_core_haste, spymasters_report(20), Ascension_Crit(10), flask_of_alchemical_chaos_vers
2:00.844Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2600250.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(6), fingers_of_frost(2), freezing_rain, frigid_empowerment(5), icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_haste, spymasters_report(20), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:02.016Qflurry
[st_aoebuild]
Fluffy_Pillow 2575150.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(6), fingers_of_frost(2), frigid_empowerment(5), icicles, icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(3), time_warp, unstable_power_suit_core_haste, spymasters_report(20), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:02.773Vice_lance
[st_aoebuild]
Fluffy_Pillow 2588000.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(8), fingers_of_frost(2), frigid_empowerment(5), icicles(2), icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(3), time_warp, unstable_power_suit_core_haste, spymasters_report(21), keen_prowess, Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:03.529Vice_lance
[st_aoebuild]
Fluffy_Pillow 2600800.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(8), fingers_of_frost, frigid_empowerment(5), icicles(3), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(4), time_warp, unstable_power_suit_core_haste, spymasters_report(21), keen_prowess, Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:04.282Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2613450.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(8), frigid_empowerment(5), icicles(4), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(5), time_warp, unstable_power_suit_core_haste, spymasters_report(21), keen_prowess, Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:05.187Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2575300.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(8), fingers_of_frost, frigid_empowerment(5), icicles(5), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(5), time_warp, unstable_power_suit_core_haste, spymasters_report(21), keen_prowess, Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:06.662Qflurry
[st_aoebuild]
Fluffy_Pillow 2600350.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(9), fingers_of_frost, frigid_empowerment(5), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(4), overflowing_energy(2), time_warp, unstable_power_suit_core_haste, spymasters_report(21), keen_prowess, Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:07.417Vice_lance
[st_aoebuild]
Fluffy_Pillow 2613100.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(10), fingers_of_frost, frigid_empowerment(5), icicles, icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_haste, spymasters_report(21), keen_prowess, Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:08.396Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(10), frigid_empowerment(5), icicles(2), icy_veins, incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(21), keen_prowess, Ascendance_Haste(10), flask_of_alchemical_chaos_vers
2:09.419Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(10), frigid_empowerment(5), icicles(3), icy_veins, frost_mastery, incanters_flow, unstable_power_suit_core_haste, spymasters_report(22), keen_prowess, Ascendance_Haste(10), flask_of_alchemical_chaos_vers
2:10.646Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2575250.0/2625000 98% mana bone_chilling(10), chain_reaction(5), cold_front(10), frigid_empowerment(5), icicles(4), icy_veins, frost_mastery, incanters_flow, unstable_power_suit_core_haste, spymasters_report(22), keen_prowess, Ascendance_Haste(10), flask_of_alchemical_chaos_vers
2:11.873Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2575250.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(11), frigid_empowerment(5), icicles(5), icy_veins, fire_mastery(2), frost_mastery(3), incanters_flow(2), overflowing_energy, unstable_power_suit_core_haste, spymasters_report(22), keen_prowess, Ascendance_Haste(10), flask_of_alchemical_chaos_vers
2:13.075Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2575200.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(12), frigid_empowerment(5), icicles(5), icy_veins, fire_mastery(3), frost_mastery(4), incanters_flow(4), overflowing_energy(2), unstable_power_suit_core_haste, spymasters_report(22), keen_prowess, Ascendance_Haste(10), flask_of_alchemical_chaos_vers
2:15.022Qflurry
[st_aoebuild]
Fluffy_Pillow 2600150.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(13), fingers_of_frost, frigid_empowerment(5), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(5), overflowing_energy(5), unstable_power_suit_core_haste, spymasters_report(23), Ascendance_Haste(10), flask_of_alchemical_chaos_mastery
2:16.005Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2624300.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(14), fingers_of_frost, frigid_empowerment(5), icicles, icy_veins, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(23), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery
2:17.005Sshifting_power
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(14), fingers_of_frost, frigid_empowerment(5), icicles, icy_veins, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_haste, spymasters_report(23), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery
2:19.892Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), cold_front(14), fingers_of_frost, icicles, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_haste, spymasters_report(23), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery
2:21.087Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction, brain_freeze, cold_front(14), icicles(2), fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(24), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery
2:22.281Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(14), icicles(3), fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_haste, spymasters_report(24), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery
2:23.717Qflurry
[st_aoebuild]
Fluffy_Pillow 2575300.0/2625000 98% mana bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(14), icicles(4), fire_mastery(6), incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(24), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery
2:24.914Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2610150.0/2625000 99% mana bone_chilling(4), chain_reaction(2), cold_front(16), icicles(5), frost_mastery(3), incanters_flow(5), unstable_power_suit_core_crit, spymasters_report(24), Ascension_Crit(10), flask_of_alchemical_chaos_mastery
2:27.234Vice_lance
[st_aoebuild]
Fluffy_Pillow 2600200.0/2625000 99% mana bone_chilling(4), chain_reaction(2), brain_freeze, cold_front(16), fingers_of_frost, frigid_empowerment(3), icy_veins, frost_mastery(4), frostfire_empowerment, incanters_flow(3), unstable_power_suit_core_crit, spymasters_report(25), Ascension_Crit(10), flask_of_alchemical_chaos_mastery
2:28.289Qflurry
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(4), chain_reaction(3), brain_freeze, cold_front(16), frigid_empowerment(5), icicles, icy_veins, excess_frost, fire_mastery, frost_mastery(6), frostfire_empowerment, incanters_flow(2), overflowing_energy(2), unstable_power_suit_core_crit, spymasters_report(25), Ascension_Crit(10), flask_of_alchemical_chaos_mastery
2:29.336Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(7), chain_reaction(3), cold_front(17), frigid_empowerment(5), icicles(2), icy_veins, fire_mastery, frost_mastery(6), frostfire_empowerment, incanters_flow, unstable_power_suit_core_crit, spymasters_report(25), Ascension_Crit(10), flask_of_alchemical_chaos_mastery
2:30.383Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(7), chain_reaction(3), cold_front(17), frigid_empowerment(5), icicles(2), icy_veins, fire_mastery, frost_mastery(6), frostfire_empowerment, incanters_flow, unstable_power_suit_core_crit, spymasters_report(25), Ascension_Crit(10), flask_of_alchemical_chaos_mastery
2:31.430Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(7), chain_reaction(4), cold_front(17), frigid_empowerment(5), icicles(3), icy_veins, fire_mastery(3), frost_mastery(6), frostfire_empowerment, incanters_flow(2), unstable_power_suit_core_crit, spymasters_report(25), Ascension_Crit(10), flask_of_alchemical_chaos_mastery
2:32.456Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(7), chain_reaction(5), cold_front(17), frigid_empowerment(5), icicles(4), icy_veins, fire_mastery(3), frost_mastery(6), frostfire_empowerment, incanters_flow(3), unstable_power_suit_core_crit, spymasters_report(25), Ascendance_Haste(10), flask_of_alchemical_chaos_mastery
2:33.468Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(8), chain_reaction(5), cold_front(18), fingers_of_frost, frigid_empowerment(5), icicles(5), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_crit, spymasters_report(26), Ascendance_Haste(10), flask_of_alchemical_chaos_mastery
2:35.267Qflurry
[st_aoebuild]
Fluffy_Pillow 2600150.0/2625000 99% mana bone_chilling(8), chain_reaction(5), cold_front(18), fingers_of_frost, frigid_empowerment(5), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_crit, spymasters_report(26), Ascendance_Haste(10), flask_of_alchemical_chaos_mastery
2:36.250Uray_of_frost
[st_aoebuild]
Fluffy_Pillow 2624300.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(19), fingers_of_frost, frigid_empowerment(5), icicles, icy_veins, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_crit, spymasters_report(26), Ascendance_Haste(10), flask_of_alchemical_chaos_mastery
2:39.756Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(19), fingers_of_frost(2), icicles, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_vers, spymasters_report(27), Ascendance_Haste(10), flask_of_alchemical_chaos_mastery
2:40.937Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(19), fingers_of_frost, icicles(2), fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_vers, spymasters_report(27), Ascension_Mastery(10), flask_of_alchemical_chaos_mastery
2:42.131Rfrozen_orb
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(19), icicles(3), fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_vers, spymasters_report(27), Ascension_Mastery(10), flask_of_alchemical_chaos_mastery
2:43.326Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(19), fingers_of_frost, freezing_rain, icicles(3), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_vers, spymasters_report(27), Ascension_Mastery(10), flask_of_alchemical_chaos_mastery
2:44.522Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(19), freezing_rain, icicles(4), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(5), overflowing_energy, unstable_power_suit_core_vers, spymasters_report(27), Ascension_Mastery(10), flask_of_alchemical_chaos_mastery
2:45.957Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2575250.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(19), fingers_of_frost, freezing_rain, icicles(5), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(5), overflowing_energy, unstable_power_suit_core_vers, spymasters_report(28), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:48.240Qflurry
[st_aoebuild]
Fluffy_Pillow 2600150.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(20), fingers_of_frost(2), freezing_rain, permafrost_lances, fire_mastery, frost_mastery(2), incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report(28), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:49.494Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(21), fingers_of_frost(2), freezing_rain, icicles, icy_veins, permafrost_lances, excess_frost, fire_mastery(4), frost_mastery(6), frostfire_empowerment, incanters_flow, unstable_power_suit_core_mastery, spymasters_report(28), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:50.512Qflurry
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(21), fingers_of_frost, freezing_rain, frigid_empowerment(3), icicles(2), icy_veins, permafrost_lances, excess_frost, fire_mastery(4), frost_mastery(6), frostfire_empowerment, incanters_flow, unstable_power_suit_core_mastery, spymasters_report(28), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:51.528Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(22), fingers_of_frost, freezing_rain, frigid_empowerment(4), icicles(3), icy_veins, permafrost_lances, fire_mastery(5), frost_mastery(6), frostfire_empowerment, incanters_flow(2), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(29), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:52.535Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(22), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles(3), icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(3), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(29), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:53.533Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(22), freezing_rain, frigid_empowerment(5), icicles(4), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report(29), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:54.531Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(22), frigid_empowerment(5), icicles(5), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(5), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(29), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:56.358Qflurry
[st_aoebuild]
Fluffy_Pillow 2600300.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(22), frigid_empowerment(5), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(4), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(29), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:57.356Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(23), frigid_empowerment(5), icicles, icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(3), unstable_power_suit_core_mastery, spymasters_report(29), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:58.353Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(23), frigid_empowerment(5), icicles(2), icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report(30), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
2:59.351Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(23), frigid_empowerment(5), icicles(3), icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow, unstable_power_suit_core_mastery, spymasters_report(30), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
3:00.349Qflurry
[st_aoebuild]
Fluffy_Pillow 2624900.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(24), frigid_empowerment(5), icicles(4), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_mastery, spymasters_report(30), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
3:01.345Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(25), icicles(5), excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(2), overflowing_energy(2), unstable_power_suit_core_mastery, spymasters_report(30), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
3:03.533Vice_lance
[st_aoebuild]
Fluffy_Pillow 2600150.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(25), excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(4), overflowing_energy(2), unstable_power_suit_core_mastery, spymasters_report(30), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
3:04.728Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(25), icicles, fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report(31), Ascendance_Haste(10), flask_of_alchemical_chaos_vers
3:06.141Qflurry
[st_aoebuild]
Fluffy_Pillow 2575150.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(25), icicles(2), fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report(31), Ascendance_Haste(10), flask_of_alchemical_chaos_vers
3:07.320Vice_lance
[st_aoebuild]
Fluffy_Pillow 2609100.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(27), icicles(3), fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_mastery, spymasters_report(31), Ascendance_Haste(10), flask_of_alchemical_chaos_vers
3:08.499Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(27), icicles(4), fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report(31), Ascendance_Haste(10), flask_of_alchemical_chaos_vers
3:09.680Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(27), icicles(5), fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_haste, spymasters_report(32), Ascendance_Haste(10), flask_of_alchemical_chaos_vers
3:11.797Qflurry
[st_aoebuild]
Fluffy_Pillow 2600150.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(27), fingers_of_frost, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(32), Ascendance_Haste(10), flask_of_alchemical_chaos_vers
3:12.953Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(28), fingers_of_frost, icicles, fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_haste, spymasters_report(32), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
3:14.126Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(28), icicles(2), incanters_flow(5), unstable_power_suit_core_haste, spymasters_report(32), Ascension_Mastery(10), flask_of_alchemical_chaos_vers
3:15.367Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(28), icicles(3), fire_mastery(3), frost_mastery(4), frostfire_empowerment, incanters_flow(5), overflowing_energy, unstable_power_suit_core_haste, spymasters_report(32), Ascension_Mastery(10), flask_of_alchemical_chaos_mastery
3:16.566Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front_ready, icicles(4), excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(4), overflowing_energy(3), unstable_power_suit_core_haste, spymasters_report(33), Ascension_Mastery(10), flask_of_alchemical_chaos_mastery
3:17.966Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2575200.0/2625000 98% mana bone_chilling(10), chain_reaction(5), cold_front_ready, icicles(5), excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(3), overflowing_energy(3), unstable_power_suit_core_haste, spymasters_report(33), Ascension_Mastery(10), flask_of_alchemical_chaos_mastery
3:19.367Vice_lance
[st_aoebuild]
Fluffy_Pillow 2575250.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front, fingers_of_frost(2), icicles(5), permafrost_lances, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow, overflowing_energy(5), unstable_power_suit_core_haste, spymasters_report(33), Ascension_Mastery(10), flask_of_alchemical_chaos_mastery
3:20.535Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2608650.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(2), fingers_of_frost, icicles(5), permafrost_lances, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow, overflowing_energy(2), unstable_power_suit_core_haste, spymasters_report(33), Ascendance_Haste(10), flask_of_alchemical_chaos_mastery
3:22.644Qflurry
[st_aoebuild]
Fluffy_Pillow 2600200.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(2), fingers_of_frost(2), permafrost_lances, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(3), overflowing_energy(3), unstable_power_suit_core_haste, spymasters_report(34), Ascendance_Haste(10), flask_of_alchemical_chaos_mastery
3:23.796Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(3), fingers_of_frost(2), icicles, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(34), Ascendance_Haste(10), flask_of_alchemical_chaos_mastery
3:24.948Sshifting_power
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(3), fingers_of_frost(2), icicles, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_haste, spymasters_report(34), Ascendance_Haste(10), flask_of_alchemical_chaos_mastery
3:28.415Micy_veins
[cds]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(3), fingers_of_frost(2), icicles, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(34), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery
3:28.415Kpotion
[cds]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(3), fingers_of_frost(2), icicles, icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(34), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery
3:28.415Uray_of_frost
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(3), fingers_of_frost(2), icicles, icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(34), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:31.778Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), brain_freeze, cold_front(3), fingers_of_frost(2), frigid_empowerment(5), icicles, icy_veins, permafrost_lances, fire_mastery, frost_mastery, frostfire_empowerment, incanters_flow(2), time_warp, unstable_power_suit_core_haste, spymasters_report(35), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:32.536Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction, brain_freeze, cold_front(3), fingers_of_frost, frigid_empowerment(5), icicles(2), icy_veins, permafrost_lances, fire_mastery(2), frost_mastery(3), frostfire_empowerment, incanters_flow(3), overflowing_energy, time_warp, unstable_power_suit_core_haste, spymasters_report(35), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:33.290Rfrozen_orb
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(3), frigid_empowerment(5), icicles(3), icy_veins, excess_frost, fire_mastery(4), frost_mastery(6), frostfire_empowerment, incanters_flow(4), overflowing_energy, time_warp, unstable_power_suit_core_haste, spymasters_report(35), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:34.044Qflurry
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(3), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles(3), icy_veins, permafrost_lances, excess_frost, fire_mastery(5), frost_mastery(6), frostfire_empowerment, incanters_flow(5), overflowing_energy(2), time_warp, unstable_power_suit_core_haste, spymasters_report(35), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:34.797Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(2), cold_front(4), fingers_of_frost(2), freezing_rain, frigid_empowerment(5), icicles(4), icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(5), overflowing_energy, time_warp, unstable_power_suit_core_haste, spymasters_report(36), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:35.552Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(3), brain_freeze, cold_front(4), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles(5), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(5), time_warp, unstable_power_suit_core_haste, spymasters_report(36), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:36.871Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2600200.0/2625000 99% mana bone_chilling(10), chain_reaction(3), brain_freeze, cold_front(4), fingers_of_frost, freezing_rain, frigid_empowerment(5), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment(2), incanters_flow(4), time_warp, unstable_power_suit_core_haste, spymasters_report(36), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:37.624Qflurry
[st_aoebuild]
Fluffy_Pillow 2587850.0/2625000 99% mana bone_chilling(10), chain_reaction(3), brain_freeze, cold_front(5), fingers_of_frost(2), freezing_rain, frigid_empowerment(5), icicles, icy_veins, permafrost_lances, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(3), overflowing_energy, unstable_power_suit_core_haste, spymasters_report(36), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:38.557Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2609500.0/2625000 99% mana bone_chilling(10), chain_reaction(3), cold_front(6), fingers_of_frost(2), freezing_rain, frigid_empowerment(5), icicles(2), icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report(36), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:39.512Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(3), cold_front(6), fingers_of_frost(2), freezing_rain, frigid_empowerment(5), icicles(2), icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow, unstable_power_suit_core_mastery, spymasters_report(36), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:40.465Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(4), brain_freeze, cold_front(6), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles(3), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow, unstable_power_suit_core_mastery, spymasters_report(36), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:41.418Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(6), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles(4), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report(37), Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:42.371Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2622650.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(7), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles(5), icy_veins, permafrost_lances, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(3), overflowing_energy(2), unstable_power_suit_core_mastery, spymasters_report(37), keen_prowess, Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:44.117Juse_item_spymasters_web
[cds]
Fluffy_Pillow 2600250.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(7), fingers_of_frost, freezing_rain, frigid_empowerment(5), icy_veins, permafrost_lances, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report(37), keen_prowess, Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:44.117Qflurry
[st_aoebuild]
Fluffy_Pillow 2600250.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(7), fingers_of_frost, freezing_rain, frigid_empowerment(5), icy_veins, permafrost_lances, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(5), unstable_power_suit_core_mastery, spymasters_web(37), keen_prowess, Ascendance_Vers(10), flask_of_alchemical_chaos_mastery, tempered_potion
3:45.069Vice_lance
[st_aoebuild]
Fluffy_Pillow 2622850.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(8), fingers_of_frost, freezing_rain, frigid_empowerment(5), icicles, icy_veins, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(5), unstable_power_suit_core_mastery, spymasters_web(37), keen_prowess, Ascendance_Vers(10), flask_of_alchemical_chaos_crit, tempered_potion
3:46.028Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(8), frigid_empowerment(5), icicles(2), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(4), unstable_power_suit_core_mastery, spymasters_web(37), keen_prowess, Ascendance_Vers(10), flask_of_alchemical_chaos_crit, tempered_potion
3:46.988Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(8), frigid_empowerment(5), icicles(3), icy_veins, permafrost_lances, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report, spymasters_web(37), keen_prowess, Ascendance_Vers(10), flask_of_alchemical_chaos_crit, tempered_potion
3:47.946Qflurry
[st_aoebuild]
Fluffy_Pillow 2622900.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(9), frigid_empowerment(5), icicles(4), icy_veins, permafrost_lances, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(3), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report, spymasters_web(37), keen_prowess, Ascendance_Vers(10), flask_of_alchemical_chaos_crit, tempered_potion
3:48.904Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(10), frigid_empowerment(5), icicles(5), icy_veins, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report, spymasters_web(37), keen_prowess, Ascendance_Vers(10), flask_of_alchemical_chaos_crit, tempered_potion
3:50.658Vice_lance
[st_aoebuild]
Fluffy_Pillow 2600250.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(10), frigid_empowerment(5), icy_veins, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_mastery, spymasters_report, spymasters_web(37), keen_prowess, Ascendance_Vers(10), flask_of_alchemical_chaos_crit, tempered_potion
3:51.617Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2623200.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(10), frigid_empowerment(5), icicles, icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(2), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report, spymasters_web(37), keen_prowess, Ascendance_Vers(10), flask_of_alchemical_chaos_crit, tempered_potion
3:52.766Qflurry
[st_aoebuild]
Fluffy_Pillow 2575200.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(10), frigid_empowerment(5), icicles(2), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow(3), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report, spymasters_web(37), keen_prowess, Ascension_Crit(10), flask_of_alchemical_chaos_crit, tempered_potion
3:53.723Vice_lance
[st_aoebuild]
Fluffy_Pillow 2598050.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(12), frigid_empowerment(5), icicles(3), icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report(2), spymasters_web(37), keen_prowess, Ascension_Crit(10), flask_of_alchemical_chaos_crit, tempered_potion
3:54.681Vice_lance
[st_aoebuild]
Fluffy_Pillow 2620950.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(12), frigid_empowerment(5), icicles(4), icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report(2), spymasters_web(37), Ascension_Crit(10), flask_of_alchemical_chaos_crit, tempered_potion
3:55.640Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(12), frigid_empowerment(5), icicles(5), icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment(2), incanters_flow(5), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(2), spymasters_web(37), Ascension_Crit(10), flask_of_alchemical_chaos_crit, tempered_potion
3:57.394Qflurry
[st_aoebuild]
Fluffy_Pillow 2600250.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(12), frigid_empowerment(5), icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment(2), incanters_flow(3), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(2), spymasters_web(37), Ascension_Crit(10), flask_of_alchemical_chaos_crit, tempered_potion
3:58.354Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2623250.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(13), frigid_empowerment(5), icicles, icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment(2), incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report(2), spymasters_web(37), Ascension_Crit(10), flask_of_alchemical_chaos_crit, tempered_potion
3:59.554Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(13), frigid_empowerment(5), icicles, icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment(2), incanters_flow, unstable_power_suit_core_mastery, spymasters_report(3), spymasters_web(37), Ascension_Crit(10), flask_of_alchemical_chaos_crit
4:00.551Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(13), frigid_empowerment(5), icicles(2), icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment(2), incanters_flow, unstable_power_suit_core_mastery, spymasters_report(3), spymasters_web(37), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
4:01.548Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(13), frigid_empowerment(5), icicles(3), icy_veins, frostfire_empowerment(2), incanters_flow(2), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(3), spymasters_web(37), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
4:02.603Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(14), frigid_empowerment(5), icicles(4), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(3), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(3), spymasters_web(37), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
4:03.600Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2624850.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(15), frigid_empowerment(5), icicles(5), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(4), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(3), spymasters_web(37), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
4:04.798Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2575300.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(15), fingers_of_frost, frigid_empowerment(5), icicles(5), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(5), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(3), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
4:05.995Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2575250.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(16), fingers_of_frost, frigid_empowerment(5), icicles(5), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(5), overflowing_energy(3), unstable_power_suit_core_mastery, spymasters_report(4), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
4:07.915Qflurry
[st_aoebuild]
Fluffy_Pillow 2600200.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(17), fingers_of_frost, frigid_empowerment(5), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(3), overflowing_energy(4), time_warp, unstable_power_suit_core_mastery, spymasters_report(4), Ascension_Mastery(10), flask_of_alchemical_chaos_crit
4:08.682Vice_lance
[st_aoebuild]
Fluffy_Pillow 2613550.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(18), fingers_of_frost, frigid_empowerment(5), icicles, icy_veins, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(2), time_warp, unstable_power_suit_core_mastery, spymasters_report(4), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:09.438Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(18), frigid_empowerment(5), icicles(2), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow, time_warp, unstable_power_suit_core_mastery, spymasters_report(4), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:10.195Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(18), frigid_empowerment(5), icicles(3), icy_veins, fire_mastery(6), frost_mastery(6), incanters_flow, time_warp, unstable_power_suit_core_mastery, spymasters_report(4), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:11.102Qflurry
[st_aoebuild]
Fluffy_Pillow 2575150.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(18), icicles(4), fire_mastery(6), frost_mastery(6), incanters_flow(2), time_warp, unstable_power_suit_core_mastery, spymasters_report(4), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:12.012Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2595650.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(20), icicles(5), fire_mastery(6), frost_mastery(6), incanters_flow(3), time_warp, unstable_power_suit_core_mastery, spymasters_report(5), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:13.674Vice_lance
[st_aoebuild]
Fluffy_Pillow 2600250.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(20), fingers_of_frost, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report(5), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:14.853Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(20), icicles, fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report(5), Ascendance_Haste(10), flask_of_alchemical_chaos_haste
4:16.191Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2575250.0/2625000 98% mana bone_chilling(10), chain_reaction(5), cold_front(20), icicles(2), fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report(5), Ascendance_Haste(10), flask_of_alchemical_chaos_haste
4:17.527Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2575150.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(21), icicles(3), incanters_flow(3), overflowing_energy(2), unstable_power_suit_core_mastery, spymasters_report(5), Ascendance_Haste(10), flask_of_alchemical_chaos_haste
4:18.945Qflurry
[st_aoebuild]
Fluffy_Pillow 2575250.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(22), icicles(4), fire_mastery(2), frost_mastery(2), incanters_flow(2), overflowing_energy(3), unstable_power_suit_core_mastery, spymasters_report(6), Ascendance_Haste(10), flask_of_alchemical_chaos_haste
4:20.104Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2608200.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(24), frigid_empowerment(2), icicles(5), icy_veins, fire_mastery(4), frost_mastery(5), frostfire_empowerment, incanters_flow, unstable_power_suit_core_mastery, spymasters_report(6), Ascendance_Haste(10), flask_of_alchemical_chaos_haste
4:21.840Qflurry
[st_aoebuild]
Fluffy_Pillow 2600300.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(24), frigid_empowerment(4), icy_veins, excess_frost, fire_mastery(5), frost_mastery(6), frostfire_empowerment, incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report(6), Ascendance_Haste(10), flask_of_alchemical_chaos_haste
4:22.778Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2622200.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(25), frigid_empowerment(5), icicles, icy_veins, excess_fire, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(3), unstable_power_suit_core_mastery, spymasters_report(6), Ascendance_Haste(10), flask_of_alchemical_chaos_haste
4:23.708Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(25), frigid_empowerment(5), icicles, icy_veins, excess_fire, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(4), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(6), Ascendance_Haste(10), flask_of_alchemical_chaos_haste
4:24.636Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction, brain_freeze, cold_front(25), frigid_empowerment(5), icicles(2), icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report(7), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:25.578Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(25), frigid_empowerment(5), icicles(3), icy_veins, fire_mastery(6), frost_mastery(6), frostfire_empowerment, incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report(7), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:26.520Qflurry
[st_aoebuild]
Fluffy_Pillow 2622100.0/2625000 100% mana bone_chilling(10), chain_reaction(2), brain_freeze, cold_front(26), frigid_empowerment(5), icicles(4), icy_veins, excess_fire, excess_frost, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report(7), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:27.461Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(2), cold_front(27), frigid_empowerment(5), icicles(5), icy_veins, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_mastery, spymasters_report(7), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:29.184Uray_of_frost
[st_aoebuild]
Fluffy_Pillow 2600150.0/2625000 99% mana bone_chilling(10), chain_reaction(2), cold_front(27), excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_mastery, spymasters_report(7), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:33.168Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(2), cold_front(27), fingers_of_frost(2), excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(4), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(8), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:34.296Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(3), brain_freeze, cold_front(27), fingers_of_frost, icicles, fire_mastery(6), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report(8), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:35.426Rfrozen_orb
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(4), brain_freeze, cold_front(27), icicles(2), fire_mastery(6), frost_mastery(6), incanters_flow(5), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(8), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:36.558Sshifting_power
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(4), brain_freeze, cold_front(27), fingers_of_frost, freezing_rain, icicles(2), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(4), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(9), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:39.913Juse_item_spymasters_web
[cds]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(4), brain_freeze, cold_front(27), fingers_of_frost, freezing_rain, icicles(2), permafrost_lances, incanters_flow, overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(9), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:39.913Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(4), brain_freeze, cold_front(27), fingers_of_frost, freezing_rain, icicles(2), permafrost_lances, incanters_flow, overflowing_energy, unstable_power_suit_core_mastery, spymasters_web(9), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:41.110Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(27), freezing_rain, icicles(3), permafrost_lances, fire_mastery, frost_mastery(2), incanters_flow(2), overflowing_energy, unstable_power_suit_core_mastery, spymasters_web(9), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:42.533Qflurry
[st_aoebuild]
Fluffy_Pillow 2575250.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, cold_front(27), freezing_rain, icicles(4), permafrost_lances, fire_mastery, frost_mastery(2), incanters_flow(3), unstable_power_suit_core_mastery, spymasters_report, spymasters_web(9), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:43.719Pcomet_storm
[st_aoebuild]
Fluffy_Pillow 2609550.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, fingers_of_frost(2), freezing_rain, icicles(5), permafrost_lances, fire_mastery(4), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report, spymasters_web(9), Ascension_Crit(10), flask_of_alchemical_chaos_haste
4:44.870Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, fingers_of_frost(2), freezing_rain, icicles(5), permafrost_lances, fire_mastery(5), frost_mastery(6), incanters_flow(5), unstable_power_suit_core_mastery, spymasters_report, spymasters_web(9), Ascension_Crit(10), flask_of_alchemical_chaos_crit
4:47.080Vice_lance
[st_aoebuild]
Fluffy_Pillow 2600250.0/2625000 99% mana bone_chilling(10), chain_reaction(5), brain_freeze, fingers_of_frost(2), freezing_rain, permafrost_lances, excess_fire, fire_mastery(6), frost_mastery(6), incanters_flow(3), unstable_power_suit_core_mastery, spymasters_report, spymasters_web(9), Ascension_Crit(10), flask_of_alchemical_chaos_crit
4:48.275Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, fingers_of_frost(2), icicles, permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(2), unstable_power_suit_core_mastery, spymasters_report, spymasters_web(9), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:49.455Vice_lance
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, fingers_of_frost, icicles(2), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow, unstable_power_suit_core_mastery, spymasters_report(2), spymasters_web(9), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:50.635Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), brain_freeze, icicles(3), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow, overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(2), spymasters_web(9), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:52.050Qflurry
[st_aoebuild]
Fluffy_Pillow 2575250.0/2625000 98% mana bone_chilling(10), chain_reaction(5), brain_freeze, icicles(4), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(3), overflowing_energy, unstable_power_suit_core_mastery, spymasters_report(2), spymasters_web(9), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:53.230Tglacial_spike
[st_aoebuild]
Fluffy_Pillow 2609250.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(2), icicles(5), permafrost_lances, fire_mastery(6), frost_mastery(6), incanters_flow(4), unstable_power_suit_core_mastery, spymasters_report(2), spymasters_web(9), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:55.389Vice_lance
[st_aoebuild]
Fluffy_Pillow 2600200.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(2), fingers_of_frost, permafrost_lances, fire_mastery, frost_mastery(2), incanters_flow(5), unstable_power_suit_core_haste, spymasters_report(3), spymasters_web(9), Ascendance_Haste(10), flask_of_alchemical_chaos_crit
4:56.603Wfrostfire_bolt
[st_aoebuild]
Fluffy_Pillow 2625000.0/2625000 100% mana bone_chilling(10), chain_reaction(5), cold_front(2), icicles, permafrost_lances, fire_mastery(2), frost_mastery(4), incanters_flow(4), unstable_power_suit_core_haste, spymasters_report(3), spymasters_web(9), Ascendance_Vers(10), flask_of_alchemical_chaos_crit
4:58.065Qflurry
[st_aoebuild]
Fluffy_Pillow 2575200.0/2625000 98% mana bone_chilling(10), chain_reaction(5), cold_front(2), icicles(2), fire_mastery(2), frost_mastery(4), incanters_flow(2), unstable_power_suit_core_haste, spymasters_report(3), spymasters_web(9), Ascendance_Vers(10), flask_of_alchemical_chaos_crit
4:59.283Vice_lance
[st_aoebuild]
Fluffy_Pillow 2611100.0/2625000 99% mana bone_chilling(10), chain_reaction(5), cold_front(4), icicles(3), fire_mastery(4), frost_mastery(6), incanters_flow, unstable_power_suit_core_haste, spymasters_report(3), spymasters_web(9), Ascendance_Vers(10), flask_of_alchemical_chaos_crit

Stats

Level Bonus (80) Race Bonus (gnome) Raid-Buffed Unbuffed Gear Amount
Strength7765-3776277620
Agility12000112001120010
Stamina86452-1238784227414140963
Intellect176473579885506334791 (1526)
Spirit00000
Health477568045482800
Mana262500026250000
Spell Power57988550630
Crit21.07%19.70%8891
Haste18.75%19.29%4763
Versatility9.47%6.47%5046
Mana Regen50000500000
Mastery31.39%24.43%11503
Armor127101271012710
Run Speed700
Leech0.39%0.39%402

Gear

Source Slot Average Item Level: 601.00
Local Head Hood of Violet Rebirth
ilevel: 593, stats: { 1,488 Armor, +2,472 Int, +12,583 Sta, +1,099 Crit, +503 Mastery, +687 Avoidance }
Local Neck Silken Advisor's Favor
ilevel: 606, stats: { +8,601 Sta, +3,919 Vers, +811 Mastery, +811 Avoidance }
Local Shoulders Beacons of Violet Rebirth
ilevel: 610, stats: { 1,495 Armor, +2,172 Int, +12,149 Sta, +899 Crit, +419 Haste }
Local Shirt Red Swashbuckler's Shirt
ilevel: 1
Local Chest Runecoat of Violet Rebirth
ilevel: 600, stats: { 2,058 Armor, +2,638 Int, +14,000 Sta, +566 Haste, +1,101 Mastery }
Local Waist Sash of the Burning Heart
ilevel: 590, stats: { 1,099 Armor, +1,803 Int, +9,018 Sta, +658 Crit, +523 Vers }
Local Legs Coattails of Violet Rebirth
ilevel: 597, stats: { 1,772 Armor, +2,566 Int, +13,369 Sta, +561 Crit, +1,078 Haste }
Local Feet Mineral-Sparkled Sandals
ilevel: 600, stats: { 1,286 Armor, +1,979 Int, +10,500 Sta, +652 Crit, +598 Haste }
Local Wrists Alighted Cuffs of the Peerless (alighted_cuffs)
ilevel: 600, stats: { 1,029 Armor, +1,484 Int, +7,875 Sta, +402 Leech, +603 Crit, +335 Mastery }
Local Hands Cave Topographer's Handwraps
ilevel: 580, stats: { 1,045 Armor, +1,642 Int, +7,675 Sta, +509 Crit, +604 Vers }
Local Finger1 Gem-Studded Signet of the Peerless (gemstudded_signet)
ilevel: 606, stats: { +8,601 Sta, +1,622 Crit, +3,108 Mastery }
Local Finger2 Bone-Carved Circlet
ilevel: 616, stats: { +9,938 Sta, +1,620 Crit, +3,535 Mastery }
Local Trinket1 Unstable Power Suit Core
ilevel: 600, stats: { +2,508 Int }
item effects: { equip: Unstable Power Suit Core }
Local Trinket2 Spymaster's Web
ilevel: 600, stats: { +1,190 Mastery }
item effects: { equip: Spymaster's Web, use: Spymaster's Web }
Local Back Cloak of the Illidari Council
ilevel: 603, stats: { 1,438 Armor, +8,238 Sta, +436 Crit, +517 Haste, +1,526 StrAgiInt }
Local Main Hand Vagabond's Bounding Baton
ilevel: 619, weapon: { 3,626 - 4,908, 3.6 }, stats: { +3,149 Int, +10,852 Int, +18,416 Sta, +920 Mastery, +920 Haste }, enchant: councils_guile_2, temporary_enchant: Algari Mana Oil
item effects: { equip: Ascendance }
Local Tabard Stormwind Tabard
ilevel: 35

Profile

mage="Swissly"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/swissly"
spec=frost
level=80
race=gnome
role=spell
position=back
talents=CAEAjd9IgsSkCmGQ8vOmZtyV7YGYzCmZmxsYYMzoxYegxMzMmZMjZYmZmxMzMzMzMDmZWmpZmtZBCAAaBAAAAAAAAAAAAAAA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_midnight_masquerade
augmentation=crystallized
temporary_enchant=main_hand:algari_mana_oil_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=st_aoebuild,value=talent.splinterstorm&!(talent.cold_front&talent.slick_ice&talent.deaths_chill&talent.frozen_touch)|talent.frostfire_bolt&!(talent.deep_shatter&talent.slick_ice&talent.deaths_chill)
actions.precombat+=/variable,name=st_ff,value=talent.frostfire_bolt
actions.precombat+=/blizzard,if=active_enemies>=2&talent.ice_caller&!talent.fractured_frost|active_enemies>=4
actions.precombat+=/frostbolt,if=active_enemies<=3

# Executed every time the actor is available.
actions=counterspell
actions+=/call_action_list,name=cds
actions+=/run_action_list,name=aoe_ff,if=talent.frostfire_bolt&active_enemies>=4
actions+=/run_action_list,name=aoe_ss,if=talent.splinterstorm&active_enemies>=3
actions+=/run_action_list,name=cleave_ff,if=talent.frostfire_bolt&active_enemies>=2&active_enemies<=3
actions+=/run_action_list,name=cleave_ss,if=talent.splinterstorm&active_enemies=2
actions+=/run_action_list,name=st_aoebuild,if=variable.st_aoebuild
actions+=/run_action_list,name=st_ff,if=variable.st_ff
actions+=/run_action_list,name=st_ss

actions.aoe_ff=cone_of_cold,if=talent.coldest_snap&cooldown.frozen_orb.remains>4&(prev_gcd.1.comet_storm|prev_gcd.1.frozen_orb&!talent.comet_storm|cooldown.comet_storm.remains>15&!talent.frostfire_bolt)
actions.aoe_ff+=/frozen_orb,if=cooldown_react&((!prev_gcd.1.cone_of_cold|!talent.isothermic_core)&(!prev_gcd.1.glacial_spike|!freezable))
actions.aoe_ff+=/blizzard,if=!prev_gcd.1.glacial_spike|!freezable
actions.aoe_ff+=/frostbolt,if=buff.icy_veins.up&(buff.deaths_chill.stack<9|buff.deaths_chill.stack=9&!action.frostbolt.in_flight)&buff.icy_veins.remains>8&talent.deaths_chill
actions.aoe_ff+=/comet_storm,if=!prev_gcd.1.glacial_spike&(!talent.coldest_snap|cooldown.cone_of_cold.ready&cooldown.frozen_orb.remains>20|(cooldown.cone_of_cold.remains>10))
actions.aoe_ff+=/freeze,if=freezable&debuff.frozen.down&(!talent.glacial_spike|prev_gcd.1.glacial_spike)
actions.aoe_ff+=/ice_nova,if=freezable&!prev_off_gcd.freeze&(prev_gcd.1.glacial_spike)
actions.aoe_ff+=/frost_nova,if=freezable&!prev_off_gcd.freeze&(prev_gcd.1.glacial_spike&!remaining_winters_chill)
actions.aoe_ff+=/shifting_power,if=cooldown.comet_storm.remains>14
actions.aoe_ff+=/frostbolt,if=buff.frostfire_empowerment.react&!buff.excess_frost.react&!buff.excess_fire.react
actions.aoe_ff+=/glacial_spike,if=buff.icicles.react=5&(freezable|(action.flurry.cooldown_react|remaining_winters_chill))
actions.aoe_ff+=/flurry,if=cooldown_react&!remaining_winters_chill&(buff.brain_freeze.react&!talent.excess_frost|buff.excess_frost.react|prev_gcd.1.glacial_spike)
actions.aoe_ff+=/ice_lance,if=buff.fingers_of_frost.react|debuff.frozen.remains>travel_time|remaining_winters_chill
actions.aoe_ff+=/flurry,if=cooldown_react&!remaining_winters_chill
actions.aoe_ff+=/ice_nova,if=active_enemies>=4&(!talent.glacial_spike|!freezable)&!talent.frostfire_bolt
actions.aoe_ff+=/cone_of_cold,if=!talent.coldest_snap&active_enemies>=7
actions.aoe_ff+=/frostbolt
actions.aoe_ff+=/call_action_list,name=movement

actions.aoe_ss=cone_of_cold,if=talent.coldest_snap&!action.frozen_orb.cooldown_react&(prev_gcd.1.comet_storm|prev_gcd.1.frozen_orb&cooldown.comet_storm.remains>5)&(!talent.deaths_chill|buff.icy_veins.remains<8|buff.deaths_chill.stack>=12)
actions.aoe_ss+=/freeze,if=freezable&debuff.frozen.down&prev_gcd.1.glacial_spike
actions.aoe_ss+=/flurry,if=cooldown_react&remaining_winters_chill=0&prev_gcd.1.glacial_spike
actions.aoe_ss+=/ice_nova,if=active_enemies<5&freezable&prev_gcd.1.glacial_spike&remaining_winters_chill=0&debuff.winters_chill.down|active_enemies>=5&time-action.cone_of_cold.last_used<6&time-action.cone_of_cold.last_used>6-gcd.max
actions.aoe_ss+=/frozen_orb,if=cooldown_react
actions.aoe_ss+=/frostbolt,if=talent.deaths_chill&buff.icy_veins.remains>8&(buff.deaths_chill.stack<9|buff.deaths_chill.stack=9&!action.frostbolt.in_flight)
actions.aoe_ss+=/comet_storm
actions.aoe_ss+=/blizzard
actions.aoe_ss+=/shifting_power,if=cooldown.icy_veins.remains>10&(fight_remains+10>cooldown.icy_veins.remains)
actions.aoe_ss+=/glacial_spike,if=buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill|active_enemies<5&freezable&cooldown.ice_nova.ready&!buff.fingers_of_frost.react)
actions.aoe_ss+=/ice_lance,if=buff.fingers_of_frost.react&!prev_gcd.1.glacial_spike|remaining_winters_chill
actions.aoe_ss+=/flurry,if=cooldown_react&remaining_winters_chill=0
actions.aoe_ss+=/frostbolt
actions.aoe_ss+=/call_action_list,name=movement

actions.cds=use_item,name=imperfect_ascendancy_serum,if=buff.icy_veins.remains>19|fight_remains<25
actions.cds+=/use_item,name=treacherous_transmitter,if=equipped.spymasters_web&(fight_remains<50|cooldown.icy_veins.remains<12)|!equipped.spymasters_web&(fight_remains<30|prev_off_gcd.icy_veins)
actions.cds+=/do_treacherous_transmitter_task,if=fight_remains<18|(buff.cryptic_instructions.remains<?buff.realigning_nexus_convergence_divergence.remains<?buff.errant_manaforge_emission.remains)<(action.shifting_power.execute_time+1*talent.ray_of_frost)
actions.cds+=/use_item,name=burst_of_knowledge,if=buff.icy_veins.remains<21|fight_remains<25
actions.cds+=/use_item,name=spymasters_web,if=fight_remains<22|buff.icy_veins.remains<19&(fight_remains<105|buff.spymasters_report.stack>=32)&(buff.icy_veins.remains>15|equipped.treacherous_transmitter&buff.icy_veins.remains>9)
actions.cds+=/potion,if=fight_remains<35|buff.icy_veins.remains>10&(fight_remains>315|cooldown.icy_veins.remains+12>fight_remains)
actions.cds+=/flurry,if=time=0&active_enemies<=2
actions.cds+=/icy_veins,if=buff.icy_veins.remains<gcd.max*2
actions.cds+=/use_items
actions.cds+=/invoke_external_buff,name=power_infusion,if=buff.power_infusion.down
actions.cds+=/invoke_external_buff,name=blessing_of_summer,if=buff.blessing_of_summer.down
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/lights_judgment
actions.cds+=/fireblood
actions.cds+=/ancestral_call

actions.cleave_ff=comet_storm,if=prev_gcd.1.flurry|prev_gcd.1.cone_of_cold
actions.cleave_ff+=/frostbolt,if=buff.icy_veins.up&(buff.deaths_chill.stack<8|buff.deaths_chill.stack=8&!action.frostbolt.in_flight)&buff.icy_veins.remains>8&talent.deaths_chill
actions.cleave_ff+=/flurry,target_if=min:debuff.winters_chill.stack,if=cooldown_react&(((prev_gcd.1.frostbolt|prev_gcd.1.frostfire_bolt)&buff.icicles.react>=3)|prev_gcd.1.glacial_spike|(buff.icicles.react>=3&buff.icicles.react<5&charges_fractional=2))
actions.cleave_ff+=/ray_of_frost,target_if=max:debuff.winters_chill.stack,if=remaining_winters_chill=1
actions.cleave_ff+=/frozen_orb,if=buff.fingers_of_frost.react<2&(!talent.ray_of_frost|cooldown.ray_of_frost.remains)
actions.cleave_ff+=/cone_of_cold,if=talent.coldest_snap&cooldown.comet_storm.remains>10&cooldown.frozen_orb.remains>10&remaining_winters_chill=0&active_enemies>=3
actions.cleave_ff+=/glacial_spike,if=buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill&buff.icy_veins.down)
actions.cleave_ff+=/shifting_power,if=cooldown.frozen_orb.remains>10&(!talent.comet_storm|cooldown.comet_storm.remains>10)&(!talent.ray_of_frost|cooldown.ray_of_frost.remains>10)|cooldown.icy_veins.remains<20
actions.cleave_ff+=/glacial_spike,if=buff.icicles.react=5
actions.cleave_ff+=/frostfire_bolt,target_if=max:debuff.winters_chill.stack,if=buff.frostfire_empowerment.up&remaining_winters_chill
actions.cleave_ff+=/ice_lance,target_if=max:debuff.winters_chill.stack,if=buff.fingers_of_frost.react&!prev_gcd.1.glacial_spike|remaining_winters_chill&buff.icy_veins.down
actions.cleave_ff+=/frostbolt
actions.cleave_ff+=/call_action_list,name=movement

actions.cleave_ss=comet_storm,if=prev_gcd.1.flurry&(buff.icy_veins.down)
actions.cleave_ss+=/flurry,if=cooldown_react&remaining_winters_chill=0&debuff.winters_chill.down&(prev_gcd.1.frostbolt|prev_gcd.1.glacial_spike)
actions.cleave_ss+=/flurry,target_if=min:debuff.winters_chill.stack,if=cooldown_react&prev_gcd.1.glacial_spike
actions.cleave_ss+=/freeze,if=freezable&debuff.frozen.down&(!talent.glacial_spike|prev_gcd.1.glacial_spike)
actions.cleave_ss+=/frozen_orb,if=cooldown_react
actions.cleave_ss+=/shifting_power,if=cooldown.icy_veins.remains>10&cooldown.flurry.remains&(fight_remains>cooldown.icy_veins.remains-6)
actions.cleave_ss+=/glacial_spike,if=buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill|freezable&cooldown.freeze.ready)
actions.cleave_ss+=/ray_of_frost,if=remaining_winters_chill&buff.icy_veins.down
actions.cleave_ss+=/frostbolt,if=talent.deaths_chill&(!talent.freezing_rain&buff.icy_veins.remains>8&buff.deaths_chill.stack<=13|talent.freezing_rain&buff.icy_veins.remains>22)
actions.cleave_ss+=/ice_lance,if=buff.fingers_of_frost.react&!prev_gcd.1.glacial_spike
actions.cleave_ss+=/frostbolt
actions.cleave_ss+=/call_action_list,name=movement

actions.movement=any_blink,if=movement.distance>10
actions.movement+=/ice_floes,if=buff.ice_floes.down
actions.movement+=/ice_nova
actions.movement+=/cone_of_cold,if=!talent.coldest_snap&active_enemies>=2
actions.movement+=/arcane_explosion,if=mana.pct>30&active_enemies>=2
actions.movement+=/fire_blast
actions.movement+=/ice_lance

actions.st_aoebuild=comet_storm,if=prev_gcd.1.flurry&(buff.icy_veins.down|talent.frostfire_bolt)
actions.st_aoebuild+=/flurry,if=cooldown_react&(buff.icicles.react<5|talent.splinterstorm)&(remaining_winters_chill=0&debuff.winters_chill.down&(prev_gcd.1.frostbolt|prev_gcd.1.frostfire_bolt|prev_gcd.1.glacial_spike)|buff.excess_frost.react)
actions.st_aoebuild+=/frozen_orb,if=cooldown_react&(talent.splinterstorm|(!talent.ray_of_frost|buff.fingers_of_frost.down&cooldown.ray_of_frost.remains&buff.icicles.react<5))
actions.st_aoebuild+=/shifting_power,if=(cooldown.icy_veins.remains>10&cooldown.flurry.remains&(fight_remains+10>cooldown.icy_veins.remains)|talent.frostfire_bolt)&(talent.splinterstorm|(buff.icy_veins.down|!talent.deaths_chill)&cooldown.frozen_orb.remains>10&(!talent.comet_storm|cooldown.comet_storm.remains>10)&(!talent.ray_of_frost|cooldown.ray_of_frost.remains>10)&buff.icicles.react<5)
actions.st_aoebuild+=/glacial_spike,if=buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill)
actions.st_aoebuild+=/ray_of_frost,if=remaining_winters_chill&talent.frostfire_bolt|remaining_winters_chill=1
actions.st_aoebuild+=/ice_lance,if=buff.fingers_of_frost.react&!prev_gcd.1.glacial_spike|remaining_winters_chill
actions.st_aoebuild+=/frostbolt
actions.st_aoebuild+=/call_action_list,name=movement

actions.st_ff=comet_storm,if=prev_gcd.1.flurry|prev_gcd.1.cone_of_cold
actions.st_ff+=/flurry,if=cooldown_react&buff.icicles.react<5&remaining_winters_chill=0&(debuff.winters_chill.down|buff.brain_freeze.react|buff.excess_frost.react)
actions.st_ff+=/cone_of_cold,if=talent.coldest_snap&prev_gcd.1.comet_storm&active_enemies>=3
actions.st_ff+=/glacial_spike,if=buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill)
actions.st_ff+=/ray_of_frost,if=remaining_winters_chill&(buff.icy_veins.remains<14|buff.spymasters_web.up)
actions.st_ff+=/frozen_orb
actions.st_ff+=/shifting_power,if=(buff.icy_veins.down|!talent.deaths_chill)&cooldown.frozen_orb.remains>10&(!talent.comet_storm|cooldown.comet_storm.remains>10)&(!talent.ray_of_frost|cooldown.ray_of_frost.remains>10)
actions.st_ff+=/ice_lance,if=buff.excess_fire.react&remaining_winters_chill=2|remaining_winters_chill=0&debuff.winters_chill.down&buff.fingers_of_frost.react
actions.st_ff+=/frostbolt
actions.st_ff+=/call_action_list,name=movement

actions.st_ss=comet_storm,if=prev_gcd.1.flurry&buff.icy_veins.down
actions.st_ss+=/flurry,if=cooldown_react&remaining_winters_chill=0&debuff.winters_chill.down&(prev_gcd.1.frostbolt|prev_gcd.1.glacial_spike)
actions.st_ss+=/frozen_orb,if=cooldown_react&(cooldown.icy_veins.remains>22|buff.icy_veins.up)
actions.st_ss+=/shifting_power,if=cooldown.icy_veins.remains>10&cooldown.flurry.remains&(fight_remains+10>cooldown.icy_veins.remains)
actions.st_ss+=/glacial_spike,if=buff.icicles.react=5&(action.flurry.cooldown_react|remaining_winters_chill)
actions.st_ss+=/ray_of_frost,if=remaining_winters_chill&buff.icy_veins.down
actions.st_ss+=/frostbolt,if=buff.icy_veins.remains>8&buff.deaths_chill.stack<8
actions.st_ss+=/ice_lance,if=remaining_winters_chill=2|remaining_winters_chill&action.flurry.cooldown_react
actions.st_ss+=/frostbolt
actions.st_ss+=/call_action_list,name=movement

head=hood_of_violet_rebirth,id=212092,bonus_id=10876/40/10371/10278/1494/10255
neck=silken_advisors_favor,id=225575,bonus_id=40/10395/10392/10354/10270/1507/10255
shoulders=beacons_of_violet_rebirth,id=212090,bonus_id=10265/10369/1511
back=cloak_of_the_illidari_council,id=150483,bonus_id=10377/7756/10383/10271/10038/10255
chest=runecoat_of_violet_rebirth,id=212095,bonus_id=10373/10272/1501/10255
shirt=red_swashbucklers_shirt,id=6796
tabard=stormwind_tabard,id=118365
wrists=alighted_cuffs,id=224673,bonus_id=41/10876/1684/10377/10276/1672/10255
hands=cave_topographers_handwraps,id=211010,bonus_id=10294/43/11215/10375/3159/10254
waist=sash_of_the_burning_heart,id=231411,bonus_id=11215/10377/6652/10877/12092/10383/10279/1478/10255
legs=coattails_of_violet_rebirth,id=212091,bonus_id=6652/10353/8096/10370/10277/1498/10255
feet=mineralsparkled_sandals,id=223300,bonus_id=10377/10272/1672/10255
finger1=gemstudded_signet,id=224661,bonus_id=6652/10394/10392/1754/10274/3135/10255
finger2=bonecarved_circlet,id=219187,bonus_id=10263/6652/10395/10392/3195/10255
trinket1=unstable_power_suit_core,id=225668,bonus_id=6652/11215/10276/1672/10255
trinket2=spymasters_web,id=220202,bonus_id=6652/10353/10276/1501/10255
main_hand=vagabonds_bounding_baton,id=222568,bonus_id=10421/9633/8902/9627/10222/11300/8960/8793/11143,enchant=councils_guile_2,crafted_stats=mastery/crit

# Gear Summary
# gear_ilvl=601.33
# gear_stamina=140963
# gear_intellect=34791
# gear_crit_rating=8891
# gear_haste_rating=4330
# gear_mastery_rating=11503
# gear_versatility_rating=5046
# gear_leech_rating=402
# gear_avoidance_rating=1498
# gear_armor=12710
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 61164249
Max Event Queue: 149
Sim Seconds: 3006899
CPU Seconds: 60.7688
Physical Seconds: 22.3091
Speed Up: 49481

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Swissly Swissly augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Swissly Swissly cold_front_frozen_orb 84714 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 98.29sec 0 300.00sec
Swissly Swissly cold_front_frozen_orb_bolt 84721 2078973 6930 12.61 20051 42361 63.1 63.1 57.9% 0.0% 0.0% 0.0% 2.80sec 2078973 300.00sec
Swissly Swissly comet_storm 153595 0 0 0.00 0 0 14.0 0.0 0.0% 0.0% 0.0% 0.0% 22.06sec 0 300.00sec
Swissly Swissly comet_storm_projectile 153596 13189994 43967 19.49 72847 150788 97.4 97.4 80.2% 0.0% 0.0% 0.0% 2.97sec 13189994 300.00sec
Swissly Swissly excess_ice_nova 157997 4995590 16652 4.73 152700 323274 23.6 23.6 34.4% 0.0% 0.0% 0.0% 12.61sec 4995590 300.00sec
Swissly Swissly flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Swissly Swissly flurry 44614 0 0 0.00 0 0 47.6 0.0 0.0% 0.0% 0.0% 0.0% 6.38sec 0 300.00sec
Swissly Swissly flurry_bolt 228354 21206619 70689 28.49 85221 179644 142.5 142.5 67.4% 0.0% 0.0% 0.0% 2.09sec 21206619 300.00sec
Swissly Swissly flurry_icicle 148022 271490 905 0.52 73352 171439 2.6 2.6 31.0% 0.0% 0.0% 0.0% 70.81sec 271490 300.00sec
Swissly Swissly glacial_assault 379029 2051671 6839 7.10 29573 62683 35.5 35.5 85.2% 0.0% 0.0% 0.0% 8.23sec 2051671 300.00sec
Swissly Swissly food 457285 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Swissly Swissly frostfire_bolt 431044 15102325 50341 9.05 174230 440396 44.3 45.2 60.0% 0.0% 0.0% 0.0% 6.47sec 20066128 300.00sec
Swissly Swissly frostfire_bolt ticks -431044 4963803 16546 74.71 7724 17318 44.3 373.5 58.0% 0.0% 0.0% 0.0% 6.47sec 20066128 300.00sec
Swissly Swissly frostbolt_icicle 148022 233206 777 0.46 72357 167892 2.3 2.3 30.5% 0.0% 0.0% 0.0% 48.50sec 233206 300.00sec
Swissly Swissly frostfire_burst 470596 4576826 15256 4.51 110629 238649 22.5 22.5 72.2% 0.0% 0.0% 0.0% 13.21sec 4576826 300.00sec
Swissly Swissly frostfire_empowerment 431186 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 21.97sec 0 300.00sec
Swissly Swissly frostfire_infusion 431171 14111504 47038 42.16 40125 85266 211.0 210.8 59.4% 0.0% 0.0% 0.0% 1.41sec 14111504 300.00sec
Swissly Swissly frozen_orb 84714 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 52.94sec 0 300.00sec
Swissly Swissly frozen_orb_bolt 84721 5242933 17476 28.09 22707 48741 140.5 140.5 56.1% 0.0% 0.0% 0.0% 1.95sec 5242933 300.00sec
Swissly Swissly glacial_spike 199786 88382186 294607 6.65 1223851 2863250 33.3 33.2 87.6% 0.0% 0.0% 0.0% 8.88sec 88382186 300.00sec
Swissly Swissly ice_lance 30455 55533604 185112 17.16 328144 702491 85.9 85.8 85.2% 0.0% 0.0% 0.0% 3.43sec 55533604 300.00sec
Swissly Swissly ice_lance_icicle 148022 412555 1375 0.82 72064 167703 4.1 4.1 29.7% 0.0% 0.0% 0.0% 41.21sec 412555 300.00sec
Swissly Swissly frigid_pulse 460623 2199556 7332 10.18 26746 56936 50.9 50.9 54.5% 0.0% 0.0% 0.0% 5.75sec 2199556 300.00sec
Swissly Swissly icy_veins 12472 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 101.83sec 0 300.00sec
Swissly Swissly isothermic_meteor 153561 0 0 0.00 0 0 14.0 0.0 0.0% 0.0% 0.0% 0.0% 22.06sec 0 300.00sec
Swissly Swissly isothermic_meteor_burn ticks -155158 1355635 4519 21.93 7666 16175 109.7 109.7 55.2% 0.0% 0.0% 0.0% 2.67sec 1355635 300.00sec
Swissly Swissly isothermic_meteor_impact 438607 8271754 27573 2.78 305292 646776 13.9 13.9 84.8% 0.0% 0.0% 0.0% 22.08sec 8271754 300.00sec
Swissly Swissly potion 431932 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 303.93sec 0 300.00sec
Swissly Swissly ray_of_frost ticks -205021 21291062 70970 6.12 371388 773921 6.2 30.6 80.7% 0.0% 0.0% 0.0% 52.32sec 21291062 300.00sec
Swissly Swissly shifting_power ticks -382440 1863304 6211 3.75 53674 115335 4.7 18.8 74.0% 0.0% 0.0% 0.0% 67.84sec 1863304 300.00sec
Swissly Swissly spymasters_web 444959 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 45.96sec 0 300.00sec
Swissly Swissly_water_elemental water_jet ticks -135029 1996788 6656 9.05 35752 71806 9.5 45.3 23.2% 0.0% 0.0% 0.0% 32.34sec 1996788 157.18sec
Swissly Swissly_water_elemental waterbolt 31707 4652334 29599 32.75 43891 88054 85.9 85.8 23.4% 0.0% 0.0% 0.0% 3.28sec 4652334 157.18sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health892,229.50.00.00%0.0100.0%

Scale Factors for other metrics

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Numbing Blast19.6113.315.5s2.2s10.0s65.61%0.00%113.3 (113.3)19.0

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_numbing_blast
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 74.5s
  • trigger_min/max:0.0s / 40.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.4s
  • uptime_min/max:45.65% / 85.41%

Stack Uptimes

  • numbing_blast_1:65.61%

Spelldata

  • id:417490
  • name:Numbing Blast
  • tooltip:Damage taken from {$@=}auracaster's spells increased by {$s1=6}%
  • description:{$@spelldesc378947=Your Comet Storm now increases the damage enemies take from you by {$417490s1=6}% for {$417490d=6 seconds} and Flurry has a {$s1=25}% chance each hit to call down an icy comet, crashing into your target and nearby enemies for {$379029s1=0} Frost damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Winter's Chill45.197.46.7s2.1s3.5s52.79%0.00%97.4 (160.6)3.5

Buff Details

  • buff initial source:Swissly
  • cooldown name:buff_winters_chill
  • max_stacks:2
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 29.0s
  • trigger_min/max:0.1s / 28.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.2s
  • uptime_min/max:44.15% / 60.74%

Stack Uptimes

  • winters_chill_1:19.25%
  • winters_chill_2:33.54%

Spelldata

  • id:228358
  • name:Winter's Chill
  • tooltip:Taking damage from the Mage's spells as if frozen.
  • description:{$@spelldesc44614=Unleash a flurry of ice, striking the target {$s1=3} times for a total of {$=}{{$228354s2=0}*{$m1=3}} Frost damage. Each hit reduces the target's movement speed by {$228354s1=70}% for {$228354d=1 second}{$?a378947=true}[, has a {$378947s1=25}% chance to activate Glacial Assault,][] and applies Winter's Chill to the target. Winter's Chill causes the target to take damage from your spells as if it were frozen.}
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 913732.33
Minimum 819046.12
Maximum 1009578.97
Spread ( max - min ) 190532.84
Range [ ( max - min ) / 2 * 100% ] 10.43%
Standard Deviation 25035.5331
5th Percentile 873323.24
95th Percentile 955125.75
( 95th Percentile - 5th Percentile ) 81802.51
Mean Distribution
Standard Deviation 250.3678
95.00% Confidence Interval ( 913241.62 - 914223.04 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2884
0.1 Scale Factor Error with Delta=300 5350537
0.05 Scale Factor Error with Delta=300 21402148
0.01 Scale Factor Error with Delta=300 535053679
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health02161435250
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.