SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.7.58238 Live (hotfix 2024-12-23/58238, git build 293e95c8fe)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Raid Summary

Raid Event List
0 heal,name=tank_heal,amount=1500000,cooldown=5.0,duration=0,player_if=role.tank

DPS Scale Factors (dps increase per unit stat)

Profile Str Sta Crit Haste Mastery Vers Wdps wowhead
Stormyo 8.08 -0.06 5.31 7.07 4.25 4.35 42.78 wowhead

Stormyo : 378,599 dps, 732,083 dtps, 108,919 hps (48,765 aps)

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
378,599.2378,599.2324.8 / 0.086%64,464.6 / 17.0%-1.0
HPS HPS(e) HPS Error HPS Range HPR
60,154.360,154.3383.9 / 0.638%77,570.0 / 129.0%-1.0
APS APS Error APS Range APR
48,765.0580.5 / 1.190%25,166.0 / 51.6%-1.0
DTPS DTPS Error DTPS Range
732,082.5606.79 / 0.08%119,707 / 16.4%
Resource Out In Waiting APM Active
Mana0.00.00.00%67.9100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/stormyo
TalentCIEA5ba6OK14IUITjS1kSUVJctNjBzyYZegZMzMLbzMzYGjZMAAADAAAAAAAt1MzwgZYMjZrNAYMwAYgtBAAABYmZZZptZGLmBDAMMMG
Scale Factors for Stormyo Damage Per Second
Wdps Str Haste Crit Vers Mastery Sta
Scale Factors 42.78 8.08 7.07 5.31 4.35 4.25 -0.06
Normalized 5.29 1.00 0.88 0.66 0.54 0.53 -0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.23 0.20 0.20 0.20 0.20 0.20 0.20
Ranking
  • Wdps > Str > Haste > Crit > Vers ~= Mastery > Sta
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=8.08, Stamina=-0.06, CritRating=5.31, HasteRating=7.07, MasteryRating=4.25, Versatility=4.35, Dps=42.78 )

Scale Factors for other metrics

Scale Factors for Stormyo Priority Target Damage Per Second
Wdps Str Haste Crit Vers Mastery Sta
Scale Factors 42.78 8.08 7.07 5.31 4.35 4.25 -0.06
Normalized 5.29 1.00 0.88 0.66 0.54 0.53 -0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.23 0.20 0.20 0.20 0.20 0.20 0.20
Ranking
  • Wdps > Str > Haste > Crit > Vers ~= Mastery > Sta
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=8.08, Stamina=-0.06, CritRating=5.31, HasteRating=7.07, MasteryRating=4.25, Versatility=4.35, Dps=42.78 )
Scale Factors for Stormyo Damage Per Second (Effective)
Wdps Str Haste Crit Vers Mastery Sta
Scale Factors 42.78 8.08 7.07 5.31 4.35 4.25 -0.06
Normalized 5.29 1.00 0.88 0.66 0.54 0.53 -0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Str > Haste > Crit > Vers > Mastery > Sta
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=8.08, Stamina=-0.06, CritRating=5.31, HasteRating=7.07, MasteryRating=4.25, Versatility=4.35, Dps=42.78 )
Scale Factors for Stormyo Healing Per Second
Wdps Haste Str Mastery Vers Crit Sta
Scale Factors 6.42 1.32 1.23 0.70 0.65 0.23 0.08
Normalized 5.20 1.07 1.00 0.56 0.53 0.19 0.07
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.26 0.24 0.24 0.24 0.24 0.24 0.24
Ranking
  • Wdps > Haste ~= Str > Mastery ~= Vers > Crit ~= Sta
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=1.23, Stamina=0.08, CritRating=0.23, HasteRating=1.32, MasteryRating=0.70, Versatility=0.65, Dps=6.42 )
Scale Factors for Stormyo Healing Per Second (Effective)
Wdps Haste Str Mastery Vers Crit Sta
Scale Factors 6.42 1.32 1.23 0.70 0.65 0.23 0.08
Normalized 5.20 1.07 1.00 0.56 0.53 0.19 0.07
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Haste > Str > Mastery > Vers > Crit > Sta
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=1.23, Stamina=0.08, CritRating=0.23, HasteRating=1.32, MasteryRating=0.70, Versatility=0.65, Dps=6.42 )
Scale Factors for Stormyo Absorb Per Second
Wdps Str Haste Sta Vers Mastery Crit
Scale Factors 1.81 0.21 0.19 0.16 0.10 -0.17 -0.21
Normalized 8.73 1.00 0.90 0.78 0.47 -0.83 -1.02
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.37 0.36 0.34 0.40 0.38 0.36 0.37
Ranking
  • Wdps > Str ~= Haste ~= Sta ~= Vers ~= Mastery ~= Crit
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=0.21, Stamina=0.16, CritRating=-0.21, HasteRating=0.19, MasteryRating=-0.17, Versatility=0.10, Dps=1.81 )
Scale Factors for Healing + Absorb per second
Wdps Haste Str Vers Mastery Sta Crit
Scale Factors 8.23 1.50 1.44 0.75 0.53 0.25 0.02
Normalized 5.71 1.04 1.00 0.52 0.36 0.17 0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.46 0.41 0.43 0.45 0.43 0.47 0.44
Ranking
  • Wdps > Haste ~= Str > Vers ~= Mastery ~= Sta ~= Crit
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=1.44, Stamina=0.25, CritRating=0.02, HasteRating=1.50, MasteryRating=0.53, Versatility=0.75, Dps=8.23 )
Scale Factors for Stormyo Damage Taken Per Second
Vers Crit Mastery Str Wdps Haste Sta
Scale Factors -5.82 -5.33 -4.19 -3.91 -2.11 -0.61 -0.12
Normalized 1.49 1.36 1.07 1.00 0.54 0.16 0.03
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.37 0.38 0.37 0.37 0.37 0.37 0.37
Ranking
  • Vers > Crit > Mastery ~= Str > Wdps > Haste > Sta
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=3.91, Stamina=0.12, CritRating=5.33, HasteRating=0.61, MasteryRating=4.19, Versatility=5.82, Dps=2.11 )
Scale Factors for Stormyo Damage Taken
Vers Crit Mastery Str Wdps Haste Sta
Scale Factors -1744.15 -1602.95 -1252.70 -1175.48 -650.67 -179.09 -34.48
Normalized 1.48 1.36 1.07 1.00 0.55 0.15 0.03
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Vers > Crit > Mastery > Str > Wdps > Haste > Sta
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=1175.48, Stamina=34.48, CritRating=1602.95, HasteRating=179.09, MasteryRating=1252.70, Versatility=1744.15, Dps=650.67 )
Scale Factors for Stormyo Healing Taken Per Second
Wdps Haste Str Mastery Vers Crit Sta
Scale Factors 6.31 1.31 1.20 0.67 0.62 0.21 0.08
Normalized 5.24 1.09 1.00 0.56 0.52 0.17 0.06
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Haste > Str > Mastery > Vers > Crit > Sta
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=1.20, Stamina=0.08, CritRating=0.21, HasteRating=1.31, MasteryRating=0.67, Versatility=0.62, Dps=6.31 )
Scale Factors for Stormyo Fight Length
Vers Str Sta Crit Mastery Haste Wdps
Scale Factors 0.00 0.00 -0.00 -0.00 -0.00 -0.00 -0.00
Normalized 89.14 1.00 -0.20 -0.86 -44.09 -88.10 -88.22
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Vers > Str > Sta > Crit > Mastery > Haste > Wdps
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=0.00, Stamina=-0.00, CritRating=-0.00, HasteRating=-0.00, MasteryRating=-0.00, Versatility=0.00, Dps=-0.00 )
Scale Factors for Raid Damage Per Second
Wdps Str Haste Crit Vers Mastery Sta
Scale Factors 42.78 8.08 7.07 5.31 4.35 4.25 -0.06
Normalized 5.29 1.00 0.88 0.66 0.54 0.53 -0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.23 0.20 0.20 0.20 0.20 0.20 0.20
Ranking
  • Wdps > Str > Haste > Crit > Vers ~= Mastery > Sta
Pawn string ( Pawn: v1: "Stormyo-Protection": Class=Paladin, Spec=Protection, Strength=8.08, Stamina=-0.06, CritRating=5.31, HasteRating=7.07, MasteryRating=4.25, Versatility=4.35, Dps=42.78 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Stormyo378,599
Avenger's Shield 7,3741.9%19.514.91s113,34787,834Direct19.588,404186,244113,38625.5%

Stats Details: Avengers Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.5119.500.000.000.001.29050.00002,211,566.752,211,566.750.00%87,833.7887,833.78
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit74.46%14.5252388,404.1778,524115,43488,339.8380,75496,7141,283,8121,283,8120.00%
crit25.54%4.98015186,243.97159,578230,867185,776.020230,591927,754927,7540.00%

Action Details: Avengers Shield

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=false}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Action Priority List

    standard
    [R]:19.51
  • if_expr:!talent.lights_guidance.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Blessed Hammer 0 (33,640)0.0% (8.9%)70.84.20s142,556112,006

Stats Details: Blessed Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage70.780.000.000.000.001.27280.00000.000.000.00%112,006.13112,006.13

Action Details: Blessed Hammer

  • id:204019
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:5.000
  • cooldown hasted:true
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Spelldata

  • id:204019
  • name:Blessed Hammer
  • school:holy
  • tooltip:
  • description:Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    standard
    [J]:33.06
  • if_expr:buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3&!buff.avenging_wrath.up
    standard
    [Q]:31.28
  • if_expr:(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
    standard
    [V]:6.44

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown Duration (Category)Paladin1370265SET1.000
    Blessed Hammer (_tick) 33,6408.9%0.00.00s00Periodic141.054,375118,07071,56527.0%0.0%

Stats Details: Blessed Hammer Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00140.990.000.00000.000010,089,512.3110,089,512.310.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit73.01%102.946814354,375.4216,66174,68154,356.7449,38459,2225,597,3745,597,3740.00%
crit26.99%38.051562118,070.2733,868149,362118,133.8393,930135,1734,492,1394,492,1390.00%

Action Details: Blessed Hammer Tick

  • id:204301
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:9.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:204301
  • name:Blessed Hammer
  • school:holy
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Consecration 0 (7,077)0.0% (1.9%)14.320.85s148,528122,317

Stats Details: Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage14.270.000.000.000.001.21430.00000.000.000.00%122,317.11122,317.11

Action Details: Consecration

  • id:26573
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:4.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=false}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=true}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Action Priority List

    standard
    [S]:13.16
  • if_expr:!consecration.up
    standard
    [X]:0.12

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    Consecration (_tick) 7,0771.9%0.00.00s00Periodic233.57,05714,9129,08025.8%0.0%

Stats Details: Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00233.480.000.00000.00002,120,000.182,120,000.180.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit74.25%173.35772647,056.966,0509,1927,054.396,6907,4851,223,3441,223,3440.00%
crit25.75%60.132310614,911.7212,30318,38314,903.2713,67216,011896,657896,6570.00%

Action Details: Consecration Tick

  • id:81297
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Divine Toll 0 (8,343)0.0% (2.2%)5.461.07s464,017367,053

Stats Details: Divine Toll

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.390.000.000.000.001.26430.00000.000.000.00%367,052.74367,052.74

Action Details: Divine Toll

  • id:375576
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:375576
  • name:Divine Toll
  • school:holy
  • tooltip:
  • description:Instantly cast {$?a137029=false}[Holy Shock]?a137028[Avenger's Shield]?a137027[Judgment][Holy Shock, Avenger's Shield, or Judgment] on up to {$s1=5} targets within {$=}A2 yds.{$?=}c3[ Divine Toll's Judgment deals {$326011s1=100}% increased damage.][]{$?=}c2[ Generates {$s5=1} Holy Power per target hit.][]

Action Priority List

    standard
    [M]:5.39
  • if_expr:(!raid_event.adds.exists|raid_event.adds.in>10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Global CooldownPaladin1370268SET1.000
    Avenger's Shield (_dt) 2,1250.6%5.461.07s117,9010Direct5.490,050189,870117,97328.0%

Stats Details: Avengers Shield Dt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.395.380.000.000.000.00000.0000635,031.50635,031.500.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.04%3.880690,049.7177,254108,25189,738.640108,251349,255349,2550.00%
crit27.96%1.5106189,870.29159,578216,503159,278.270216,503285,776285,7760.00%

Action Details: Avengers Shield Dt

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=false}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    Avenger's Shield (_dr) 6,2181.6%15.718.59s119,0710Direct15.690,533192,140119,14228.2%

Stats Details: Avengers Shield Dr

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.6615.650.000.000.000.00000.00001,864,230.591,864,230.590.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.85%11.2441890,533.1279,789115,43490,465.5980,06299,7581,017,7631,017,7630.00%
crit28.15%4.41012192,139.68154,508230,867191,178.790230,867846,467846,4670.00%

Action Details: Avengers Shield Dr

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=false}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Eye for an Eye 2,1870.6%10.631.30s61,7770Direct10.645,25295,57961,78432.8%

Stats Details: Eye For An Eye

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.5510.550.000.000.000.00000.0000651,947.44651,947.440.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.16%7.0901345,252.3637,43154,08845,196.38052,278320,723320,7230.00%
crit32.84%3.4701095,579.0574,862108,17794,679.710107,821331,224331,2240.00%

Action Details: Eye For An Eye

  • id:469311
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.350000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.34
  • base_multiplier:1.00

Spelldata

  • id:469311
  • name:Eye for an Eye
  • school:holy
  • tooltip:
  • description:{$@spelldesc469309=Melee and ranged attackers receive {$469311s1=0} Holy damage each time they strike you during {$?=}c2[Ardent Defender][Divine Protection] and Divine Shield.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Eye of Tyr 5,2051.4%4.459.76s352,279269,265Direct4.4289,731594,264352,30820.5%

Stats Details: Eye Of Tyr

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.434.430.000.000.001.30840.00001,560,928.521,560,928.520.00%269,264.88269,264.88
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit79.46%3.5207289,730.84272,901394,814288,859.900366,6301,020,0711,020,0710.00%
crit20.54%0.9105594,263.80545,803789,629374,390.160788,691540,858540,8580.00%

Action Details: Eye Of Tyr

  • id:387174
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:40.199
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:387174
  • name:Eye of Tyr
  • school:holy
  • tooltip:Dealing {$s1=25}% less damage to the Paladin.
  • description:Releases a blinding flash from your shield, causing {$s2=0} Holy damage to all nearby enemies within {$=}A1 yds and reducing all damage they deal to you by {$s1=25}% for {$d=6 seconds}.

Action Priority List

    standard
    [T]:4.43
  • if_expr:(talent.inmost_light.enabled&raid_event.adds.in>=45|spell_targets.shield_of_the_righteous>=3)&!talent.lights_deliverance.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hammer of Wrath 33,6648.9%28.010.97s359,942294,084Direct28.0262,600542,111360,18134.9%

Stats Details: Hammer Of Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage27.9927.970.000.000.001.22400.000010,074,445.4910,074,445.490.00%294,084.29294,084.29
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit65.09%18.21731262,599.60216,559313,305262,529.08239,197280,6424,780,5654,780,5650.00%
crit34.91%9.77121542,111.45433,119626,611542,485.88466,089593,4985,293,8805,293,8800.00%

Action Details: Hammer Of Wrath

  • id:24275
  • school:holy
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$=}<damage> {$?s403664=false}[Holystrike][Holy] damage. Only usable on enemies that have less than 20% health{$?s326730=true}[, or during Avenging Wrath][]. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    standard
    [L]:27.99

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Global CooldownProtection Paladin1370285SET1.000
Spell Direct AmountProtection Paladin13702818PCT68.0%
Hasted Cooldown Duration (Category)Paladin1370266SET1.000
Holy Shield 2,3520.6%40.27.24s17,5510Direct40.113,39728,37217,55827.8%

Stats Details: Holy Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage40.1540.140.000.000.000.00000.0000704,698.18704,698.180.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.22%28.99125013,397.0811,26317,10913,395.7612,22314,510388,314388,3140.00%
crit27.78%11.1512428,372.3922,90034,21828,393.4323,89431,985316,384316,3840.00%

Action Details: Holy Shield

  • id:157122
  • school:holy
  • range:100.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:157122
  • name:Holy Shield
  • school:holy
  • tooltip:
  • description:{$@spelldesc152261=Your block chance is increased by {$s1=20}%, you are able to block spells, and your successful blocks deal {$157122s1=0} Holy damage to your attacker.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Judgment 76,416 (95,933)20.2% (25.3%)81.93.69s350,926278,039Direct81.9 (104.8)213,100450,599279,71828.1% (29.0%)

Stats Details: Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage81.9081.860.000.000.001.26220.000022,898,586.4122,898,586.410.00%278,039.29278,039.29
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.95%58.903485213,100.50178,848271,697213,098.86201,361225,07512,551,67912,551,6790.00%
crit28.05%22.96741450,599.50363,680543,393450,938.71412,101490,51010,346,90710,346,9070.00%

Action Details: Judgment

  • id:275779
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:11.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:0.450
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.237500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15
  • base_multiplier:1.65

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275779
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target, dealing {$s1=0} Holy damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability][].{$?a315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Action Priority List

    standard
    [H]:11.31
  • target_if_expr:charges>=2|full_recharge_time<=gcd.max
    standard
    [N]:33.05
  • if_expr:(buff.avenging_wrath.up&talent.hammer_and_anvil.enabled)
  • target_if_expr:debuff.judgment.remains
    standard
    [P]:37.55
  • target_if_expr:debuff.judgment.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Modify Recharge Time% (Category)Protection Paladin1370283SET-0.550
Hasted Global CooldownProtection Paladin1370285SET1.000
Hasted Cooldown Duration (Category)Protection Paladin1370286SET1.000
Spell Direct AmountProtection Paladin13702811PCT-14.0%
    Hammer and Anvil 19,5175.2%23.012.90s254,4730Direct23.0187,894392,996254,47432.5%

Stats Details: Hammer And Anvil

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.9622.960.000.000.000.00000.00005,843,447.655,843,447.650.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.54%15.51234187,893.88153,792229,788187,994.03162,111225,2912,913,8572,913,8570.00%
crit32.46%7.45020392,995.86313,694459,576393,245.110459,0262,929,5912,929,5910.00%

Action Details: Hammer And Anvil

  • id:433717
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:433717
  • name:Hammer and Anvil
  • school:holy
  • tooltip:
  • description:{$@spelldesc433718=Judgment critical strikes cause a shockwave around the target, dealing {$?=}c1[{$433722s1=0}][{$433717s1=0}] {$?=}c1[healing][damage] at the target's location.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
melee 20,1845.3%167.72.14s36,07316,806Direct167.727,60258,33936,07327.6%

Stats Details: Melee

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage167.74167.740.000.000.002.14640.00006,051,009.568,644,290.7330.00%16,806.1716,806.17
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.44%121.518016827,602.0023,65935,35227,604.2926,43528,9083,353,9744,791,38730.00%
crit27.56%46.23227758,338.7247,31870,70458,370.9954,48462,7562,697,0363,852,90430.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Refining Fire 28,3447.5%40.57.38s209,5320Periodic216.329,96263,46139,27227.8%57.5%

Stats Details: Refining Fire

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage40.530.00216.27216.2716.670.00000.79808,493,337.058,493,337.050.00%49,215.050.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit72.21%156.1610521229,962.002679,05529,988.5426,57733,9654,678,9134,678,9130.00%
crit27.79%60.112910163,461.0857158,11063,546.9053,46377,3673,814,4243,814,4240.00%

Action Details: Refining Fire

  • id:469882
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.225000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.34
  • base_multiplier:1.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:469882
  • name:Refining Fire
  • school:holyfire
  • tooltip:Suffering {$=}w1 Radiant damage every $t sec.
  • description:Enemies struck by Avenger's Shield burn with holy fire, suffering {$=}o1 Radiant damage over {$d=5 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Sacred Weapon (_proc_damage) 63,32516.7%32.48.99s586,5850Direct32.4435,728897,398586,55932.7%

Stats Details: Sacred Weapon Proc Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage32.3732.370.000.000.000.00000.000018,987,479.9718,987,479.970.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.33%21.79744435,727.55165,1851,384,216434,817.76342,601605,7799,497,2709,497,2700.00%
crit32.67%10.57126897,397.63330,3692,636,564897,267.54596,5891,505,0409,490,2109,490,2100.00%

Action Details: Sacred Weapon Proc Damage

  • id:432616
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:432616
  • name:Sacred Weapon
  • school:holy
  • tooltip:
  • description:{$@spelldesc432502=While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Shield of the Righteous 43,312 (70,972)11.4% (18.7%)88.73.38s239,6360Direct88.7 (121.7)111,387226,650146,29030.3% (32.7%)

Stats Details: Shield Of The Righteous

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage88.7288.720.000.000.000.00000.000012,978,355.9112,978,355.910.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.72%61.853794111,386.8854,003229,624111,464.97100,037121,7056,889,3496,889,3490.00%
crit30.28%26.86947226,649.81108,005418,335226,944.30188,495274,1576,089,0076,089,0070.00%

Action Details: Shield Of The Righteous

  • id:53600
  • school:holy
  • range:5.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53600
  • name:Shield of the Righteous
  • school:holy
  • tooltip:
  • description:Slams enemies in front of you with your shield, causing {$s1=0} Holy damage, and increasing your Armor by {$?=}c1[{$=}{{$132403s1=160}*{$=}INT/100}][{$=}{{$132403s1=160}*{$=}STR/100}] for {$132403d=4.500 seconds}.{$?a386568=false}[ {$@spelldesc386568=When Shield of the Righteous expires, gain {$386556s1=10}% block chance and deal {$386553s1=0} Holy damage to all attackers for {$386556d=4 seconds}.}][]{$?a280373=true}[ {$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}][]

Action Priority List

    standard
    [I]:88.72
  • if_expr:(!talent.righteous_protector.enabled|cooldown.righteous_protector_icd.remains=0)&!buff.hammer_of_light_ready.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Hasted Global CooldownProtection Paladin1370285SET1.000
    Forge's Reckoning 27,6607.3%33.08.50s250,6320Direct33.0179,919360,472250,78439.3%

Stats Details: Forges Reckoning

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage33.0433.020.000.000.000.00000.00008,281,202.878,281,202.870.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit60.75%20.06637179,919.16165,813203,133179,925.40169,078190,1453,609,1083,609,1080.00%
crit39.25%12.96328360,472.27336,977406,265360,636.95337,175385,2754,672,0954,672,0950.00%

Action Details: Forges Reckoning

  • id:447258
  • school:holy
  • range:100.0
  • travel_speed:30.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:447258
  • name:Forge's Reckoning
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} damage to enemy targets. Reduced above {$s2=5} targets.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Spell Direct AmountProtection Paladin13702826PCT-15.0%
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Stormyo 108919
blessed_hammer_absorb 8,4867.7%0.00.00s00Direct120.421,149021,1490.0%

Stats Details: Blessed Hammer Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.00120.380.000.000.000.00000.00002,545,866.640.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%120.388815421,149.0820,10423,02321,149.0420,82121,8662,545,86700.00%
bulwark_of_order_absorb 9,4048.6%0.00.00s00Direct38.673,063073,0630.0%

Stats Details: Bulwark Of Order Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0038.580.000.000.000.00000.00002,819,143.920.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%38.58265073,062.8846,352276,70873,144.0256,56499,8922,819,14400.00%
holy_bulwark_absorb 30,53428.0%0.00.00s00Direct42.4216,9780216,9780.0%

Stats Details: Holy Bulwark Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0042.350.000.000.000.00000.00009,188,883.440.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%42.351993216,977.745421,840,980217,436.86190,446284,6899,188,88300.00%
Sacred Weapon (_proc_heal) 6270.6%0.355.35s672,4650Direct0.3558,6751,148,463672,14419.2%

Stats Details: Sacred Weapon Proc Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal0.280.280.000.000.000.00000.0000190,192.18192,025.740.95%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.76%0.2303558,674.8501,201,847113,490.1401,201,847127,675128,9530.18%
crit19.24%0.05021,148,462.5102,307,54560,039.5702,307,54562,51763,0730.04%

Action Details: Sacred Weapon Proc Heal

  • id:441590
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Stormyo
  • aoe:5
  • split_aoe_damage:false
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441590
  • name:Sacred Weapon
  • school:holy
  • tooltip:
  • description:{$@spelldesc432502=While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.}
Word of Glory 59,402 (59,528)54.7% (54.8%)6.027.75s2,997,5802,233,985Direct6.0 (6.2)2,518,7805,071,8232,991,71518.5% (19.0%)

Stats Details: Word Of Glory

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal6.016.010.000.000.001.34180.000017,977,729.7917,992,008.690.08%2,233,985.162,233,985.16
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.48%4.900122,518,779.6903,805,4642,509,379.5203,518,28512,334,18912,337,7240.04%
crit18.52%1.11075,071,822.5207,610,9273,491,590.6307,610,8275,643,5415,654,2840.17%

Action Details: Word Of Glory

  • id:85673
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Stormyo
  • aoe:0
  • harmful:false

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.465000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10
  • base_multiplier:1.00

Spelldata

  • id:85673
  • name:Word of Glory
  • school:holy
  • tooltip:
  • description:Calls down the Light to heal a friendly target for $130551s1{$?a378405=false}[ and an additional {$378405s1=20}% over {$378412d=10 seconds}][].{$?a379043=true}[ Your block chance is increased by {$379043s1=5}% for {$379041d=6 seconds}.][]{$?a315921=true}&!a315924[ |cFFFFFFFFProtection:|r If cast on yourself, healing increased by up to {$315921s1=300}% based on your missing health.][]{$?a315924=false}[ |cFFFFFFFFProtection:|r Healing increased by up to {$315921s1=300}% based on your missing health, or up to {$315924s1=100}% if cast on another target.][]

Action Priority List

    standard
    [W]:6.01
  • if_expr:buff.shining_light_free.up&(talent.blessed_assurance.enabled|(talent.lights_guidance.enabled&cooldown.hammerfall_icd.remains=0))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin13702817PCT110.0%
    Sacred Word 1260.1%0.292.66s194,2590Direct0.2143,668285,408194,36935.7%

Stats Details: Sacred Word

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal0.190.190.000.000.000.00000.000037,126.5237,212.880.23%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.31%0.1202143,668.36139,475151,05017,301.740151,05017,65917,6590.00%
crit35.69%0.0702285,407.700301,71919,154.550301,71919,46719,5540.03%

Action Details: Sacred Word

  • id:447246
  • school:holy
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Stormyo
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:447246
  • name:Sacred Word
  • school:holy
  • tooltip:
  • description:Heals the target for {$s1=0}.
Simple Action Stats Execute Interval
Stormyo
Ardent Defender 6.353.13s

Stats Details: Ardent Defender

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.280.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Ardent Defender

  • id:31850
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:84.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:31850
  • name:Ardent Defender
  • school:physical
  • tooltip:Damage taken reduced by {$=}w1%. The next attack that would otherwise kill you will instead bring you to {$=}w2% of your maximum health.{$?a469439=true}[ Healing taken increased by {$=}w4%.][]
  • description:Reduces all damage you take by {$s1=20}% for {$d=8 seconds}. While Ardent Defender is active, the next attack that would otherwise kill you will instead bring you to {$s2=20}% of your maximum health.

Action Priority List

    defensives
    [G]:6.28
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Stormyo
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Avenging Wrath 4.283.81s

Stats Details: Avenging Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.200.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Avenging Wrath

  • id:454351
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:454351
  • name:Avenging Wrath
  • school:holy
  • tooltip:{$?=}{$=}w2>0&{$=}w3>0[Damage, healing and critical strike chance increased by {$=}w2%.]?{$=}w3==0&{$=}w2>0[Damage and healing increased by {$=}w2%.]?{$=}w2==0&{$=}w3>0[Critical strike chance increased by {$=}w3%.][]{$?a53376=true}[ ][]{$?a53376=true}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=true}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]{$?s384442=false}&s384376[increasing your damage, healing and critical strike chance by {$s2=20}% for {$d=8 seconds}.]?!s384442&s384376[increasing your damage and healing by {$s1=20}% for {$d=8 seconds}.]?!s384376&s384442[increasing your critical strike chance by {$s3=20}% for {$d=8 seconds}.][and activating all the effects learned for Avenging Wrath for {$d=8 seconds}.]

Action Priority List

    cooldowns
    [E]:4.20
Devotion Aura 1.00.00s

Stats Details: Devotion Aura

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Devotion Aura

  • id:465
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:465
  • name:Devotion Aura
  • school:holy
  • tooltip:Damage taken reduced by {$=}w1%.
  • description:Party and raid members within {$=}a1 yds are bolstered by their devotion, reducing damage taken by {$s1=3}%.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Stormyo
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Stormyo
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Holy Bulwark (Holy Armaments) 5.945.44s

Stats Details: Holy Armaments

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.940.000.000.000.001.27810.00000.000.000.00%0.000.00

Action Details: Holy Armaments

  • id:432459
  • school:holy
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:432459
  • name:Holy Bulwark
  • school:holy
  • tooltip:
  • description:Will the Light to coalesce and become manifest as a Holy Armament, wielded by your friendly target. {$@=}spellicon432496 {$@=}spellname432496: {$@spelldesc432496=While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.} Becomes Sacred Weapon after use.

Action Priority List

    standard
    [K]:3.45
  • if_expr:next_armament=sacred_weapon&(!buff.sacred_weapon.up|(buff.sacred_weapon.remains<6&!buff.avenging_wrath.up&cooldown.avenging_wrath.remains<=30))
    standard
    [O]:0.22
  • if_expr:next_armament=holy_bulwark&charges=2
    standard
    [U]:2.27
  • if_expr:next_armament=holy_bulwark
holy_bulwark 4.260.40s

Stats Details: Holy Bulwark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.240.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Holy Bulwark

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.30.00s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.250.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [F]:1.25
  • if_expr:buff.avenging_wrath.up
Rite of Sanctification 1.00.00s

Stats Details: Rite Of Sanctification

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Rite Of Sanctification

  • id:433568
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Stormyo
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:433568
  • name:Rite of Sanctification
  • school:holy
  • tooltip:
  • description:Imbue your weapon with the power of the Light, increasing your armor by {$433550s2=5}% and your primary stat by {$433550s1=2}%. Lasts {$433550d=3600 seconds}.
sacred_weapon 9.434.87s

Stats Details: Sacred Weapon

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.390.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sacred Weapon

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ardent Defender6.30.051.5s53.2s1.9s4.10%4.05%0.0 (0.0)1.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_ardent_defender
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:32.7s / 62.0s
  • trigger_min/max:38.0s / 62.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:2.38% / 5.92%

Stack Uptimes

  • ardent_defender_1:4.10%

Spelldata

  • id:31850
  • name:Ardent Defender
  • tooltip:Damage taken reduced by {$=}w1%. The next attack that would otherwise kill you will instead bring you to {$=}w2% of your maximum health.{$?a469439=true}[ Healing taken increased by {$=}w4%.][]
  • description:Reduces all damage you take by {$s1=20}% for {$d=8 seconds}. While Ardent Defender is active, the next attack that would otherwise kill you will instead bring you to {$s2=20}% of your maximum health.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Avenging Wrath4.20.082.0s83.9s30.7s42.99%45.08%0.0 (0.0)3.7

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:66.0s / 91.9s
  • trigger_min/max:71.2s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.5s
  • uptime_min/max:37.43% / 50.67%

Stack Uptimes

  • avenging_wrath_1:42.99%

Spelldata

  • id:31884
  • name:Avenging Wrath
  • tooltip:Damage, healing, and critical strike chance increased by {$=}w2%. {$?a53376=true}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=true}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]increasing your damage, healing, and critical strike chance by {$s2=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Barricade of Faith17.12.517.1s14.9s10.9s62.19%55.98%2.5 (2.5)16.5

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_barricade_of_faith
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 84.7s
  • trigger_min/max:2.5s / 58.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.4s
  • uptime_min/max:47.11% / 75.56%

Stack Uptimes

  • barricade_of_faith_1:62.19%

Spelldata

  • id:385726
  • name:Barricade of Faith
  • tooltip:
  • description:When you use Avenger's Shield, your block chance is increased by {$385724s1=10}% for {$385724d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Blessed Assurance64.929.94.6s3.2s2.5s54.67%90.87%29.9 (29.9)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_blessed_assurance
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 20.4s
  • trigger_min/max:0.0s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.7s
  • uptime_min/max:41.88% / 70.67%

Stack Uptimes

  • blessed_assurance_1:54.67%

Spelldata

  • id:433019
  • name:Blessed Assurance
  • tooltip:Damage and healing of your next {$?s204019=true}[Blessed Hammer]?s53595[Hammer of the Righteous][Crusader Strike] increased by {$=}w1%.
  • description:{$@spelldesc433015=Casting a Holy Power ability increases the damage and healing of your next {$?s204019=true}[Blessed Hammer]?s53595[Hammer of the Righteous][Crusader Strike] by {$433019s1=200}%.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Blessed Hammer (_absorb)120.40.02.4s2.4s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_blessed_hammer_absorb
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 15.0s
  • trigger_min/max:0.0s / 15.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:204301
  • name:Blessed Hammer
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of Dawn59.90.05.0s5.0s2.2s26.76%63.11%0.0 (0.0)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_blessing_of_dawn
  • max_stacks:2
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.6s / 11.1s
  • trigger_min/max:2.6s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.6s
  • uptime_min/max:8.64% / 44.83%

Stack Uptimes

  • blessing_of_dawn_1:26.76%

Spelldata

  • id:385127
  • name:Blessing of Dawn
  • tooltip:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing.
  • description:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing. This effect stacks.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blessing of Dusk1.857.8103.6s5.0s164.0s98.73%99.69%57.8 (57.8)0.8

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_blessing_of_dusk
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.2s / 317.5s
  • trigger_min/max:1.0s / 14.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.0s
  • uptime_min/max:96.28% / 99.23%

Stack Uptimes

  • blessing_of_dusk_1:98.73%

Spelldata

  • id:385126
  • name:Blessing of Dusk
  • tooltip:Damage taken reduced by {$=}w1%{$?s385129=false}[, armor increased by {$=}w2%, and Holy Power generating abilities cool down {$=}w3% faster.][.]
  • description:Damage taken reduced by {$s1=4}%{$?s385129=false}&c2[, armor increased by {$s2=10}%, and Holy Power generating abilities cool down {$s3=10}% faster]?s385129[ and your Holy Power generating abilities also grant an absorb shield for {$s9=10}% of damage or healing dealt.][] For {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of the Forge4.20.082.0s83.9s19.2s26.88%35.11%0.0 (0.0)3.9

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_blessing_of_the_forge
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • blessing_of_the_forge_1:26.88%

Spelldata

  • id:434132
  • name:Blessing of the Forge
  • tooltip:Assisted by a Sacred Weapon.
  • description:{$@spelldesc433011=Avenging Wrath summons an additional Sacred Weapon, and during Avenging Wrath your Sacred Weapon casts spells on your target and echoes the effects of your Holy Power abilities.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.51%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bulwark of Order38.71.87.7s7.4s0.9s11.85%51.11%1.8 (1.8)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_bulwark_of_order
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 41.1s
  • trigger_min/max:0.0s / 41.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s
  • uptime_min/max:7.12% / 17.99%

Stack Uptimes

  • bulwark_of_order_1:11.85%

Spelldata

  • id:209389
  • name:Bulwark of Order
  • tooltip:
  • description:Avenger's Shield also shields you for {$209388d=8 seconds}, absorbing {$s1=60}% as much damage as it dealt, up to {$s2=50}% of your maximum health.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Bulwark of Righteous Fury33.76.88.9s7.4s2.4s26.90%37.85%0.0 (0.0)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_bulwark_of_righteous_fury
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 46.1s
  • trigger_min/max:0.0s / 41.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.5s
  • uptime_min/max:17.79% / 38.49%

Stack Uptimes

  • bulwark_of_righteous_fury_1:22.87%
  • bulwark_of_righteous_fury_2:3.73%
  • bulwark_of_righteous_fury_3:0.30%
  • bulwark_of_righteous_fury_4:0.00%

Spelldata

  • id:386652
  • name:Bulwark of Righteous Fury
  • tooltip:Increases your next Shield of the Righteous' damage by {$=}w1% and radius by {$s3=6}~ yds.
  • description:{$@spelldesc386653=Avenger's Shield increases the damage of your next Shield of the Righteous by {$386652s1=20}% for each target hit by Avenger's Shield, stacking up to {$386652u=5} times, and increases its radius by {$386652s3=6} yds.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Purpose14.20.019.7s19.7s1.0s4.95%14.78%0.0 (0.0)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 252.5s
  • trigger_min/max:0.2s / 252.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.1s
  • uptime_min/max:0.71% / 11.80%

Stack Uptimes

  • divine_purpose_1:4.95%

Spelldata

  • id:223819
  • name:Divine Purpose
  • tooltip:Your next Holy Power spending ability is free and deals {$s2=15}% increased damage and healing.
  • description:{$@spelldesc223817=Holy Power spending abilities have a {$s1=15}% chance to make your next Holy Power spending ability free and deal {$223819s2=15}% increased damage and healing.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Resonance5.40.061.1s61.1s14.7s26.32%0.00%10.5 (10.5)5.1

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_divine_resonance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:60.0s / 75.6s
  • trigger_min/max:60.0s / 75.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:23.39% / 29.17%

Stack Uptimes

  • divine_resonance_1:26.32%

Spelldata

  • id:355455
  • name:Divine Resonance
  • tooltip:Casting {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$t1=5} sec for {$s2=15} sec.
  • description:{$@spelldesc355098=After casting Divine Toll, you instantly cast {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$355455t1=5} sec. This effect lasts {$355455s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Faith in the Light4.91.135.2s27.7s6.8s11.08%14.95%1.1 (1.1)4.9

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_faith_in_the_light
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 183.8s
  • trigger_min/max:1.2s / 180.9s
  • trigger_pct:100.00%
  • duration_min/max:4.0s / 15.5s
  • uptime_min/max:0.00% / 22.14%

Stack Uptimes

  • faith_in_the_light_1:11.08%

Spelldata

  • id:379041
  • name:Faith in the Light
  • tooltip:Block chance increased by {$=}w1%.
  • description:Casting Word of Glory grants you an additional {$379043s1=5}% block chance for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Faith's Armor23.165.612.9s3.4s11.5s88.38%69.65%65.6 (65.6)22.2

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_faiths_armor
  • max_stacks:1
  • base duration:4.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.5s / 68.6s
  • trigger_min/max:1.0s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.8s
  • uptime_min/max:84.30% / 92.78%

Stack Uptimes

  • faiths_armor_1:88.38%

Spelldata

  • id:379017
  • name:Faith's Armor
  • tooltip:Armor increased by {$=}w1%.
  • description:{$?=}c2[Shield of the Righteous][Word of Glory] grants {$s1=20}% bonus armor for {$d=4.500 seconds}.
  • max_stacks:0
  • duration:4.50
  • cooldown:0.00
  • default_chance:0.00%
fake_solidarity13.60.028.2s22.4s25.0s69.44%93.27%0.0 (0.0)7.7

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_fake_solidarity
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 150.3s
  • trigger_min/max:0.0s / 86.5s
  • trigger_pct:99.63%
  • duration_min/max:0.0s / 143.1s
  • uptime_min/max:53.04% / 98.30%

Stack Uptimes

  • fake_solidarity_1:52.99%
  • fake_solidarity_2:14.51%
  • fake_solidarity_3:1.80%
  • fake_solidarity_4:0.14%
  • fake_solidarity_5:0.01%
  • fake_solidarity_6:0.00%
Flask of Alchemical Chaos (Crit)2.10.6112.3s77.6s35.0s24.90%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 351.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 80.45%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.90%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6112.0s77.1s35.3s25.06%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 353.9s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 85.87%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.06%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.6s76.7s35.2s24.92%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 352.1s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 80.51%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.92%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.6s76.1s35.5s25.12%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 351.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 206.6s
  • uptime_min/max:0.00% / 84.63%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.12%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Holy Bulwark3.70.674.7s61.9s21.7s26.47%34.80%36.6 (36.6)3.4

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_holy_bulwark
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:20.0s / 196.9s
  • trigger_min/max:0.3s / 182.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 81.4s
  • uptime_min/max:13.11% / 56.76%

Stack Uptimes

  • holy_bulwark_1:26.47%

Spelldata

  • id:432496
  • name:Holy Bulwark
  • tooltip:Wielding a Holy Bulwark.{$?=}{$=}w3<0[ Duration of Fear effects reduced by {$s3=0}%.][]
  • description:While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Holy Bulwark (_absorb)37.85.85.9s5.1s1.2s14.62%56.13%5.8 (5.8)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_holy_bulwark_absorb
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 162.3s
  • trigger_min/max:0.0s / 162.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.2s
  • uptime_min/max:3.50% / 38.45%

Stack Uptimes

  • holy_bulwark_absorb_1:14.62%

Spelldata

  • id:432607
  • name:Holy Bulwark
  • tooltip:Absorbing the next {$=}w1 damage you take.
  • description:{$@spelldesc432496=While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Quickwick's Quick Trick Wick Walk2.60.0149.7s129.8s19.4s16.95%0.00%0.0 (0.0)2.5

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_quickwicks_quick_trick_wick_walk
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Quickwick Candlestick

Stat Details

  • stat:haste_rating
  • amount:5306.78

Trigger Details

  • interval_min/max:120.0s / 174.3s
  • trigger_min/max:120.0s / 166.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:13.71% / 20.48%

Stack Uptimes

  • quickwicks_quick_trick_wick_walk_1:16.95%

Spelldata

  • id:455451
  • name:Quickwick's Quick Trick Wick Walk
  • tooltip:Increased movement speed and haste.
  • description:{$@=}class be nimble, {$@=}class be quick. {$@=}class invoke the power of the candlestick to increase movement speed by {$s1=20}% and Haste by {$s2=9192} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Radiance7.30.639.3s35.9s15.5s36.76%0.00%0.6 (0.6)6.7

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_radiance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2845.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:0.00
  • stat:mastery_rating
  • amount:1422.50
  • stat:haste_rating
  • amount:0.00
  • stat:versatility_rating
  • amount:0.00

Trigger Details

  • interval_min/max:15.0s / 117.4s
  • trigger_min/max:0.1s / 110.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.2s
  • uptime_min/max:15.85% / 68.36%

Stack Uptimes

  • radiance_1:36.76%

Spelldata

  • id:454785
  • name:Radiance
  • tooltip:{$?=}e1[Critical Strike]?e2[Haste]?e3[Mastery]?e4[Versatility][Highest secondary stat] increased by {$=}w1.
  • description:{$@spelldesc454558=Your damaging spells and abilities have the chance to ignite your target with Radiant Focus for {$454560d=15 seconds}. After dealing up to {$454560s1=1910684} damage to the target, the focused energies ignite you with Radiance, granting between {$=}{{$s2=144325}*.5} to {$s2=144325} of your highest Secondary stat based on damage dealt for {$454560d=15 seconds}. }
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Redoubt1.087.7104.9s3.4s298.8s99.67%98.87%85.7 (85.7)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_redoubt
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:49.1s / 207.2s
  • trigger_min/max:1.0s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:49.0s / 359.0s
  • uptime_min/max:99.30% / 99.74%

Stack Uptimes

  • redoubt_1:0.60%
  • redoubt_2:0.56%
  • redoubt_3:98.51%

Spelldata

  • id:280375
  • name:Redoubt
  • tooltip:Strength and Stamina increased by {$=}w1%.
  • description:{$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Relentless Inquisitor1.093.70.0s3.2s299.0s99.67%94.37%91.7 (91.7)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_relentless_inquisitor
  • max_stacks:3
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:239.0s / 359.0s
  • uptime_min/max:99.59% / 99.74%

Stack Uptimes

  • relentless_inquisitor_1:0.60%
  • relentless_inquisitor_2:0.56%
  • relentless_inquisitor_3:98.51%

Spelldata

  • id:383389
  • name:Relentless Inquisitor
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc383388=Spending Holy Power grants you {$s1=1}% haste per finisher for {$383389d=12 seconds}, stacking up to {$=}{{$s2=0}+{$s3=3}} times.}
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Sacred Weapon7.61.841.5s35.1s22.4s56.75%57.03%1.8 (1.8)7.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_sacred_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:8.00
  • modifier:1.00

Stack Uptimes

  • sacred_weapon_1:56.75%

Spelldata

  • id:432502
  • name:Sacred Weapon
  • tooltip:Your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets.{$?=}{$=}w3<0[ Duration of Fear effects reduced by {$s3=0}%.][]
  • description:While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Shield of the Righteous1.087.70.0s3.4s299.0s99.67%100.00%87.7 (87.7)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_shield_of_the_righteous
  • max_stacks:1
  • base duration:4.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:1.0s / 11.1s
  • trigger_pct:100.00%
  • duration_min/max:239.0s / 359.0s
  • uptime_min/max:99.59% / 99.74%

Stack Uptimes

  • shield_of_the_righteous_1:99.67%

Spelldata

  • id:132403
  • name:Shield of the Righteous
  • tooltip:Armor increased by {$?=}c1[{$=}{{$=}W1*{$=}INT/100}][{$=}{{$=}W1*{$=}STR/100}].{$?=}{$=}W3<0[ Damage taken reduced by {$=}w3%.][]
  • description:{$@spelldesc53600=Slams enemies in front of you with your shield, causing {$s1=0} Holy damage, and increasing your Armor by {$?=}c1[{$=}{{$132403s1=160}*{$=}INT/100}][{$=}{{$132403s1=160}*{$=}STR/100}] for {$132403d=4.500 seconds}.{$?a386568=false}[ {$@spelldesc386568=When Shield of the Righteous expires, gain {$386556s1=10}% block chance and deal {$386553s1=0} Holy damage to all attackers for {$386556d=4 seconds}.}][]{$?a280373=true}[ {$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}][] }
  • max_stacks:0
  • duration:4.50
  • cooldown:0.00
  • default_chance:0.00%
Shining Light (_free)2.239.8112.0s7.1s130.4s96.69%100.00%34.1 (34.1)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_shining_light_free
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 277.7s
  • trigger_min/max:0.0s / 23.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 357.0s
  • uptime_min/max:85.25% / 99.71%

Stack Uptimes

  • shining_light_free_1:12.02%
  • shining_light_free_2:84.67%

Spelldata

  • id:327510
  • name:Shining Light
  • tooltip:Your next Word of Glory costs no Holy Power.
  • description:{$@spelldesc321136=Every {$s1=3} Shields of the Righteous make your next Word of Glory cost no Holy Power. Maximum {$327510=}U stacks.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Shining Light (_stacks)29.929.610.2s5.1s6.7s66.68%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_shining_light_stacks
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 23.5s
  • trigger_min/max:1.0s / 17.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.7s
  • uptime_min/max:57.54% / 75.81%

Stack Uptimes

  • shining_light_stacks_1:33.44%
  • shining_light_stacks_2:33.23%

Spelldata

  • id:182104
  • name:Shining Light
  • tooltip:After {$=}{{$321136s1=3}~-{$=}w1} {$?=}{$=}w1<{$=}w2[Shields][Shield] of the Righteous, your next Word of Glory is free.
  • description:{$@spelldesc321136=Every {$s1=3} Shields of the Righteous make your next Word of Glory cost no Holy Power. Maximum {$327510=}U stacks.}
  • max_stacks:4
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Strength in Adversity40.60.07.4s7.4s7.4s99.35%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_strength_in_adversity
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 41.1s
  • trigger_min/max:0.0s / 41.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.1s
  • uptime_min/max:99.19% / 99.48%

Stack Uptimes

  • strength_in_adversity_1:99.35%

Spelldata

  • id:393071
  • name:Strength in Adversity
  • tooltip:
  • description:For each target hit by Avenger's Shield, gain {$s1=5}% parry for {$393038d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Tempered Potion1.30.0328.7s0.0s27.1s11.25%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:307.7s / 344.9s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:8.80% / 17.75%

Stack Uptimes

  • tempered_potion_1:11.25%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devotion Aura

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_devotion_aura
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:465
  • name:Devotion Aura
  • tooltip:Damage taken reduced by {$=}w1%.
  • description:Party and raid members within {$=}a1 yds are bolstered by their devotion, reducing damage taken by {$s1=3}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rite of Sanctification

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_rite_of_sanctification
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:433550
  • name:Rite of Sanctification
  • tooltip:Primary stat increased by {$=}w1%. Armor increased by {$=}w2%.
  • description:{$@spelldesc433568=Imbue your weapon with the power of the Light, increasing your armor by {$433550s2=5}% and your primary stat by {$433550s1=2}%. Lasts {$433550d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Stormyo
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)27.98.052.010.5s0.9s139.7s
parry_haste12.10.030.022.9s2.0s248.0s
Divine Purpose14.22.035.019.7s0.2s252.5s
Avenger's Shield: Grand Crusader8.20.018.031.8s2.0s252.0s
Avenger's Shield: Grand Crusader wasted4.60.017.050.6s0.0s333.2s
Divine Inspiration3.50.012.062.8s0.2s290.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Avenger's Shield (_dt)39.9291.85461.972233.574189.657285.818
Avenger's Shield (_dr)11.0220.00052.131184.272149.229226.636
Consecration16.1820.00097.951246.785184.583310.867
Avenging Wrath0.4890.0001.3742.0560.0005.409
Divine Toll1.2260.00015.6366.6641.85720.926
Judgment0.0140.0001.5851.1710.0007.529
Eye of Tyr24.1490.000133.211129.77541.874237.045
Shield of the Righteous2.5380.09010.176226.411172.658280.936
Avenger's Shield5.2660.00057.504106.07346.134186.514
Blessed Hammer0.0980.0008.6366.9444.58721.154
Holy Bulwark (Holy Armaments)3.9080.00064.80223.24520.00064.802
Hammer of Wrath4.7160.00059.086132.01884.414166.689

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Stormyo
Blessed HammerHoly Power70.7870.7631.47%1.000.010.02%
Blessed Hammer (_absorb)Health120.382,545,925.1612.27%21,149.080.000.00%
Divine TollHoly Power5.395.392.39%1.000.000.00%
Hammer of WrathHoly Power27.9927.9812.44%1.000.000.02%
JudgmentHoly Power81.90120.7353.69%1.470.030.02%
Sacred Weapon (_proc_heal)Health0.28190,316.600.92%672,143.511,829.170.95%
Sacred WordHealth0.1937,136.220.18%194,368.8586.160.23%
Word of GloryHealth6.0117,982,224.9386.64%2,991,714.5114,244.710.08%
Usage Type Count Total Tot% Avg RPE APR
Stormyo
Shield of the RighteousHoly Power88.72223.78100.00%2.522.5295,000.01
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Health5,789,240.0572,788.59731,927.751,560,540.3-39,298,698.8-77,884,286.2-1,311,555.7
Holy Power0.00.750.750.01.10.05.0

Statistics & Data Analysis

Fight Length
Stormyo Fight Length
Count 9999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Stormyo Damage Per Second
Count 9999
Mean 378599.16
Minimum 324425.53
Maximum 466361.11
Spread ( max - min ) 141935.58
Range [ ( max - min ) / 2 * 100% ] 18.74%
Standard Deviation 16569.7407
5th Percentile 352698.46
95th Percentile 407361.44
( 95th Percentile - 5th Percentile ) 54662.98
Mean Distribution
Standard Deviation 165.7057
95.00% Confidence Interval ( 378274.39 - 378923.94 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7359
0.1 Scale Factor Error with Delta=300 2343771
0.05 Scale Factor Error with Delta=300 9375083
0.01 Scale Factor Error with Delta=300 234377056
Priority Target DPS
Stormyo Priority Target Damage Per Second
Count 9999
Mean 378599.16
Minimum 324425.53
Maximum 466361.11
Spread ( max - min ) 141935.58
Range [ ( max - min ) / 2 * 100% ] 18.74%
Standard Deviation 16569.7407
5th Percentile 352698.46
95th Percentile 407361.44
( 95th Percentile - 5th Percentile ) 54662.98
Mean Distribution
Standard Deviation 165.7057
95.00% Confidence Interval ( 378274.39 - 378923.94 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7359
0.1 Scale Factor Error with Delta=300 2343771
0.05 Scale Factor Error with Delta=300 9375083
0.01 Scale Factor Error with Delta=300 234377056
DPS(e)
Stormyo Damage Per Second (Effective)
Count 9999
Mean 378599.16
Minimum 324425.53
Maximum 466361.11
Spread ( max - min ) 141935.58
Range [ ( max - min ) / 2 * 100% ] 18.74%
Damage
Stormyo Damage
Count 9999
Mean 113445780.38
Minimum 81381580.91
Maximum 151775858.33
Spread ( max - min ) 70394277.42
Range [ ( max - min ) / 2 * 100% ] 31.03%
DTPS
Stormyo Damage Taken Per Second
Count 9999
Mean 732082.53
Minimum 594762.78
Maximum 849426.32
Spread ( max - min ) 254663.54
Range [ ( max - min ) / 2 * 100% ] 17.39%
Standard Deviation 30957.6969
5th Percentile 681068.40
95th Percentile 783085.25
( 95th Percentile - 5th Percentile ) 102016.85
Mean Distribution
Standard Deviation 309.5924
95.00% Confidence Interval ( 731475.74 - 732689.32 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 69
0.1% Error 6870
0.1 Scale Factor Error with Delta=300 8181275
0.05 Scale Factor Error with Delta=300 32725098
0.01 Scale Factor Error with Delta=300 818127438
HPS
Stormyo Healing Per Second
Count 9999
Mean 60154.27
Minimum 0.00
Maximum 147924.29
Spread ( max - min ) 147924.29
Range [ ( max - min ) / 2 * 100% ] 122.95%
Standard Deviation 19587.9096
5th Percentile 27795.12
95th Percentile 92296.37
( 95th Percentile - 5th Percentile ) 64501.25
Mean Distribution
Standard Deviation 195.8889
95.00% Confidence Interval ( 59770.34 - 60538.21 )
Normalized 95.00% Confidence Interval ( 99.36% - 100.64% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 4074
0.1% Error 407324
0.1 Scale Factor Error with Delta=300 3275367
0.05 Scale Factor Error with Delta=300 13101465
0.01 Scale Factor Error with Delta=300 327536612
HPS(e)
Stormyo Healing Per Second (Effective)
Count 9999
Mean 60154.27
Minimum 0.00
Maximum 147924.29
Spread ( max - min ) 147924.29
Range [ ( max - min ) / 2 * 100% ] 122.95%
Heal
Stormyo Heal
Count 9999
Mean 18205048.49
Minimum 0.00
Maximum 45016306.52
Spread ( max - min ) 45016306.52
Range [ ( max - min ) / 2 * 100% ] 123.64%
HTPS
Stormyo Healing Taken Per Second
Count 9999
Mean 357484.60
Minimum 294068.22
Maximum 441507.35
Spread ( max - min ) 147439.13
Range [ ( max - min ) / 2 * 100% ] 20.62%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 rite_of_sanctification
1 0.00 rite_of_adjuration
2 0.00 snapshot_stats
3 0.00 devotion_aura
4 0.00 lights_judgment
5 0.00 arcane_torrent
6 0.00 consecration
7 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_cooldown&trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)|!trinket.2.has_cooldown
8 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_cooldown&trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)|!trinket.1.has_cooldown
Default action list Executed every time the actor is available.
# count action,conditions
9 1.00 auto_attack
A 0.00 call_action_list,name=cooldowns
B 0.00 call_action_list,name=defensives
C 0.00 call_action_list,name=trinkets
D 0.00 call_action_list,name=standard
actions.cooldowns
# count action,conditions
0.00 lights_judgment,if=spell_targets.lights_judgment>=2|!raid_event.adds.exists|raid_event.adds.in>75|raid_event.adds.up
E 4.20 avenging_wrath
F 1.25 potion,if=buff.avenging_wrath.up
0.00 moment_of_glory,if=(buff.avenging_wrath.remains<15|(time>10))
0.00 divine_toll,if=spell_targets.shield_of_the_righteous>=3
0.00 bastion_of_light,if=buff.avenging_wrath.up|cooldown.avenging_wrath.remains<=30
0.00 invoke_external_buff,name=power_infusion,if=buff.avenging_wrath.up
0.00 fireblood,if=buff.avenging_wrath.remains>8
actions.defensives
# count action,conditions
G 6.28 ardent_defender
actions.standard
# count action,conditions
H 11.31 judgment,target_if=charges>=2|full_recharge_time<=gcd.max
0.00 hammer_of_light,if=buff.hammer_of_light_free.remains<2|buff.shake_the_heavens.remains<1|!buff.shake_the_heavens.up|cooldown.eye_of_tyr.remains<1.5|fight_remains<2
0.00 eye_of_tyr,if=(hpg_to_2dawn=5|!talent.of_dusk_and_dawn.enabled)&talent.lights_guidance.enabled
0.00 eye_of_tyr,if=(hpg_to_2dawn=1|buff.blessing_of_dawn.stack>0)&talent.lights_guidance.enabled
I 88.72 shield_of_the_righteous,if=(!talent.righteous_protector.enabled|cooldown.righteous_protector_icd.remains=0)&!buff.hammer_of_light_ready.up
0.00 judgment,target_if=min:debuff.judgment.remains,if=spell_targets.shield_of_the_righteous>3&buff.bulwark_of_righteous_fury.stack>=3&holy_power<3
0.00 avengers_shield,if=!buff.bulwark_of_righteous_fury.up&talent.bulwark_of_righteous_fury.enabled&spell_targets.shield_of_the_righteous>=3
0.00 hammer_of_the_righteous,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3&!buff.avenging_wrath.up
J 33.06 blessed_hammer,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3&!buff.avenging_wrath.up
0.00 crusader_strike,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<2&!buff.avenging_wrath.up
0.00 judgment,target_if=min:debuff.judgment.remains,if=charges>=2|full_recharge_time<=gcd.max
0.00 consecration,if=buff.divine_guidance.stack=5
K 3.45 holy_armaments,if=next_armament=sacred_weapon&(!buff.sacred_weapon.up|(buff.sacred_weapon.remains<6&!buff.avenging_wrath.up&cooldown.avenging_wrath.remains<=30))
L 27.99 hammer_of_wrath
M 5.39 divine_toll,if=(!raid_event.adds.exists|raid_event.adds.in>10)
0.00 avengers_shield,if=talent.refining_fire.enabled&talent.lights_guidance.enabled
N 33.05 judgment,target_if=min:debuff.judgment.remains,if=(buff.avenging_wrath.up&talent.hammer_and_anvil.enabled)
O 0.22 holy_armaments,if=next_armament=holy_bulwark&charges=2
P 37.55 judgment,target_if=min:debuff.judgment.remains
0.00 avengers_shield,if=!buff.shake_the_heavens.up&talent.shake_the_heavens.enabled
0.00 hammer_of_the_righteous,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
Q 31.28 blessed_hammer,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
0.00 crusader_strike,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<2)|buff.shake_the_heavens.up
R 19.51 avengers_shield,if=!talent.lights_guidance.enabled
S 13.16 consecration,if=!consecration.up
T 4.43 eye_of_tyr,if=(talent.inmost_light.enabled&raid_event.adds.in>=45|spell_targets.shield_of_the_righteous>=3)&!talent.lights_deliverance.enabled
U 2.27 holy_armaments,if=next_armament=holy_bulwark
V 6.44 blessed_hammer
0.00 hammer_of_the_righteous
0.00 crusader_strike
W 6.01 word_of_glory,if=buff.shining_light_free.up&(talent.blessed_assurance.enabled|(talent.lights_guidance.enabled&cooldown.hammerfall_icd.remains=0))
0.00 avengers_shield
0.00 eye_of_tyr,if=!talent.lights_deliverance.enabled
0.00 word_of_glory,if=buff.shining_light_free.up
0.00 arcane_torrent,if=holy_power<5
X 0.12 consecration
actions.trinkets
# count action,conditions
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.avenging_wrath.up|fight_remains<=40)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready|!buff.avenging_wrath.up))|!variable.trinket_sync_slot)
Y 2.64 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.avenging_wrath.up|fight_remains<=40)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready|!buff.avenging_wrath.up))|!variable.trinket_sync_slot)

Sample Sequence

03689EFGYHLIMIHINQILNIQRNILQNIQSLINQIQINIKLNIQRNIILQHINIQLHINIQRPSTPIJUV