SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.5.57534 Live (hotfix 2024-11-14/57534, git build 9abb449df1)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Rhodonis : 848,942 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
848,942.4848,942.4421.4 / 0.050%85,083.3 / 10.0%972,069.9
Resource Out In Waiting APM Active
Holy Power0.90.90.95%57.7100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/rhodonis
TalentCYEA5ba6OK14IUITjS1kSUVJcBAAAYAgRjltZmlltZGLmZWWYbAAAAAAY2aaGGMjtZMmthxsNzyGzwYYYZjtBAAQmZabWmtZAAbADAADzA
Set Bonus
Scale Factors for Rhodonis Damage Per Second
Wdps Mastery Str Crit Vers Haste
Scale Factors 69.60 12.85 12.62 10.79 9.83 8.39
Normalized 5.51 1.02 1.00 0.86 0.78 0.66
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.28 0.26 0.26 0.26 0.26 0.26
Ranking
  • Wdps > Mastery ~= Str > Crit > Vers > Haste
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, Strength=12.62, CritRating=10.79, HasteRating=8.39, MasteryRating=12.85, Versatility=9.83, Dps=69.60 )

Scale Factors for other metrics

Scale Factors for Rhodonis Priority Target Damage Per Second
Wdps Mastery Str Crit Vers Haste
Scale Factors 69.60 12.85 12.62 10.79 9.83 8.39
Normalized 5.51 1.02 1.00 0.86 0.78 0.66
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.28 0.26 0.26 0.26 0.26 0.26
Ranking
  • Wdps > Mastery ~= Str > Crit > Vers > Haste
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, Strength=12.62, CritRating=10.79, HasteRating=8.39, MasteryRating=12.85, Versatility=9.83, Dps=69.60 )
Scale Factors for Rhodonis Damage Per Second (Effective)
Wdps Mastery Str Crit Vers Haste
Scale Factors 69.60 12.85 12.62 10.79 9.83 8.39
Normalized 5.51 1.02 1.00 0.86 0.78 0.66
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Mastery > Str > Crit > Vers > Haste
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, Strength=12.62, CritRating=10.79, HasteRating=8.39, MasteryRating=12.85, Versatility=9.83, Dps=69.60 )
Scale Factors for Rhodonis Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Rhodonis Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Rhodonis Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Rhodonis Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Rhodonis Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Rhodonis Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Rhodonis Fight Length
Str Wdps Mastery Crit Haste Vers
Scale Factors -0.00 -0.00 -0.00 0.00 0.00 0.00
Normalized 1.00 0.01 0.00 -0.50 -0.99 -1.50
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Str > Wdps > Mastery > Crit > Haste > Vers
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, Strength=0.00, CritRating=-0.00, HasteRating=-0.00, MasteryRating=0.00, Versatility=-0.00, Dps=0.00 )
Scale Factors for Raid Damage Per Second
Wdps Mastery Str Crit Vers Haste
Scale Factors 69.60 12.85 12.62 10.79 9.83 8.39
Normalized 5.51 1.02 1.00 0.86 0.78 0.66
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.28 0.26 0.26 0.26 0.26 0.26
Ranking
  • Wdps > Mastery ~= Str > Crit > Vers > Haste
Pawn string ( Pawn: v1: "Rhodonis-Retribution": Class=Paladin, Spec=Retribution, Strength=12.62, CritRating=10.79, HasteRating=8.39, MasteryRating=12.85, Versatility=9.83, Dps=69.60 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Rhodonis848,942
Blade of Justice 26,2603.1%27.810.54s283,370264,215Direct27.8217,913465,634283,36226.4%

Stats Details: Blade Of Justice

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage27.7827.780.000.000.001.07250.00007,872,284.677,872,284.670.00%264,214.96264,214.96
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.58%20.44734217,912.83195,670305,367217,866.97203,043235,9384,454,3384,454,3380.00%
crit26.42%7.34017465,634.49401,123626,003466,195.100622,7343,417,9473,417,9470.00%

Action Details: Blade Of Justice

  • id:184575
  • school:holy
  • range:12.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:184575
  • name:Blade of Justice
  • school:holy
  • tooltip:
  • description:{$?s403826=true}[Pierce enemies][Pierce an enemy] with a blade of light, dealing {$s1=0} Holy damage{$?s403826=true}[ to your target and {$404358s1=0} Holy damage to nearby enemies.][.] |cFFFFFFFFGenerates {$s2=1} Holy Power.|r

Action Priority List

    generators
    [T]:27.78
  • if_expr:holy_power<=3|!talent.holy_blade

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Cooldown DurationRetribution Paladin1370273SET1.000
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370276SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin13702719SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Spell Direct AmountPaladin Retribution 11.0 Class Set 2pc4536551PCT15.0%
(blade_of_justice_) Consecration 0 (9,165)0.0% (1.1%)17.317.35s159,0770

Stats Details: Blade Of Justice Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage17.270.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Blade Of Justice Consecration

  • id:26573
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=true}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=true}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
    (blade_of_justice_) Consecration 9,1651.1%0.00.00s00Periodic289.97,14615,4069,47728.2%0.0%

Stats Details: Blade Of Justice Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00289.880.000.00000.00002,747,234.222,747,234.220.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.78%208.081222967,145.876,3089,8457,145.786,8347,4831,486,9481,486,9480.00%
crit28.22%81.803313715,406.0212,93220,18215,407.8114,48616,6731,260,2861,260,2860.00%

Action Details: Blade Of Justice Consecration Tick

  • id:81297
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:11.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Divine Storm 11,116 (12,470)1.3% (1.5%)9.430.11s399,025372,694Direct9.4 (18.7)263,389580,940355,67329.1% (29.1%)

Stats Details: Divine Storm

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.379.370.000.000.001.07070.00003,331,033.913,331,033.910.00%372,694.04372,694.04
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.94%6.64018263,389.04163,341464,996263,103.380458,4371,750,0841,750,0840.00%
crit29.06%2.72012580,939.80335,675950,077543,361.330950,0771,580,9501,580,9500.00%

Action Details: Divine Storm

  • id:53385
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Unleashes a whirl of divine energy, dealing {$?s405289=true}[{$=}{{$s1=0}*1.05} Radiant][{$s1=0} Holy] damage to all nearby enemies. Deals reduced damage beyond {$s2=5} targets.

Action Priority List

    finishers
    [J]:9.37
  • if_expr:variable.ds_castable&!buff.hammer_of_light_ready.up&(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Divine Storm (_tempest) 1,3540.2%9.430.11s43,3480Direct9.432,41869,81643,34529.2%

Stats Details: Divine Storm Tempest

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.379.370.000.000.000.00000.0000405,969.19405,969.190.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.78%6.6301932,417.9728,40744,33332,388.79043,433214,888214,8880.00%
crit29.22%2.7401169,816.2958,23590,88365,594.50090,706191,082191,0820.00%

Action Details: Divine Storm Tempest

  • id:224239
  • school:holyfire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:224239
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:{$@spelldesc53385=Unleashes a whirl of divine energy, dealing {$?s405289=true}[{$=}{{$s1=0}*1.05} Radiant][{$s1=0} Holy] damage to all nearby enemies. Deals reduced damage beyond {$s2=5} targets.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Divine Toll 0 (21,619)0.0% (2.5%)5.262.43s1,247,8311,261,795

Stats Details: Divine Toll

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.200.000.000.000.000.98900.00000.000.000.00%1,261,795.191,261,795.19

Action Details: Divine Toll

  • id:375576
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:375576
  • name:Divine Toll
  • school:holy
  • tooltip:
  • description:Instantly cast {$?a137029=false}[Holy Shock]?a137028[Avenger's Shield]?a137027[Judgment][Holy Shock, Avenger's Shield, or Judgment] on up to {$s1=5} targets within {$=}A2 yds.{$?=}c3[ Divine Toll's Judgment deals {$326011s1=100}% increased damage.][]{$?=}c2[ Generates {$s5=1} Holy Power per target hit.][]

Action Priority List

    generators
    [O]:5.20
  • if_expr:holy_power<=2&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)&(cooldown.avenging_wrath.remains>15|cooldown.crusade.remains>15|talent.radiant_glory|fight_remains<8)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Global CooldownPaladin1370268SET1.000
    (divine_toll_) Judgment 9,5351.1%5.262.43s550,4670Direct5.2380,769781,574550,66142.4%

Stats Details: Divine Toll Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.205.200.000.000.000.00000.00002,861,063.232,861,063.230.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.62%2.9906380,769.19275,346442,003375,119.840441,1431,140,0351,140,0350.00%
crit42.38%2.2006781,574.25569,229906,107735,788.010906,1071,721,0281,721,0280.00%

Action Details: Divine Toll Judgment

  • id:20271
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.671596
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.11
  • base_multiplier:3.30

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=false}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    (divine_resonance_) Judgment 12,0841.4%15.118.87s240,2950Direct15.1169,459362,678240,38936.7%

Stats Details: Divine Resonance Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.0815.080.000.000.000.00000.00003,624,564.043,624,564.040.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit63.28%9.54317169,458.59137,334221,002169,592.37139,930197,4401,616,9041,616,9040.00%
crit36.72%5.54014362,677.65281,535453,053362,652.110449,1422,007,6602,007,6600.00%

Action Details: Divine Resonance Judgment

  • id:20271
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.671596
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.11
  • base_multiplier:1.65

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=false}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Empyrean Hammer 158,15818.6%369.50.80s128,4350Direct369.5 (369.5)94,456209,994128,43329.4% (29.4%)

Stats Details: Empyrean Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage369.51369.510.000.000.000.00000.000047,458,452.5447,458,452.540.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.59%260.8518435094,456.1259,502170,09094,436.4188,524101,44824,639,21724,639,2170.00%
crit29.41%108.6658160209,993.98121,980346,465210,079.04190,899232,62522,819,23522,819,2350.00%

Action Details: Empyrean Hammer

  • id:431398
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:431398
  • name:Empyrean Hammer
  • school:holy
  • tooltip:
  • description:A Holy Hammer called down from the skies to deal {$s1=0} Holy damage to its target.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Expurgation 21,8772.6%27.810.54s235,8930Periodic107.646,02898,72160,92428.3%72.7%

Stats Details: Expurgation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage27.780.00107.57107.5714.320.00002.02826,553,344.446,553,344.440.00%30,038.890.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.73%77.164811446,027.8814139,54546,037.5337,11057,8123,551,4003,551,4000.00%
crit28.27%30.41105398,720.5929288,69898,798.2373,206131,8843,001,9443,001,9440.00%

Action Details: Expurgation

  • id:383346
  • school:holyfire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.229500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.11
  • base_multiplier:1.21
  • dot_duration:9.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:383346
  • name:Expurgation
  • school:holyfire
  • tooltip:Suffering {$=}w1 {$?s403665=false}[Holy][Radiant] damage every {$t1=3} sec.{$?s406545=false}[ Holy damage taken from {$@=}auracaster increased by {$=}w2%.][]
  • description:{$@spelldesc383344=Your Blade of Justice causes the target to burn for {$383346=}o1 {$?s403665=false}[Holy][Radiant] damage over {$383346d=9 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Final Reckoning 11,1501.3%5.461.16s622,627552,258Direct5.4429,394881,470622,53442.7%

Stats Details: Final Reckoning

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.375.370.000.000.001.12760.00003,341,163.873,341,163.870.00%552,258.49552,258.49
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.26%3.0706429,394.49402,648484,864423,691.100483,9231,319,4401,319,4400.00%
crit42.74%2.2906881,470.42825,428993,970832,670.130993,9702,021,7242,021,7240.00%

Action Details: Final Reckoning

  • id:343721
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343721
  • name:Final Reckoning
  • school:holy
  • tooltip:Taking {$=}w3% increased damage from {$@=}auracaster's single target Holy Power abilities and {$s4=15}% increased damage from their other Holy Power abilities.
  • description:Call down a blast of heavenly energy, dealing {$s2=0} Holy damage to all targets in the area and causing them to take {$s3=30}% increased damage from your single target Holy Power abilities, and {$s4=15}% increased damage from other Holy Power abilities for {$d=12 seconds}. {$?s406158=false} [|cFFFFFFFFGenerates {$406158s1=3} Holy Power.][]

Action Priority List

    cooldowns
    [H]:5.37
  • if_expr:(holy_power>=4&time<8|holy_power>=3&time>=8|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(cooldown.avenging_wrath.remains>10|cooldown.crusade.remains&(!buff.crusade.up|buff.crusade.stack>=10)|talent.radiant_glory&(buff.avenging_wrath.up|talent.crusade&cooldown.wake_of_ashes.remains<gcd))&(!raid_event.adds.exists|raid_event.adds.up|raid_event.adds.in>40)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Final Verdict 120,79114.2%81.33.66s445,695413,477Direct81.3325,821731,145445,67029.6%

Stats Details: Final Verdict

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage81.2681.260.000.000.001.07790.000036,217,261.7836,217,261.780.00%413,476.82413,476.82
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.43%57.233386325,821.50206,296665,501325,775.70295,620356,72918,646,93318,646,9330.00%
crit29.57%24.03845731,145.23422,9071,368,780732,003.22609,377879,31017,570,32917,570,3290.00%

Action Details: Final Verdict

  • id:383328
  • school:holy
  • range:12.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:383328
  • name:Final Verdict
  • school:holy
  • tooltip:
  • description:Unleashes a powerful weapon strike that deals {$s1=0} {$?s403664=false}[Holystrike][Holy] damage to an enemy target, Final Verdict has a {$s2=15}% chance to reset the cooldown of Hammer of Wrath and make it usable on any target, regardless of their health.

Action Priority List

    finishers
    [K]:81.26
  • if_expr:(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hammer of Light 107,73712.7%16.718.00s1,937,8181,698,962Direct16.71,402,4753,189,7601,941,07330.1%

Stats Details: Hammer Of Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.6916.660.000.000.001.14060.000032,344,834.0532,344,834.050.00%1,698,961.761,698,961.76
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.86%11.644201,402,475.32843,4182,807,1021,399,721.751,070,2851,777,29616,324,32216,324,3220.00%
crit30.14%5.020143,189,759.871,729,0065,746,3643,190,979.4505,153,12416,020,51216,020,5120.00%

Action Details: Hammer Of Light

  • id:427453
  • school:holy
  • range:14.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:427453
  • name:Hammer of Light
  • school:holy
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$429826s1=0} Holy damage and {$=}{{$429826s1=0}/2} Holy damage up to 4 nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.

Action Priority List

    finishers
    [I]:16.69

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Global CooldownPaladin1370268SET1.000
Hammer of Wrath 19,9742.4%19.614.51s305,367276,325Direct19.6 (19.6)227,666492,008305,65329.5% (29.5%)

Stats Details: Hammer Of Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.6419.620.000.000.001.10510.00005,997,360.545,997,360.540.00%276,325.13276,325.13
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.50%13.83528227,665.78142,529349,501227,989.52182,663275,4623,149,4523,149,4520.00%
crit29.50%5.79016492,008.01292,184716,477491,973.090708,5512,847,9082,847,9080.00%

Action Details: Hammer Of Wrath

  • id:24275
  • school:holy
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$=}<damage> {$?s403664=false}[Holystrike][Holy] damage. Only usable on enemies that have less than 20% health{$?s326730=true}[, or during Avenging Wrath][]. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    generators
    [Q]:13.19
  • if_expr:(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)&(target.health.pct<35&talent.vengeful_wrath|buff.blessing_of_anshe.up)
    generators
    [U]:6.45
  • if_expr:(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Cooldown DurationRetribution Paladin1370273SET1.000
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin4123147PCT16.0%
Spell Direct AmountRetribution Paladin4123148PCT-14.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Cooldown Duration (Category)Paladin1370266SET1.000
Highlord's Judgment 17,6792.1%28.910.44s183,5810Direct28.9139,411280,297183,58731.3%

Stats Details: Highlords Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage28.9228.920.000.000.000.00000.00005,309,705.385,309,705.380.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.65%19.86640139,410.54131,552158,413139,350.54132,810147,7432,768,1822,768,1820.00%
crit31.35%9.07023280,296.60263,104316,827280,186.770315,8982,541,5242,541,5240.00%

Action Details: Highlords Judgment

  • id:383921
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383921
  • name:Highlord's Judgment
  • school:holy
  • tooltip:
  • description:Blasts the target with the Light, dealing {$s1=0} Holy damage.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Judgment 23,2352.7%33.98.92s205,784191,318Direct33.9156,011335,670205,85627.7%

Stats Details: Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage33.8733.860.000.000.001.07560.00006,969,729.126,969,729.120.00%191,318.39191,318.39
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.25%24.461337156,010.52137,334221,002155,948.61141,021169,4023,816,4763,816,4760.00%
crit27.75%9.39124335,670.30281,535453,053336,074.90284,773403,9283,153,2533,153,2530.00%

Action Details: Judgment

  • id:20271
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.671596
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.11
  • base_multiplier:1.65

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=false}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Action Priority List

    generators
    [S]:33.87
  • if_expr:holy_power<=3|!talent.boundless_judgment

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
melee 32,3533.8%139.32.58s69,66927,052Direct139.345,47294,45669,66649.4%

Stats Details: Melee

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage139.27139.270.000.000.002.57540.00009,702,486.7913,860,681.5530.00%27,052.2027,052.20
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit50.60%70.474210645,472.4741,74057,12245,467.0843,41147,8613,204,6254,578,03130.00%
crit49.40%68.793510194,455.6283,481114,24594,468.0090,70599,3046,497,8629,282,65030.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.20
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Searing Light 7,7120.9%6.842.43s341,8560Direct6.8253,978548,181341,83329.9%

Stats Details: Searing Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.776.770.000.000.000.00000.00002,313,057.402,313,057.400.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.14%4.75012253,977.82219,626342,754253,004.730340,6261,205,2911,205,2910.00%
crit29.86%2.0208548,180.80450,233702,647490,333.320702,6471,107,7661,107,7660.00%

Action Details: Searing Light

  • id:407478
  • school:holyfire
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:407478
  • name:Searing Light
  • school:holyfire
  • tooltip:
  • description:Calls down a explosion of Holy Fire dealing {$s2=0} Radiant damage to all nearby enemies and leaving a Consecration in its wake.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
(searing_light_) Consecration 0 (3,787)0.0% (0.4%)6.842.43s167,7360

Stats Details: Searing Light Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.770.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Searing Light Consecration

  • id:26573
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=true}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=true}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
    (searing_light_) Consecration 3,7870.4%0.00.00s00Periodic115.97,28415,7399,79129.7%0.0%

Stats Details: Searing Light Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00115.910.000.00000.00001,134,929.281,134,929.280.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit70.35%81.5451727,283.926,3089,8457,287.426,3509,470593,922593,9220.00%
crit29.65%34.3717915,739.4812,93220,18215,676.8213,02219,482541,007541,0070.00%

Action Details: Searing Light Consecration Tick

  • id:81297
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:11.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Shield of Vengeance (_proc) 33,4793.9%5.063.34s2,011,2950Direct5.02,011,28202,011,2820.0%

Stats Details: Shield Of Vengeance Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.005.000.000.000.000.00000.000010,056,476.7310,056,476.730.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%5.00462,011,281.531,984,9362,133,8132,010,846.551,984,9362,072,69610,056,47710,056,4770.00%

Action Details: Shield Of Vengeance Proc

  • id:184689
  • school:holy
  • range:8.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1984935.91
  • base_dd_max:1984935.91
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:184689
  • name:Shield of Vengeance
  • school:holy
  • tooltip:
  • description:{$@spelldesc184662=Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.}
Suffocating Darkness 25,2973.0%23.412.53s324,6280Periodic120.563,006063,0060.0%80.4%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage23.390.00120.54120.5416.630.00002.00007,594,469.127,594,469.120.00%31,502.390.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%120.547516963,005.8827,16291,97762,702.5534,81281,3677,594,4697,594,4690.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:23720.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Templar Slash 53,387 (87,738)6.3% (10.3%)30.99.62s852,572848,780Direct30.9 (153.2)373,286884,894518,81728.4% (28.4%)

Stats Details: Templar Slash

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage30.8530.850.000.000.001.00450.000016,006,736.0016,006,736.000.00%848,780.05848,780.05
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.55%22.081037373,286.35329,454514,155373,117.42344,886401,9278,240,9308,240,9300.00%
crit28.45%8.78120884,894.01744,5651,161,989886,013.96748,2391,080,8657,765,8067,765,8060.00%

Action Details: Templar Slash

  • id:406647
  • school:holyfire
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:406647
  • name:Templar Slash
  • school:holyfire
  • tooltip:
  • description:Complete the Templar combo, slash the target for {$=}<damage> {$?s403664=false}[Holystrike][Radiant] damage, and burn them over 4 sec for 50% of the damage dealt. |cFFFFFFFFGenerate {$s2=1} Holy Power.

Action Priority List

    generators
    [M]:21.84
  • if_expr:buff.templar_strikes.remains<gcd*2
    generators
    [V]:9.02

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Templar Slash (_dot) 34,3504.0%30.99.62s333,7510Periodic122.484,138084,1380.0%40.8%

Stats Details: Templar Slash Dot

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage30.850.00122.38122.380.380.00001.000010,296,957.8910,296,957.890.00%84,137.160.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%122.387616284,137.7146,659224,63484,135.7462,033112,25810,296,95810,296,9580.00%

Action Details: Templar Slash Dot

  • id:447142
  • school:holyfire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:41668.37
  • base_td_mult:1.00
  • base_multiplier:1.10
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:unknown

Spelldata

  • id:447142
  • name:Templar Slash
  • school:holyfire
  • tooltip:Burning for {$=}w1 damage every $t sec.
  • description:{$@spelldesc406647=Complete the Templar combo, slash the target for {$=}<damage> {$?s403664=false}[Holystrike][Radiant] damage, and burn them over 4 sec for 50% of the damage dealt. |cFFFFFFFFGenerate {$s2=1} Holy Power.}
Templar Strike 32,0883.8%33.98.97s283,769282,500Direct33.9203,378483,514283,76128.7%

Stats Details: Templar Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage33.9133.910.000.000.001.00450.00009,622,783.419,622,783.410.00%282,499.59282,499.59
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.30%24.181238203,378.20178,619278,758203,293.53189,742216,5324,917,7724,917,7720.00%
crit28.70%9.73121483,513.76403,679629,992484,034.94407,065568,3594,705,0124,705,0120.00%

Action Details: Templar Strike

  • id:407480
  • school:holyfire
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:10.750
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:407480
  • name:Templar Strike
  • school:holyfire
  • tooltip:
  • description:Begin the Templar combo, striking the target for {$=}<damage> {$?s403664=false} [Holystrike][Radiant] damage. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    generators
    [R]:33.91

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Hasted Cooldown Duration (Category)Retribution Paladin1370275SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Cooldown Duration (Category)Paladin1370264SET1.000
Wake of Ashes 20,534 (76,375)2.4% (9.0%)9.931.15s2,303,8852,050,273Direct9.9 (96.0)451,759969,782619,64832.4% (32.6%)

Stats Details: Wake Of Ashes

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.949.940.000.000.001.12380.00006,160,184.426,160,184.420.00%2,050,272.682,050,272.68
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.59%6.72212451,758.52392,716567,484450,953.25395,616534,8813,035,6933,035,6930.00%
crit32.41%3.22010969,782.13805,0671,163,343951,832.5401,161,0873,124,4913,124,4910.00%

Action Details: Wake Of Ashes

  • id:255937
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:3.0

Spelldata

  • id:255937
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.

Action Priority List

    generators
    [N]:9.94
  • if_expr:(!talent.lights_guidance|holy_power>=2&talent.lights_guidance)&(cooldown.avenging_wrath.remains>6|cooldown.crusade.remains>6|talent.radiant_glory)&(!talent.execution_sentence|cooldown.execution_sentence.remains>4|target.time_to_die<8)&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Spell Direct AmountPaladin Retribution 11.0 Class Set 2pc4536552PCT10.0%
Spell Periodic AmountPaladin Retribution 11.0 Class Set 2pc4536553PCT10.0%
    Truth's Wake 27,1643.2%9.931.15s818,7570Periodic66.288,692194,198122,85632.4%41.6%

Stats Details: Truths Wake

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.940.0066.2566.250.010.00001.88278,139,502.918,139,502.910.00%65,256.980.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit67.62%44.80316088,692.1334125,34188,818.7177,34299,8463,973,2403,973,2400.00%
crit32.38%21.45542194,197.6070256,950193,839.62133,346224,8854,166,2624,166,2620.00%

Action Details: Truths Wake

  • id:403695
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.544000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.22
  • base_multiplier:1.10
  • dot_duration:9.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:403695
  • name:Truth's Wake
  • school:holyfire
  • tooltip:{$?=}(s403696)[Burning for {$=}w2 damage every {$t2=3} sec and movement speed reduced by {$s1=50}%.] [Movement speed reduced by {$s1=50}%.]
  • description:Burns the targets for an additional {$=}o2 Radiant damage over {$d=9 seconds}, and slows them by {$s1=50}%.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Spell Direct AmountPaladin Retribution 11.0 Class Set 2pc4536552PCT10.0%
Spell Periodic AmountPaladin Retribution 11.0 Class Set 2pc4536553PCT10.0%
    Wake of Ashes (seething_flames_0) 14,3331.7%9.931.15s433,3230Direct9.9315,651677,410433,27932.5%

Stats Details: Seething Flames 0

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.929.920.000.000.000.00000.00004,300,380.954,300,380.950.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.48%6.70112315,650.87274,414396,535315,042.76276,808360,3912,113,7542,113,7540.00%
crit32.52%3.2309677,409.77562,548812,897664,696.460812,8972,186,6272,186,6270.00%

Action Details: Seething Flames 0

  • id:405345
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:405345
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:{$@spelldesc255937=Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Spell Direct AmountPaladin Retribution 11.0 Class Set 2pc4536552PCT10.0%
Spell Periodic AmountPaladin Retribution 11.0 Class Set 2pc4536553PCT10.0%
    Wake of Ashes (seething_flames_1) 14,3441.7%9.931.15s434,3190Direct9.9315,574677,275434,27032.8%

Stats Details: Seething Flames 1

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.919.910.000.000.000.00000.00004,303,527.774,303,527.770.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.17%6.66112315,573.74274,414396,535314,940.74276,234362,7992,100,5002,100,5000.00%
crit32.83%3.2509677,275.12562,548812,897663,163.590812,8972,203,0282,203,0280.00%

Action Details: Seething Flames 1

  • id:405350
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:405350
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:{$@spelldesc255937=Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin1370271PCT6.0%
Spell Periodic AmountRetribution Paladin1370272PCT6.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Spell Direct AmountPaladin Retribution 11.0 Class Set 2pc4536552PCT10.0%
Spell Periodic AmountPaladin Retribution 11.0 Class Set 2pc4536553PCT10.0%
Simple Action Stats Execute Interval
Rhodonis
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rhodonis
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Avenging Wrath 5.461.15s

Stats Details: Avenging Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.370.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Avenging Wrath

  • id:31884
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:Damage, healing, and critical strike chance increased by {$=}w2%. {$?a53376=false}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=false}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]increasing your damage, healing, and critical strike chance by {$s2=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [G]:5.37
  • if_expr:(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&talent.divine_auxiliary&(cooldown.execution_sentence.remains=0|cooldown.final_reckoning.remains=0))&(!raid_event.adds.up|target.time_to_die>10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell CooldownRetribution Paladin13702721ADD-60000.000
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rhodonis
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
The Sushi Special 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457302
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rhodonis
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5302.48s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.470.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [D]:1.47
  • if_expr:buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up|fight_remains<30
Sacrosanct Crusade (_heal) 16.718.00s

Stats Details: Sacrosanct Crusade Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal16.690.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sacrosanct Crusade Heal

  • id:461885
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rhodonis
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:357085.20
  • base_dd_max:357085.20
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461885
  • name:Sacrosanct Crusade
  • school:holy
  • tooltip:
  • description:{$@spelldesc431730={$?a137028=false}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=false}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=false}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=false}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
Shield of Vengeance 5.063.35s

Stats Details: Shield Of Vengeance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb5.005.000.000.000.000.60360.00000.000.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%5.00460.00000.0000000.00%

Action Details: Shield Of Vengeance

  • id:184662
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.7500
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:62.999
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rhodonis
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs {$=}w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.

Action Priority List

    cooldowns
    [F]:4.00
  • if_expr:fight_remains>15&(!talent.execution_sentence|!debuff.execution_sentence.up)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Avenging Wrath5.40.061.1s61.1s19.4s34.67%35.29%0.0 (0.0)5.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 67.5s
  • trigger_min/max:60.0s / 67.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:31.46% / 37.85%

Stack Uptimes

  • avenging_wrath_1:34.67%

Spelldata

  • id:31884
  • name:Avenging Wrath
  • tooltip:Damage, healing, and critical strike chance increased by {$=}w2%. {$?a53376=false}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=false}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]increasing your damage, healing, and critical strike chance by {$s2=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Blessing of Dawn57.80.75.2s5.1s1.8s34.35%53.67%0.0 (0.0)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_blessing_of_dawn
  • max_stacks:2
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.5s / 16.7s
  • trigger_min/max:1.9s / 14.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:26.53% / 42.93%

Stack Uptimes

  • blessing_of_dawn_1:34.12%
  • blessing_of_dawn_2:0.22%

Spelldata

  • id:385127
  • name:Blessing of Dawn
  • tooltip:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing.
  • description:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing. This effect stacks.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blessing of Dusk2.355.1111.7s5.2s129.3s98.31%0.00%55.1 (55.1)1.3

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_blessing_of_dusk
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 349.1s
  • trigger_min/max:0.6s / 17.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.1s
  • uptime_min/max:95.33% / 98.96%

Stack Uptimes

  • blessing_of_dusk_1:98.31%

Spelldata

  • id:385126
  • name:Blessing of Dusk
  • tooltip:Damage taken reduced by {$=}w1%{$?s385129=false}[, armor increased by {$=}w2%, and Holy Power generating abilities cool down {$=}w3% faster.][.]
  • description:Damage taken reduced by {$s1=4}%{$?s385129=false}&c2[, armor increased by {$s2=10}%, and Holy Power generating abilities cool down {$s3=10}% faster]?s385129[ and your Holy Power generating abilities also grant an absorb shield for {$s9=10}% of damage or healing dealt.][] For {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Deliberate Incubation1.0121.50.0s2.4s300.0s100.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_deliberate_incubation
  • max_stacks:30
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:152.49

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:1.0s / 27.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • deliberate_incubation_17:1.60%
  • deliberate_incubation_18:8.78%
  • deliberate_incubation_19:24.72%
  • deliberate_incubation_20:29.75%
  • deliberate_incubation_21:24.82%
  • deliberate_incubation_22:8.75%
  • deliberate_incubation_23:1.58%
  • deliberate_incubation_24:0.00%

Spelldata

  • id:449578
  • name:Deliberate Incubation
  • tooltip:{$=}pri increased by {$=}w1, and may be further increased by remaining stationary, up to {$u=30} times.
  • description:{$@spelldesc445066=Carefully balance the Egg's incubation. While stationary, gain {$s1=100} {$=}pri every {$t6=1} sec, up to {$s3=30} times. Diminishes while moving. While moving, gain {$s2=218} of your highest secondary stat every {$t6=1} sec, up to {$s3=30} times. Diminishes while stationary. Additional stacks above {$s5=20} grant {$s4=60}% reduced benefit. }
  • max_stacks:30
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Divine Purpose10.60.125.2s25.0s2.7s9.73%10.47%0.1 (0.1)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 273.3s
  • trigger_min/max:0.8s / 273.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.3s
  • uptime_min/max:0.39% / 22.93%

Stack Uptimes

  • divine_purpose_1:9.73%

Spelldata

  • id:408458
  • name:Divine Purpose
  • tooltip:Your next Holy Power spending ability is free and deals {$s2=10}% increased damage and healing.
  • description:{$@spelldesc408459=Holy Power spending abilities have a {$s1=10}% chance to make your next Holy Power spending ability free and deal {$408458s2=10}% increased damage and healing.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Resonance5.20.062.4s62.4s14.6s25.33%0.00%10.1 (10.1)4.9

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_divine_resonance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:60.0s / 74.1s
  • trigger_min/max:60.0s / 74.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:22.56% / 28.36%

Stack Uptimes

  • divine_resonance_1:25.33%

Spelldata

  • id:355455
  • name:Divine Resonance
  • tooltip:Casting {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$t1=5} sec for {$s2=15} sec.
  • description:{$@spelldesc355098=After casting Divine Toll, you instantly cast {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$355455t1=5} sec. This effect lasts {$355455s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Empyrean Power9.40.329.3s28.4s2.2s7.00%100.00%0.3 (0.3)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_empyrean_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.8s / 294.6s
  • trigger_min/max:1.0s / 294.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.2s
  • uptime_min/max:0.69% / 18.81%

Stack Uptimes

  • empyrean_power_1:7.00%

Spelldata

  • id:326733
  • name:Empyrean Power
  • tooltip:Your next Divine Storm is free and deals {$=}w1% additional damage.
  • description:{$@spelldesc326732={$?s404542=false}[Crusading Strikes has a {$s2=5}%][Crusader Strike has a {$s1=15}%] chance to make your next Divine Storm free and deal {$326733s1=15}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:326732
  • name:Empyrean Power
  • tooltip:
  • description:{$?s404542=false}[Crusading Strikes has a {$s2=5}%][Crusader Strike has a {$s1=15}%] chance to make your next Divine Storm free and deal {$326733s1=15}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Final Verdict10.22.027.6s22.7s5.6s19.19%18.70%2.0 (2.0)0.9

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_final_verdict
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 245.8s
  • trigger_min/max:0.8s / 245.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.7s
  • uptime_min/max:1.38% / 47.72%

Stack Uptimes

  • final_verdict_1:19.19%

Spelldata

  • id:337228
  • name:Final Verdict
  • tooltip:Hammer of Wrath can be used on any target.
  • description:{$@spelldesc336872=Unleashes a powerful weapon strike that deals {$s1=0} Holy damage to an enemy target. Has a {$s2=15}% chance to activate Hammer of Wrath and reset its cooldown.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of Alchemical Chaos (Crit)2.10.6112.0s76.8s35.3s24.98%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 351.1s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 213.3s
  • uptime_min/max:0.00% / 79.76%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.98%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6112.2s76.5s35.4s25.18%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 342.9s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 87.62%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.18%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.8s76.6s35.3s24.94%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 348.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 87.94%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.94%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6112.6s77.2s35.2s24.90%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 346.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 270.0s
  • uptime_min/max:0.00% / 85.37%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.90%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance (hammer_of_light_free)6.90.039.5s39.5s2.3s5.25%4.70%0.0 (0.0)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_hammer_of_light_free
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • hammer_of_light_free_1:5.25%

Spelldata

  • id:433732
  • name:Light's Deliverance
  • tooltip:
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=false}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hammer of Light (_ready)9.90.031.2s31.2s1.1s3.77%9.70%0.0 (0.0)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_hammer_of_light_ready
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.0s / 42.4s
  • trigger_min/max:30.0s / 42.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.5s
  • uptime_min/max:3.25% / 4.65%

Stack Uptimes

  • hammer_of_light_ready_1:3.77%

Spelldata

  • id:427453
  • name:Hammer of Light
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$429826s1=0} Holy damage and {$=}{{$429826s1=0}/2} Holy damage up to 4 nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance7.8361.740.4s0.8s36.9s96.34%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_lights_deliverance
  • max_stacks:50
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:28.0s / 55.0s
  • trigger_min/max:0.0s / 10.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.7s
  • uptime_min/max:91.77% / 98.42%

Stack Uptimes

  • lights_deliverance_1:2.30%
  • lights_deliverance_2:1.70%
  • lights_deliverance_3:1.19%
  • lights_deliverance_4:0.97%
  • lights_deliverance_5:0.82%
  • lights_deliverance_6:0.94%
  • lights_deliverance_7:1.14%
  • lights_deliverance_8:1.50%
  • lights_deliverance_9:1.70%
  • lights_deliverance_10:1.97%
  • lights_deliverance_11:1.72%
  • lights_deliverance_12:1.94%
  • lights_deliverance_13:2.00%
  • lights_deliverance_14:1.87%
  • lights_deliverance_15:2.10%
  • lights_deliverance_16:2.20%
  • lights_deliverance_17:1.85%
  • lights_deliverance_18:1.96%
  • lights_deliverance_19:2.18%
  • lights_deliverance_20:1.94%
  • lights_deliverance_21:1.96%
  • lights_deliverance_22:2.23%
  • lights_deliverance_23:1.96%
  • lights_deliverance_24:1.81%
  • lights_deliverance_25:2.05%
  • lights_deliverance_26:1.93%
  • lights_deliverance_27:1.85%
  • lights_deliverance_28:2.06%
  • lights_deliverance_29:2.20%
  • lights_deliverance_30:2.23%
  • lights_deliverance_31:2.32%
  • lights_deliverance_32:2.44%
  • lights_deliverance_33:2.35%
  • lights_deliverance_34:2.18%
  • lights_deliverance_35:2.08%
  • lights_deliverance_36:1.96%
  • lights_deliverance_37:1.99%
  • lights_deliverance_38:1.98%
  • lights_deliverance_39:2.05%
  • lights_deliverance_40:2.07%
  • lights_deliverance_41:2.11%
  • lights_deliverance_42:2.11%
  • lights_deliverance_43:2.11%
  • lights_deliverance_44:2.15%
  • lights_deliverance_45:2.22%
  • lights_deliverance_46:2.33%
  • lights_deliverance_47:2.44%
  • lights_deliverance_48:2.53%
  • lights_deliverance_49:2.62%
  • lights_deliverance_50:0.08%

Spelldata

  • id:433674
  • name:Light's Deliverance
  • tooltip:{$?=}{$=}W1=={$=}U[Ready to deliver Light's justice.][Building up Light's Deliverance. At {$u=60} stacks, your next Hammer of Light cast will activate another Hammer of Light for free.]
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=false}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:60
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Reckless Incubation (Crit)0.21.2106.5s3.3s12.8s0.96%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_reckless_incubation_Crit
  • max_stacks:30
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:147.34

Trigger Details

  • interval_min/max:4.0s / 266.0s
  • trigger_min/max:1.0s / 265.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 84.0s
  • uptime_min/max:0.00% / 28.17%

Stack Uptimes

  • reckless_incubation_Crit_7:0.04%
  • reckless_incubation_Crit_8:0.21%
  • reckless_incubation_Crit_9:0.27%
  • reckless_incubation_Crit_10:0.25%
  • reckless_incubation_Crit_11:0.15%
  • reckless_incubation_Crit_12:0.05%
  • reckless_incubation_Crit_13:0.01%

Spelldata

  • id:449593
  • name:Reckless Incubation
  • tooltip:Critical Strike increased by {$=}w1, and may be further increased by moving, up to {$u=30} times.
  • description:{$@spelldesc445066=Carefully balance the Egg's incubation. While stationary, gain {$s1=100} {$=}pri every {$t6=1} sec, up to {$s3=30} times. Diminishes while moving. While moving, gain {$s2=218} of your highest secondary stat every {$t6=1} sec, up to {$s3=30} times. Diminishes while stationary. Additional stacks above {$s5=20} grant {$s4=60}% reduced benefit. }
  • max_stacks:30
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Reckless Incubation (Haste)1.2119.8155.9s2.5s244.2s99.04%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_reckless_incubation_Haste
  • max_stacks:30
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:147.34

Trigger Details

  • interval_min/max:7.0s / 347.8s
  • trigger_min/max:1.0s / 88.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 360.0s
  • uptime_min/max:71.83% / 100.00%

Stack Uptimes

  • reckless_incubation_Haste_6:0.00%
  • reckless_incubation_Haste_7:1.55%
  • reckless_incubation_Haste_8:8.54%
  • reckless_incubation_Haste_9:24.55%
  • reckless_incubation_Haste_10:29.50%
  • reckless_incubation_Haste_11:24.57%
  • reckless_incubation_Haste_12:8.73%
  • reckless_incubation_Haste_13:1.59%

Spelldata

  • id:449581
  • name:Reckless Incubation
  • tooltip:Haste increased by {$=}w1, and may be further increased by moving, up to {$u=30} times.
  • description:{$@spelldesc445066=Carefully balance the Egg's incubation. While stationary, gain {$s1=100} {$=}pri every {$t6=1} sec, up to {$s3=30} times. Diminishes while moving. While moving, gain {$s2=218} of your highest secondary stat every {$t6=1} sec, up to {$s3=30} times. Diminishes while stationary. Additional stacks above {$s5=20} grant {$s4=60}% reduced benefit. }
  • max_stacks:30
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Rise From Ash9.90.031.2s31.2s7.9s26.16%30.43%0.0 (0.0)9.7

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_rise_from_ash
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.0s / 42.4s
  • trigger_min/max:30.0s / 42.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:23.31% / 28.07%

Stack Uptimes

  • rise_from_ash_1:26.16%

Spelldata

  • id:454693
  • name:Rise From Ash
  • tooltip:The damage of your spells and abilities is increased by {$s1=8}%.
  • description:{$@spelldesc453656=Wake of Ashes increases your damage done by {$454693s1=8}% for {$454693d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rush of Light10.618.528.5s10.1s17.8s62.99%59.67%18.5 (18.5)10.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_rush_of_light
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 157.6s
  • trigger_min/max:0.8s / 157.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 118.1s
  • uptime_min/max:29.93% / 86.54%

Stack Uptimes

  • rush_of_light_1:62.99%

Spelldata

  • id:407065
  • name:Rush of Light
  • tooltip:Haste increased by {$s1=5}%.
  • description:{$@spelldesc407067=The critical strikes of your damaging single target Holy Power abilities grant you {$s1=5}% Haste for {$407065d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sacrosanct Crusade13.413.322.7s11.1s12.0s53.64%49.76%13.3 (13.3)12.8

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_sacrosanct_crusade
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.0s / 47.7s
  • trigger_min/max:0.8s / 37.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.0s
  • uptime_min/max:46.75% / 59.35%

Stack Uptimes

  • sacrosanct_crusade_1:53.64%

Spelldata

  • id:461867
  • name:Sacrosanct Crusade
  • tooltip:Absorbs {$=}w1 damage.
  • description:{$@spelldesc431730={$?a137028=false}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=false}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=false}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=false}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sanctification54.00.080.3s5.6s98.4s98.27%98.15%0.0 (0.0)2.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_sanctification
  • max_stacks:20
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 357.6s
  • trigger_min/max:0.0s / 29.1s
  • trigger_pct:99.80%
  • duration_min/max:0.0s / 358.7s
  • uptime_min/max:90.70% / 99.71%

Stack Uptimes

  • sanctification_1:33.42%
  • sanctification_2:31.87%
  • sanctification_3:19.04%
  • sanctification_4:11.38%
  • sanctification_5:2.57%

Spelldata

  • id:433671
  • name:Sanctification
  • tooltip:Empyrean Hammer damage increased by {$=}w1%
  • description:{$@spelldesc432977=Casting Judgment increases the damage of Empyrean Hammer by {$433671s1=10}% for {$433671d=10 seconds}. Multiple applications may overlap.}
  • max_stacks:20
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Shake the Heavens9.17.633.3s33.3s26.8s80.92%81.37%125.1 (117.5)8.2

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_shake_the_heavens
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • shake_the_heavens_1:80.92%

Spelldata

  • id:431536
  • name:Shake the Heavens
  • tooltip:Casting Empyrean Hammer on a nearby target every $t sec.
  • description:{$@spelldesc431533=After casting Hammer of Light, you call down an Empyrean Hammer on a nearby target every {$431536=}T sec, for {$431536d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Shield of Vengeance5.05.063.3s27.2s10.0s16.65%0.00%5.0 (5.0)5.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:63.0s / 64.2s
  • trigger_min/max:0.0s / 64.2s
  • trigger_pct:100.00%
  • duration_min/max:10.0s / 10.0s
  • uptime_min/max:14.85% / 18.70%

Stack Uptimes

  • shield_of_vengeance_1:16.65%

Spelldata

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs {$=}w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Spelunker's Candle6.54.644.3s24.9s21.2s46.18%0.00%43.4 (43.4)6.1

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_spelunkers_candle
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:crit_rating
  • amount:2824.19

Trigger Details

  • interval_min/max:15.0s / 199.2s
  • trigger_min/max:0.0s / 117.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 149.4s
  • uptime_min/max:16.47% / 80.62%

Stack Uptimes

  • spelunkers_candle_1:46.18%

Spelldata

  • id:455420
  • name:Spelunker's Candle
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc455419=Your damaging spells and abilities have a chance to place a Spelunker's Candle on your head, granting {$s2=4306} Critical Strike for {$455420d=15 seconds}. Moving within 3 yards of an ally places the Spelunker's Candle on both heads, sharing the effect for the remaining duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Suspended Incubation2.90.0122.3s122.3s19.4s19.11%0.00%0.0 (0.0)2.8

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_suspended_incubation
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 130.3s
  • trigger_min/max:120.0s / 130.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:15.87% / 22.69%

Stack Uptimes

  • suspended_incubation_1:19.11%

Spelldata

  • id:445560
  • name:Suspended Incubation
  • tooltip:{$@=}spellname449578 and {$@=}spellname449581 are unaffected by your movements.
  • description:Suspend the Egg's incubation state for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Tempered Potion1.50.0302.6s302.6s27.4s13.22%0.00%0.0 (0.0)1.2

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 315.1s
  • trigger_min/max:300.0s / 315.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.88% / 18.00%

Stack Uptimes

  • tempered_potion_1:13.22%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Templar Strikes33.90.09.0s9.0s3.2s36.54%30.00%0.0 (0.0)2.7

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_templar_strikes
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.2s / 24.6s
  • trigger_min/max:5.2s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s
  • uptime_min/max:26.02% / 46.32%

Stack Uptimes

  • templar_strikes_1:36.54%

Spelldata

  • id:406648
  • name:Templar Strikes
  • tooltip:
  • description:Crusader Strike becomes a 3 part combo and deals radiant damage.
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Undisputed Ruling14.22.521.2s18.0s8.7s41.26%38.52%2.5 (2.5)13.8

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_undisputed_ruling
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • undisputed_ruling_1:41.26%

Spelldata

  • id:432629
  • name:Undisputed Ruling
  • tooltip:Haste increased by {$=}w1%
  • description:{$@spelldesc432626=Hammer of Light applies Judgment to its targets, and increases your Haste by {$432629s1=12}% for {$432629d=6 seconds}.{$?a137028=false}[ Additionally, Eye of Tyr grants {$s2=3} Holy Power.][]}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
The Sushi Special

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_the_sushi_special
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:470.00

Spelldata

  • id:461957
  • name:Well Fed
  • tooltip:Mastery increased by {$=}w9.
  • description:Increases Mastery by {$s1=0} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)23.27.046.012.5s1.8s190.4s
Art of War33.414.057.08.8s1.8s97.4s
Divine Purpose10.71.028.025.0s0.8s273.3s
Empyrean Power9.71.024.028.4s1.0s294.6s
Uptime Avg % Min Max Avg Dur Min Max
Holy Power Cap26.29%16.42%37.10%1.4s0.0s10.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Searing Light7.8350.000275.33557.8740.000275.335
(blade_of_justice_) Consecration1.6800.00066.06232.4381.921100.511
(searing_light_) Consecration22.8220.000275.335171.71553.663315.290
Shield of Vengeance0.2730.0001.2323.3160.00017.999
Avenging Wrath1.4650.0007.4527.8672.83618.944
Final Reckoning1.4710.0007.4527.8983.75318.944
Blade of Justice2.9330.00049.87985.18830.375153.958
Wake of Ashes1.6210.00012.39216.1467.69743.307
Divine Toll3.4390.00014.07517.9228.46234.053
Hammer of Wrath4.5780.000158.35990.19513.670239.287
Templar Strike1.2360.00016.08742.20617.11670.277
Judgment2.3930.00032.85382.46442.037133.014

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Rhodonis
Blade of JusticeHoly Power27.7855.5620.95%2.000.000.00%
Hammer of WrathHoly Power19.6419.647.41%1.000.000.00%
JudgmentHoly Power54.15102.0838.50%1.896.225.74%
Templar SlashHoly Power30.8530.8511.64%1.000.000.00%
Templar StrikeHoly Power33.9133.9112.79%1.000.000.01%
Wake of AshesHoly Power9.9423.108.71%2.326.7222.55%
Usage Type Count Total Tot% Avg RPE APR
Rhodonis
Final VerdictHoly Power81.26217.1282.87%2.672.67166,811.24
Hammer of LightHoly Power16.6944.8617.13%2.692.69720,947.96
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Holy Power0.00.880.8713.03.20.05.0

Statistics & Data Analysis

Fight Length
Rhodonis Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Rhodonis Damage Per Second
Count 9999
Mean 848942.37
Minimum 765138.78
Maximum 934517.97
Spread ( max - min ) 169379.19
Range [ ( max - min ) / 2 * 100% ] 9.98%
Standard Deviation 21500.6893
5th Percentile 813339.63
95th Percentile 884148.86
( 95th Percentile - 5th Percentile ) 70809.23
Mean Distribution
Standard Deviation 215.0176
95.00% Confidence Interval ( 848520.94 - 849363.79 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2465
0.1 Scale Factor Error with Delta=300 3946285
0.05 Scale Factor Error with Delta=300 15785140
0.01 Scale Factor Error with Delta=300 394628489
Priority Target DPS
Rhodonis Priority Target Damage Per Second
Count 9999
Mean 848942.37
Minimum 765138.78
Maximum 934517.97
Spread ( max - min ) 169379.19
Range [ ( max - min ) / 2 * 100% ] 9.98%
Standard Deviation 21500.6893
5th Percentile 813339.63
95th Percentile 884148.86
( 95th Percentile - 5th Percentile ) 70809.23
Mean Distribution
Standard Deviation 215.0176
95.00% Confidence Interval ( 848520.94 - 849363.79 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2465
0.1 Scale Factor Error with Delta=300 3946285
0.05 Scale Factor Error with Delta=300 15785140
0.01 Scale Factor Error with Delta=300 394628489
DPS(e)
Rhodonis Damage Per Second (Effective)
Count 9999
Mean 848942.37
Minimum 765138.78
Maximum 934517.97
Spread ( max - min ) 169379.19
Range [ ( max - min ) / 2 * 100% ] 9.98%
Damage
Rhodonis Damage
Count 9999
Mean 254665493.67
Minimum 191384004.88
Maximum 326129707.13
Spread ( max - min ) 134745702.25
Range [ ( max - min ) / 2 * 100% ] 26.46%
DTPS
Rhodonis Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Rhodonis Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Rhodonis Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Rhodonis Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Rhodonis Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 shield_of_vengeance
5 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
6 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
7 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%cooldown.crusade.duration=0|cooldown.crusade.duration%%trinket.1.cooldown.duration=0|trinket.1.cooldown.duration%%cooldown.avenging_wrath.duration=0|cooldown.avenging_wrath.duration%%trinket.1.cooldown.duration=0)
8 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%cooldown.crusade.duration=0|cooldown.crusade.duration%%trinket.2.cooldown.duration=0|trinket.2.cooldown.duration%%cooldown.avenging_wrath.duration=0|cooldown.avenging_wrath.duration%%trinket.2.cooldown.duration=0)
9 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 auto_attack
0.00 rebuke
B 0.00 call_action_list,name=cooldowns
C 0.00 call_action_list,name=generators
actions.cooldowns
# count action,conditions
D 1.47 potion,if=buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up|fight_remains<30
0.00 invoke_external_buff,name=power_infusion,if=buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up
0.00 lights_judgment,if=spell_targets.lights_judgment>=2|!raid_event.adds.exists|raid_event.adds.in>75|raid_event.adds.up
0.00 fireblood,if=buff.avenging_wrath.up|buff.crusade.up&buff.crusade.stack=10|debuff.execution_sentence.up
0.00 use_item,slot=trinket1,if=((buff.avenging_wrath.up&cooldown.avenging_wrath.remains>40|buff.crusade.up&buff.crusade.stack=10)&!talent.radiant_glory|talent.radiant_glory&(!talent.execution_sentence&cooldown.wake_of_ashes.remains=0|debuff.execution_sentence.up))&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
E 2.94 use_item,slot=trinket2,if=((buff.avenging_wrath.up&cooldown.avenging_wrath.remains>40|buff.crusade.up&buff.crusade.stack=10)&!talent.radiant_glory|talent.radiant_glory&(!talent.execution_sentence&cooldown.wake_of_ashes.remains=0|debuff.execution_sentence.up))&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!buff.crusade.up&cooldown.crusade.remains>20|!buff.avenging_wrath.up&cooldown.avenging_wrath.remains>20)
0.00 use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!buff.crusade.up&cooldown.crusade.remains>20|!buff.avenging_wrath.up&cooldown.avenging_wrath.remains>20)
F 4.00 shield_of_vengeance,if=fight_remains>15&(!talent.execution_sentence|!debuff.execution_sentence.up)
0.00 execution_sentence,if=(!buff.crusade.up&cooldown.crusade.remains>15|buff.crusade.stack=10|cooldown.avenging_wrath.remains<0.75|cooldown.avenging_wrath.remains>15|talent.radiant_glory)&(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(target.time_to_die>8&!talent.executioners_will|target.time_to_die>12)&cooldown.wake_of_ashes.remains<gcd
G 5.37 avenging_wrath,if=(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&talent.divine_auxiliary&(cooldown.execution_sentence.remains=0|cooldown.final_reckoning.remains=0))&(!raid_event.adds.up|target.time_to_die>10)
0.00 crusade,if=holy_power>=5&time<5|holy_power>=3&time>5
H 5.37 final_reckoning,if=(holy_power>=4&time<8|holy_power>=3&time>=8|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(cooldown.avenging_wrath.remains>10|cooldown.crusade.remains&(!buff.crusade.up|buff.crusade.stack>=10)|talent.radiant_glory&(buff.avenging_wrath.up|talent.crusade&cooldown.wake_of_ashes.remains<gcd))&(!raid_event.adds.exists|raid_event.adds.up|raid_event.adds.in>40)
actions.finishers
# count action,conditions
0.00 variable,name=ds_castable,value=(spell_targets.divine_storm>=2|buff.empyrean_power.up|!talent.final_verdict&talent.tempest_of_the_lightbringer)&!buff.empyrean_legacy.up&!(buff.divine_arbiter.up&buff.divine_arbiter.stack>24)
I 16.69 hammer_of_light
0.00 divine_hammer,if=holy_power=5
J 9.37 divine_storm,if=variable.ds_castable&!buff.hammer_of_light_ready.up&(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
0.00 justicars_vengeance,if=(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
K 81.26 templars_verdict,if=(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
actions.generators
# count action,conditions
L 0.00 call_action_list,name=finishers,if=holy_power=5|holy_power=4&buff.divine_resonance.up
M 21.84 templar_slash,if=buff.templar_strikes.remains<gcd*2
0.00 blade_of_justice,if=!dot.expurgation.ticking&talent.holy_flames
N 9.94 wake_of_ashes,if=(!talent.lights_guidance|holy_power>=2&talent.lights_guidance)&(cooldown.avenging_wrath.remains>6|cooldown.crusade.remains>6|talent.radiant_glory)&(!talent.execution_sentence|cooldown.execution_sentence.remains>4|target.time_to_die<8)&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)
O 5.20 divine_toll,if=holy_power<=2&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)&(cooldown.avenging_wrath.remains>15|cooldown.crusade.remains>15|talent.radiant_glory|fight_remains<8)
P 0.00 call_action_list,name=finishers,if=holy_power>=3&buff.crusade.up&buff.crusade.stack<10
0.00 templar_slash,if=buff.templar_strikes.remains<gcd&spell_targets.divine_storm>=2
0.00 blade_of_justice,if=(holy_power<=3|!talent.holy_blade)&(spell_targets.divine_storm>=2&talent.blade_of_vengeance)
Q 13.19 hammer_of_wrath,if=(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)&(target.health.pct<35&talent.vengeful_wrath|buff.blessing_of_anshe.up)
R 33.91 templar_strike
S 33.87 judgment,if=holy_power<=3|!talent.boundless_judgment
T 27.78 blade_of_justice,if=holy_power<=3|!talent.holy_blade
U 6.45 hammer_of_wrath,if=(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)
V 9.02 templar_slash
W 0.00 call_action_list,name=finishers,if=(target.health.pct<=20|buff.avenging_wrath.up|buff.crusade.up|buff.empyrean_power.up)
0.00 crusader_strike,if=cooldown.crusader_strike.charges_fractional>=1.75&(holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2)
X 0.00 call_action_list,name=finishers
0.00 hammer_of_wrath,if=holy_power<=3|target.health.pct>20|!talent.vanguards_momentum
0.00 crusader_strike
0.00 arcane_torrent

Sample Sequence

012456789ARSTGDEHKMNIORSKTKMKRSKKMKKRSKTKKURVKSKKKRTVJKKNIRSTKMUKRSVJIKTUKRSKMTFGHKRSKMNIOSJKRKTMKSKKRTIKMSKRUVKSKTNIRSVKTKSRVKKKSTKRUGEHFMKSUKNIKOIKRSJKMTKKRSKMKTKSRVJKTNIRSVKTKSRTIKMSKKRGHTKMFSKRUNIMOQJKRKQSKQKTRIKMQKSRKTVKSKTNIRSTKMTKRSKMQKTSGEHKQRVKFSQKTRIKMNIKOKQRSKMQKTKRQJKMSJKQRVKSNIQTRVIK

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0flask
[precombat]
Rhodonis 0.0/5 0% HoPo deliberate_incubation(20), reckless_incubation_Haste(10)
Pre1food
[precombat]
Rhodonis 0.0/5 0% HoPo deliberate_incubation(20), reckless_incubation_Haste(10)
Pre2augmentation
[precombat]
Rhodonis 0.0/5 0% HoPo deliberate_incubation(20), reckless_incubation_Haste(10)
Pre4shield_of_vengeance
[precombat]
Rhodonis 0.0/5 0% HoPo deliberate_incubation(20), reckless_incubation_Haste(10)
Pre5trinket_1_buffs
[precombat]
Rhodonis 0.0/5 0% HoPo shield_of_vengeance, deliberate_incubation(20), reckless_incubation_Haste(10)
Pre6trinket_2_buffs
[precombat]
Rhodonis 0.0/5 0% HoPo shield_of_vengeance, deliberate_incubation(20), reckless_incubation_Haste(10)
Pre7trinket_1_sync
[precombat]
Rhodonis 0.0/5 0% HoPo shield_of_vengeance, deliberate_incubation(20), reckless_incubation_Haste(10)
Pre8trinket_2_sync
[precombat]
Rhodonis 0.0/5 0% HoPo shield_of_vengeance, deliberate_incubation(20), reckless_incubation_Haste(10)
Pre9trinket_priority
[precombat]
Rhodonis 0.0/5 0% HoPo shield_of_vengeance, deliberate_incubation(20), reckless_incubation_Haste(10)
0:00.000Aauto_attack
[default]
Fluffy_Pillow 0.0/5 0% HoPo shield_of_vengeance, deliberate_incubation(20), reckless_incubation_Haste(10)
0:00.000Rtemplar_strike
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, shield_of_vengeance, deliberate_incubation(20), reckless_incubation_Haste(10)
0:01.005Sjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, templar_strikes, shield_of_vengeance, deliberate_incubation(21), reckless_incubation_Haste(9)
0:01.923Tblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, templar_strikes, shield_of_vengeance, sanctification, deliberate_incubation(20), reckless_incubation_Haste(10)
0:02.843Gavenging_wrath
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, templar_strikes, shield_of_vengeance, blessing_of_dawn, sanctification, deliberate_incubation(21), reckless_incubation_Haste(9)
0:02.843Dpotion
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, templar_strikes, avenging_wrath, shield_of_vengeance, blessing_of_dawn, sanctification, deliberate_incubation(21), reckless_incubation_Haste(9)
0:02.843Euse_item_ovinaxs_mercurial_egg
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, templar_strikes, avenging_wrath, shield_of_vengeance, blessing_of_dawn, sanctification, deliberate_incubation(21), reckless_incubation_Haste(9), tempered_potion
0:02.843Hfinal_reckoning
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, templar_strikes, avenging_wrath, shield_of_vengeance, blessing_of_dawn, sanctification, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:03.734Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, templar_strikes, avenging_wrath, shield_of_vengeance, blessing_of_dawn, sanctification, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:04.625Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, templar_strikes, avenging_wrath, shield_of_vengeance, blessing_of_dusk, sanctification, lights_deliverance, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:05.630Nwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, rush_of_light, avenging_wrath, shield_of_vengeance, blessing_of_dusk, sanctification, lights_deliverance, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:06.478Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance, sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:07.327Odivine_toll
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, rush_of_light, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(4), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:08.081Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(6), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:09.085Sjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, rush_of_light, templar_strikes, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(7), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:09.841Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, templar_strikes, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(7), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:10.595Tblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, templar_strikes, rise_from_ash, avenging_wrath, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(9), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:11.351Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, templar_strikes, rise_from_ash, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(10), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:12.105Mtemplar_slash
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, rush_of_light, templar_strikes, rise_from_ash, avenging_wrath, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(12), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:13.109Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, rise_from_ash, avenging_wrath, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(13), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:13.862Rtemplar_strike
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, rush_of_light, avenging_wrath, divine_purpose, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(15), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:14.865Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, templar_strikes, avenging_wrath, divine_purpose, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(16), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:15.713Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, templar_strikes, avenging_wrath, divine_purpose, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(16), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:16.562Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, templar_strikes, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(18), deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:17.409Mtemplar_slash
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, rush_of_light, templar_strikes, avenging_wrath, divine_purpose, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(19), deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:18.414Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, avenging_wrath, divine_purpose, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(19), deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:19.262Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(22), deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:20.110Rtemplar_strike
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, rush_of_light, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(22), deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:21.114Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, templar_strikes, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(23), deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:21.962Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, templar_strikes, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(23), deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, tempered_potion
0:22.810Tblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, rush_of_light, templar_strikes, avenging_wrath, divine_purpose, blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(5), lights_deliverance(25), deliberate_incubation(21), reckless_incubation_Haste(9), suspended_incubation, flask_of_alchemical_chaos_mastery, tempered_potion
0:23.696Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, templar_strikes, divine_purpose, blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(5), lights_deliverance(26), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_mastery, tempered_potion
0:24.585Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, templar_strikes, blessing_of_dusk, final_verdict, sanctification(4), lights_deliverance(29), deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_mastery, tempered_potion
0:25.475Uhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, blessing_of_dusk, final_verdict, sanctification(4), lights_deliverance(29), deliberate_incubation(23), reckless_incubation_Haste(7), flask_of_alchemical_chaos_mastery, tempered_potion
0:26.364Rtemplar_strike
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, rush_of_light, blessing_of_dusk, sanctification(4), lights_deliverance(29), deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_mastery, tempered_potion
0:27.369Vtemplar_slash
[generators]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, sanctification(3), lights_deliverance(29), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_mastery, tempered_potion
0:28.374Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, blessing_of_dawn, blessing_of_dusk, sanctification(3), lights_deliverance(29), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_mastery, tempered_potion
0:29.261Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, divine_purpose, blessing_of_dusk, sanctification(3), lights_deliverance(30), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_mastery, tempered_potion
0:30.149Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, divine_purpose, blessing_of_dusk, sanctification(3), lights_deliverance(30), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_mastery, tempered_potion
0:31.081Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, divine_purpose, blessing_of_dusk, sanctification(3), lights_deliverance(31), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_mastery, tempered_potion
0:32.013Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, blessing_of_dusk, sanctification(3), lights_deliverance(31), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_mastery, tempered_potion
0:32.943Rtemplar_strike
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, rush_of_light, blessing_of_dusk, sanctification(3), lights_deliverance(32), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_mastery
0:33.947Tblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, sanctification(2), lights_deliverance(32), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_mastery
0:34.863Vtemplar_slash
[generators]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(32), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_mastery
0:35.866Jdivine_storm
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, empyrean_power, blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(32), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_mastery
0:36.782Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, divine_purpose, blessing_of_dusk, sanctification, lights_deliverance(33), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_mastery
0:37.698Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, blessing_of_dusk, sanctification, lights_deliverance(33), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_mastery
0:38.612Nwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, rush_of_light, blessing_of_dusk, final_verdict, sanctification, lights_deliverance(34), deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_mastery
0:39.522Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, rush_of_light, rise_from_ash, blessing_of_dawn, blessing_of_dusk, final_verdict, hammer_of_light_ready, sanctification, lights_deliverance(34), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_mastery
0:40.435Rtemplar_strike
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(37), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_mastery
0:41.439Sjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, templar_strikes, rise_from_ash, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, lights_deliverance(39), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_mastery
0:42.476Tblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, rise_from_ash, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(40), sacrosanct_crusade, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_mastery
0:43.513Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, rise_from_ash, blessing_of_dawn, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(40), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_mastery
0:44.551Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, rise_from_ash, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(43), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_mastery
0:45.556Uhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(43), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_mastery
0:46.593Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(44), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_mastery
0:47.627Rtemplar_strike
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(46), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_mastery
0:48.836Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, empyrean_power, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(47), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_mastery
0:50.025Vtemplar_slash
[generators]
Fluffy_Pillow 4.0/5 80% HoPo templar_strikes, empyrean_power, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(48), spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_mastery
0:51.029Jdivine_storm
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo empyrean_power, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(48), spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_mastery
0:52.274Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance, spelunkers_candle, deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_vers
0:53.518Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(4), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_vers
0:54.601Tblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(9), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_vers
0:55.680Uhammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(9), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_vers
0:56.764Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(10), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_vers
0:57.846Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(12), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_vers
0:58.850Sjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(13), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_vers
0:59.882Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(13), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_vers
1:00.916Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(16), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_vers
1:01.921Tblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(17), sacrosanct_crusade, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_vers
1:03.114Fshield_of_vengeance
[cooldowns]
Rhodonis 5.0/5 100% HoPo rush_of_light, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(17), deliberate_incubation(23), reckless_incubation_Haste(7), flask_of_alchemical_chaos_vers
1:03.869Gavenging_wrath
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, shield_of_vengeance, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(17), deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_vers
1:03.869Hfinal_reckoning
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, avenging_wrath, shield_of_vengeance, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(17), deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_vers
1:05.062Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, avenging_wrath, shield_of_vengeance, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(18), deliberate_incubation(23), reckless_incubation_Haste(7), flask_of_alchemical_chaos_vers
1:06.258Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, avenging_wrath, shield_of_vengeance, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(21), deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_vers
1:07.261Sjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo templar_strikes, avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(21), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_vers
1:08.511Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo templar_strikes, avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(22), deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_vers
1:09.766Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, avenging_wrath, shield_of_vengeance, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(24), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_vers
1:10.770Nwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, empyrean_power, avenging_wrath, shield_of_vengeance, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(25), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_vers
1:11.960Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, empyrean_power, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, final_verdict, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(26), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_vers
1:13.149Odivine_toll
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rush_of_light, empyrean_power, rise_from_ash, avenging_wrath, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(29), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_vers
1:14.184Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, empyrean_power, rise_from_ash, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(32), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_vers
1:15.218Jdivine_storm
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, empyrean_power, rise_from_ash, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(32), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_vers
1:16.251Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, rise_from_ash, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(35), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_vers
1:17.285Rtemplar_strike
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, rise_from_ash, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(37), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_vers
1:18.290Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, rise_from_ash, avenging_wrath, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(38), sacrosanct_crusade, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_vers
1:19.328Tblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo templar_strikes, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(40), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_vers
1:20.416Mtemplar_slash
[generators]
Fluffy_Pillow 3.0/5 60% HoPo templar_strikes, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(41), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_vers
1:21.421Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo avenging_wrath, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(41), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_vers
1:22.670Sjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo avenging_wrath, divine_purpose, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(44), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
1:23.920Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_purpose, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(45), deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
1:25.173Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(5), lights_deliverance(47), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:26.423Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, final_verdict, divine_resonance, hammer_of_light_free, sanctification(3), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
1:27.428Tblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo templar_strikes, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, hammer_of_light_free, sanctification(3), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:28.679Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo templar_strikes, blessing_of_dawn, blessing_of_dusk, final_verdict, hammer_of_light_free, sanctification(4), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
1:29.928Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(4), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
1:30.962Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(7), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:31.966Sjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), sacrosanct_crusade, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
1:33.005Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(8), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:34.042Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(11), sacrosanct_crusade, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
1:35.267Uhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(12), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:36.305Vtemplar_slash
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(12), sacrosanct_crusade, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
1:37.310Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(13), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:38.502Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(15), sacrosanct_crusade, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
1:39.695Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(16), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:40.887Tblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(18), deliberate_incubation(23), reckless_incubation_Haste(7), flask_of_alchemical_chaos_crit
1:42.081Nwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(19), deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
1:43.274Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rise_from_ash, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification(2), lights_deliverance(20), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:44.526Rtemplar_strike
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(24), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
1:45.530Sjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo templar_strikes, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(26), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
1:46.614Vtemplar_slash
[generators]
Fluffy_Pillow 3.0/5 60% HoPo templar_strikes, rise_from_ash, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(26), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
1:47.618Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rise_from_ash, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(27), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:48.706 Waiting0.879s 1.0/5 20% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(29), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
1:49.585Tblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(30), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
1:50.756Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(30), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
1:51.791Sjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(33), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:53.003Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(33), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:54.009Vtemplar_slash
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(34), spelunkers_candle, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
1:55.014Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(34), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:56.206Kfinal_verdict
[finishers]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(37), spelunkers_candle, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
1:57.402Kfinal_verdict
[finishers]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(40), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
1:58.594 Waiting0.110s 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(42), spelunkers_candle, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
1:58.704Sjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(42), spelunkers_candle, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
2:00.131Tblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, sanctification(2), lights_deliverance(43), deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
2:01.324Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, sanctification(2), lights_deliverance(43), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
2:02.576Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, final_verdict, sanctification(2), lights_deliverance(44), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:03.580Uhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, blessing_of_dusk, final_verdict, sanctification(2), lights_deliverance(44), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:04.764Gavenging_wrath
[cooldowns]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(44), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:04.764Euse_item_ovinaxs_mercurial_egg
[cooldowns]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(44), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:04.764Hfinal_reckoning
[cooldowns]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(44), deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:05.953Fshield_of_vengeance
[cooldowns]
Rhodonis 4.0/5 80% HoPo rush_of_light, templar_strikes, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(44), deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:06.867Mtemplar_slash
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(44), deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:07.872Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(44), deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:09.061Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, avenging_wrath, shield_of_vengeance, blessing_of_dusk, sanctification, lights_deliverance(45), deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:10.252Uhammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, avenging_wrath, shield_of_vengeance, blessing_of_dusk, sanctification(2), lights_deliverance(45), deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:11.442Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(45), deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:12.691Nwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, avenging_wrath, divine_purpose, shield_of_vengeance, blessing_of_dusk, final_verdict, sanctification, lights_deliverance(46), deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:13.882Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, rise_from_ash, avenging_wrath, divine_purpose, shield_of_vengeance, blessing_of_dusk, final_verdict, hammer_of_light_ready, sanctification, lights_deliverance(46), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:15.070Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(49), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:16.103Odivine_toll
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dusk, final_verdict, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(3), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:17.139Ihammer_of_light
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, rise_from_ash, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(4), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:18.175Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, rise_from_ash, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(7), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:19.207Rtemplar_strike
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, rise_from_ash, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(12), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:20.213Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, empyrean_power, rise_from_ash, avenging_wrath, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(12), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:21.247Jdivine_storm
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, empyrean_power, avenging_wrath, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(13), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:22.281Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(15), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:23.312Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, avenging_wrath, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(18), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:24.318Tblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, avenging_wrath, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(18), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), suspended_incubation, flask_of_alchemical_chaos_crit
2:25.349Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(19), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:26.378Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(22), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:27.563Rtemplar_strike
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(24), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:28.567Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(25), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:29.751Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(25), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:30.933Mtemplar_slash
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, templar_strikes, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(28), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:31.938Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(5), lights_deliverance(28), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:33.122Tblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(31), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
2:34.307Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(31), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:35.491Sjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(34), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:36.825Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, sanctification(4), lights_deliverance(36), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:37.828Vtemplar_slash
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, empyrean_power, blessing_of_dawn, blessing_of_dusk, sanctification(4), lights_deliverance(36), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
2:38.832Jdivine_storm
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, empyrean_power, blessing_of_dawn, blessing_of_dusk, sanctification(3), lights_deliverance(36), deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
2:40.022Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dusk, sanctification(3), lights_deliverance(37), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:41.208 Waiting1.211s 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, sanctification(2), lights_deliverance(38), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:42.419Tblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, sanctification(2), lights_deliverance(38), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:43.750Nwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dusk, sanctification, lights_deliverance(38), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
2:44.936Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rise_from_ash, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance(38), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:46.177Rtemplar_strike
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(41), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:47.181Sjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo templar_strikes, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(43), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:48.261Vtemplar_slash
[generators]
Fluffy_Pillow 3.0/5 60% HoPo templar_strikes, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(44), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:49.265Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rise_from_ash, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(44), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:50.345 Waiting0.901s 1.0/5 20% HoPo rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(47), sacrosanct_crusade, deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_crit
2:51.246Tblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(47), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:52.553Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(48), sacrosanct_crusade, deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_crit
2:53.634Sjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, final_verdict, hammer_of_light_free, shake_the_heavens, sanctification, lights_deliverance, sacrosanct_crusade, deliberate_incubation(17), reckless_incubation_Haste(13), flask_of_alchemical_chaos_crit
2:54.903Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, final_verdict, hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance, sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
2:55.906Tblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo templar_strikes, blessing_of_dawn, blessing_of_dusk, final_verdict, hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(2), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
2:57.154Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo templar_strikes, blessing_of_dawn, blessing_of_dusk, final_verdict, hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance(2), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
2:58.403Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(7), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
2:59.441Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, divine_purpose, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(11), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
3:00.446Sjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, divine_purpose, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(11), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
3:01.538Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, divine_purpose, blessing_of_dawn, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(12), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
3:02.573Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(14), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
3:03.608Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(17), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
3:04.612Gavenging_wrath
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(17), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
3:04.764Hfinal_reckoning
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, avenging_wrath, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(17), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
3:05.798Tblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, avenging_wrath, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(18), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
3:06.990Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, avenging_wrath, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(18), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
3:08.182Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo templar_strikes, avenging_wrath, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(21), spelunkers_candle, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
3:09.187Fshield_of_vengeance
[cooldowns]
Rhodonis 3.0/5 60% HoPo avenging_wrath, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(21), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
3:09.940Sjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(22), spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
3:11.189Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(22), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
3:12.435Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, avenging_wrath, shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(25), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
3:13.440Uhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, empyrean_power, avenging_wrath, shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(26), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
3:14.631Nwake_of_ashes
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, empyrean_power, avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(26), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
3:15.819Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, empyrean_power, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(27), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
3:17.006Mtemplar_slash
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rush_of_light, templar_strikes, empyrean_power, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(30), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
3:18.010Odivine_toll
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, empyrean_power, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(33), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
3:19.045Qhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, empyrean_power, rise_from_ash, avenging_wrath, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(33), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
3:20.077Jdivine_storm
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, empyrean_power, rise_from_ash, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(34), sacrosanct_crusade, deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_crit
3:21.106Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, rise_from_ash, avenging_wrath, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(36), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
3:22.139Rtemplar_strike
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, rise_from_ash, avenging_wrath, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(39), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
3:23.144Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(39), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_haste
3:24.130Qhammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, templar_strikes, avenging_wrath, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(42), sacrosanct_crusade, deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_haste
3:25.114Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(2), lights_deliverance(42), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_haste
3:26.247Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(43), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
3:27.381Qhammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(45), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_haste
3:28.516Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(46), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
3:29.650Tblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(49), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_haste
3:30.782Rtemplar_strike
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(49), spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
3:31.785Ihammer_of_light
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, divine_resonance, hammer_of_light_free, shake_the_heavens, sanctification(3), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_haste
3:32.922Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(3), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_haste
3:33.908Mtemplar_slash
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(8), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_haste
3:34.911Qhammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(8), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_haste
3:35.897Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(9), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
3:36.885Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(11), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_haste
3:37.871Rtemplar_strike
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(12), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_haste
3:39.010Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(12), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_haste
3:39.995Tblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(15), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
3:40.984Vtemplar_slash
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(15), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_haste
3:41.987Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(16), spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
3:43.119Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(18), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_haste
3:44.293Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(19), spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
3:45.428Tblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(21), deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_haste
3:46.565Nwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(22), deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_haste
3:47.704Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, rise_from_ash, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification(2), lights_deliverance(23), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_haste
3:48.841Rtemplar_strike
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(26), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_haste
3:49.845Sjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo templar_strikes, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(29), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
3:50.883Tblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo templar_strikes, rise_from_ash, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(29), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_haste
3:51.919Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo templar_strikes, rise_from_ash, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(30), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
3:52.955Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(32), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
3:53.959Tblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(33), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
3:54.988Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(33), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
3:56.018Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(36), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
3:57.201Sjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(36), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
3:58.383Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(37), deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
3:59.569Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(40), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
4:00.573Qhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(40), deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_crit
4:01.755Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(41), deliberate_incubation(17), reckless_incubation_Haste(13), flask_of_alchemical_chaos_crit
4:02.934Tblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(43), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
4:04.348Sjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(44), deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_crit
4:05.617Gavenging_wrath
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(45), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
4:05.617Euse_item_ovinaxs_mercurial_egg
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo avenging_wrath, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(45), deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
4:05.617Hfinal_reckoning
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo avenging_wrath, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(45), deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:06.859Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo avenging_wrath, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(45), deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:08.101Qhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo avenging_wrath, blessing_of_dusk, sanctification(2), lights_deliverance(48), deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:09.344Rtemplar_strike
[generators]
Fluffy_Pillow 3.0/5 60% HoPo avenging_wrath, blessing_of_dusk, sanctification, lights_deliverance(48), deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:10.348Vtemplar_slash
[generators]
Fluffy_Pillow 4.0/5 80% HoPo templar_strikes, avenging_wrath, blessing_of_dusk, sanctification, lights_deliverance(48), deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:11.352Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo avenging_wrath, blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(48), deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:12.593Fshield_of_vengeance
[cooldowns]
Rhodonis 2.0/5 40% HoPo avenging_wrath, blessing_of_dusk, sanctification, lights_deliverance(49), deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:13.347Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo avenging_wrath, shield_of_vengeance, blessing_of_dusk, sanctification, lights_deliverance(49), deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:14.587Qhammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo avenging_wrath, shield_of_vengeance, blessing_of_dusk, sanctification(2), lights_deliverance(49), deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:15.828Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo avenging_wrath, shield_of_vengeance, blessing_of_dusk, sanctification(2), lights_deliverance(49), deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:17.069Tblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, avenging_wrath, divine_purpose, shield_of_vengeance, blessing_of_dusk, hammer_of_light_free, sanctification, deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:18.250Rtemplar_strike
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, avenging_wrath, divine_purpose, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, sanctification, deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:19.254Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, avenging_wrath, divine_purpose, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, sanctification, deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:20.437Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, avenging_wrath, shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(3), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:21.464Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, avenging_wrath, divine_purpose, shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(7), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:22.466Nwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, avenging_wrath, divine_purpose, shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(8), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:23.496Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, rise_from_ash, avenging_wrath, divine_purpose, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(8), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:24.523Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, rise_from_ash, avenging_wrath, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(12), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:25.550Odivine_toll
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, rise_from_ash, avenging_wrath, blessing_of_dusk, undisputed_ruling, shake_the_heavens, lights_deliverance(16), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), suspended_incubation, flask_of_alchemical_chaos_crit
4:26.578Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(17), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
4:27.608Qhammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(19), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
4:28.640Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(20), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
4:29.645Sjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, rise_from_ash, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(20), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
4:30.675Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(21), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
4:31.705Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(23), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
4:32.709Qhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(24), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(18), reckless_incubation_Haste(12), flask_of_alchemical_chaos_crit
4:34.037Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(25), spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
4:35.223Tblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(27), spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
4:36.404Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(28), spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
4:37.590Rtemplar_strike
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(30), spelunkers_candle, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_crit
4:38.595Qhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, templar_strikes, empyrean_power, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(31), spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
4:39.934Jdivine_storm
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, empyrean_power, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(32), spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
4:41.118Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo templar_strikes, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(34), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
4:42.365Mtemplar_slash
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, templar_strikes, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(37), spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
4:43.369Sjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, empyrean_power, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(37), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
4:44.556Jdivine_storm
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, empyrean_power, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(38), spelunkers_candle, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
4:45.745Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, blessing_of_dusk, sanctification(3), lights_deliverance(41), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
4:46.931Qhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, sanctification(3), lights_deliverance(42), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
4:48.119Rtemplar_strike
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, sanctification(2), lights_deliverance(42), spelunkers_candle, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_crit
4:49.124Vtemplar_slash
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, blessing_of_dawn, blessing_of_dusk, sanctification(2), lights_deliverance(42), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
4:50.127Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, sanctification(2), lights_deliverance(42), spelunkers_candle, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_crit
4:51.313Sjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo rush_of_light, blessing_of_dusk, sanctification(2), lights_deliverance(43), spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_crit
4:52.501Nwake_of_ashes
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, blessing_of_dawn, blessing_of_dusk, sanctification(3), lights_deliverance(43), spelunkers_candle, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_haste
4:53.639Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, rise_from_ash, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, sanctification(2), lights_deliverance(43), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(23), reckless_incubation_Haste(7), flask_of_alchemical_chaos_haste
4:54.779Qhammer_of_wrath
[generators]
Fluffy_Pillow 0.0/5 0% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(46), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(22), reckless_incubation_Haste(8), flask_of_alchemical_chaos_haste
4:55.768Tblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(48), sacrosanct_crusade, spelunkers_candle, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_haste
4:56.757Rtemplar_strike
[generators]
Fluffy_Pillow 3.0/5 60% HoPo rush_of_light, rise_from_ash, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(49), sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
4:57.761Vtemplar_slash
[generators]
Fluffy_Pillow 4.0/5 80% HoPo rush_of_light, templar_strikes, rise_from_ash, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(49), sacrosanct_crusade, deliberate_incubation(21), reckless_incubation_Haste(9), flask_of_alchemical_chaos_haste
4:58.766Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, rise_from_ash, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification, sacrosanct_crusade, deliberate_incubation(20), reckless_incubation_Haste(10), flask_of_alchemical_chaos_haste
4:59.755Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo rush_of_light, rise_from_ash, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(3), sacrosanct_crusade, deliberate_incubation(19), reckless_incubation_Haste(11), flask_of_alchemical_chaos_haste

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength176470533744924427449 (27449)
Agility61760617661760
Stamina864520297571283401171186
Intellect17647018176176470
Spirit00000
Health595142056680200
Holy Power550
Spell Power18176613790
Crit23.65%18.60%6719
Haste20.55%18.00%11878
Versatility11.55%8.55%6671
Attack Power5653549713469
Mastery28.52%26.39%5282
Armor489974899748997
Run Speed700

Gear

Source Slot Average Item Level: 614.00
Local Head Entombed Seraph's Casque
ilevel: 623, stats: { 6,689 Armor, +19,463 Sta, +621 Crit, +1,256 Mastery, +3,269 StrInt }
Local Neck Enkindled Locket
ilevel: 619, stats: { +10,359 Sta, +3,094 Haste, +2,188 Mastery }
Local Shoulders Entombed Seraph's Plumes
ilevel: 619, stats: { 5,991 Armor, +13,812 Sta, +943 Vers, +437 Mastery, +2,362 StrInt }
Local Shirt Stormwind Doublet
ilevel: 1
Local Chest Entombed Seraph's Breastplate
ilevel: 619, stats: { 8,714 Armor, +18,416 Sta, +1,283 Haste, +558 Vers, +3,149 StrInt }
Local Waist Girdle of the Gleaming Dawn
ilevel: 606, stats: { 4,556 Armor, +11,469 Sta, +914 Vers, +377 Mastery, +2,093 StrInt }
Local Legs Entombed Seraph's Greaves
ilevel: 619, stats: { 7,625 Armor, +18,416 Sta, +1,288 Crit, +552 Haste, +3,149 StrInt }
Local Feet Tide-Stomper's Greaves
ilevel: 613, stats: { 5,263 Armor, +12,693 Sta, +612 Crit, +727 Haste, +2,234 StrInt }
Local Wrists Handguards of Hidden Stars
ilevel: 610, stats: { 4,141 Armor, +9,112 Sta, +410 Haste, +579 Vers, +1,629 StrInt }
Local Hands Entombed Seraph's Castigation
ilevel: 606, stats: { 4,556 Armor, +11,469 Sta, +385 Crit, +906 Haste, +2,093 StrInt }
Local Finger1 Dark Abyss Hoop
ilevel: 619, stats: { +10,359 Sta, +1,735 Haste, +3,546 Vers }
Local Finger2 Unearthed Relic Band
ilevel: 606, stats: { +8,601 Sta, +2,298 Crit, +2,433 Haste }
Local Trinket1 Spelunker's Waning Candle
ilevel: 610, stats: { +2,753 StrAgi }
item effects: { equip: Spelunker's Waning Candle }
Local Trinket2 Ovi'nax's Mercurial Egg
ilevel: 616
item effects: { equip: Ovi'nax's Mercurial Egg, use: Suspended Incubation }
Local Back Cave Topographer's Drape
ilevel: 606, stats: { 1,462 Armor, +8,601 Sta, +463 Crit, +505 Haste, +1,569 StrAgiInt }
Local Main Hand Everforged Greataxe
ilevel: 619, weapon: { 5,547 - 11,522, 3.6 }, stats: { +18,416 Sta, +920 Crit, +920 Mastery, +3,149 StrAgi }, enchant: authority_of_the_depths_3, temporary_enchant: Ironclaw Sharpened Weapon
Local Tabard Tabard of the Lightbringer
ilevel: 32
item effects: { use: }

Talents

Talent Tables

Paladin Talents [31]
1
2
3
4
5
6
7
8
9
10
Retribution Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

paladin="Rhodonis"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/rhodonis"
spec=retribution
level=80
race=human
role=attack
position=back
talents=CYEA5ba6OK14IUITjS1kSUVJcBAAAYAgRjltZmlltZGLmZWWYbAAAAAAY2aaGGMjtZMmthxsNzyGzwYYYZjtBAAQmZabWmtZAAbADAADzA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=the_sushi_special
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3

head=entombed_seraphs_casque,id=211993,bonus_id=6652/10876/10371/10261/1524/10255
neck=enkindled_locket,id=219184,bonus_id=6652/10395/10392/10262/3198/10255
shoulders=entombed_seraphs_plumes,id=211991,bonus_id=10369/6652/10262/1520/10255
back=cave_topographers_drape,id=211005,bonus_id=6652/10377/10270/1511/10255
chest=entombed_seraphs_breastplate,id=211996,bonus_id=10373/6652/10262/1520/10255
shirt=stormwind_doublet,id=45667
tabard=tabard_of_the_lightbringer,id=52252
wrists=handguards_of_hidden_stars,id=219151,bonus_id=10265/6652/10877/10377/3189/10255
hands=entombed_seraphs_castigation,id=211994,bonus_id=10372/6652/10274/1507/10255
waist=girdle_of_the_gleaming_dawn,id=225746,bonus_id=6652/10876/10376/10354/10270/1507/10255
legs=entombed_seraphs_greaves,id=211992,bonus_id=10370/6652/10262/1520/10255
feet=tidestompers_greaves,id=150445,bonus_id=7756/10376/8902/10264/10048/10255
finger1=dark_abyss_hoop,id=219188,bonus_id=6652/10394/10393/10262/3198/10255
finger2=unearthed_relic_band,id=211061,bonus_id=6652/10395/10393/10270/1511/10255
trinket1=spelunkers_waning_candle,id=225638,bonus_id=6652/10265/3139/10255
trinket2=ovinaxs_mercurial_egg,id=220305,bonus_id=6652/10355/10263/1517/10255
main_hand=everforged_greataxe,id=222443,bonus_id=10421/9633/8902/9627/8791/10222/11143,enchant=authority_of_the_depths_3,crafted_stats=vers/crit

# Gear Summary
# gear_ilvl=614.00
# gear_strength=27449
# gear_stamina=171186
# gear_attack_power=469
# gear_crit_rating=6587
# gear_haste_rating=11645
# gear_mastery_rating=5178
# gear_versatility_rating=6540
# gear_armor=48997
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 43746988
Max Event Queue: 90
Sim Seconds: 3006781
CPU Seconds: 44.0763
Physical Seconds: 23.9585
Speed Up: 68218

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Rhodonis Rhodonis augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Rhodonis Rhodonis avenging_wrath 31884 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.15sec 0 299.99sec
Rhodonis Rhodonis blade_of_justice 184575 7872285 26242 5.56 217913 465634 27.8 27.8 26.4% 0.0% 0.0% 0.0% 10.54sec 7872285 299.99sec
Rhodonis Rhodonis blade_of_justice_consecration 26573 0 0 0.00 0 0 17.3 0.0 0.0% 0.0% 0.0% 0.0% 17.35sec 0 299.99sec
Rhodonis Rhodonis blade_of_justice_consecration_tick ticks -81297 2747234 9157 0.00 7146 15406 0.0 0.0 28.2% 0.0% 0.0% 0.0% 0.00sec 2747234 299.99sec
Rhodonis Rhodonis divine_storm 53385 3331034 11104 1.87 263389 580940 9.4 9.4 29.1% 0.0% 0.0% 0.0% 30.11sec 3331034 299.99sec
Rhodonis Rhodonis divine_storm_tempest 224239 405969 1353 1.87 32418 69816 9.4 9.4 29.2% 0.0% 0.0% 0.0% 30.11sec 405969 299.99sec
Rhodonis Rhodonis divine_toll 375576 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.43sec 0 299.99sec
Rhodonis Rhodonis divine_toll_judgment 20271 2861063 9537 1.04 380769 781574 5.2 5.2 42.4% 0.0% 0.0% 0.0% 62.43sec 2861063 299.99sec
Rhodonis Rhodonis divine_resonance_judgment 20271 3624564 12082 3.02 169459 362678 15.1 15.1 36.7% 0.0% 0.0% 0.0% 18.87sec 3624564 299.99sec
Rhodonis Rhodonis empyrean_hammer 431398 47458453 158201 73.91 94456 209994 369.5 369.5 29.4% 0.0% 0.0% 0.0% 0.80sec 47458453 299.99sec
Rhodonis Rhodonis expurgation ticks -383346 6553344 21844 21.51 46028 98721 27.8 107.6 28.3% 0.0% 0.0% 0.0% 10.54sec 6553344 299.99sec
Rhodonis Rhodonis final_reckoning 343721 3341164 11138 1.07 429394 881470 5.4 5.4 42.7% 0.0% 0.0% 0.0% 61.16sec 3341164 299.99sec
Rhodonis Rhodonis final_verdict 383328 36217262 120729 16.25 325821 731145 81.3 81.3 29.6% 0.0% 0.0% 0.0% 3.66sec 36217262 299.99sec
Rhodonis Rhodonis flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Rhodonis Rhodonis food 457302 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Rhodonis Rhodonis hammer_of_light 427453 32344834 107820 3.33 1402475 3189760 16.7 16.7 30.1% 0.0% 0.0% 0.0% 18.00sec 32344834 299.99sec
Rhodonis Rhodonis hammer_of_wrath 24275 5997361 19992 3.92 227666 492008 19.6 19.6 29.5% 0.0% 0.0% 0.0% 14.51sec 5997361 299.99sec
Rhodonis Rhodonis highlords_judgment 383921 5309705 17700 5.78 139411 280297 28.9 28.9 31.3% 0.0% 0.0% 0.0% 10.44sec 5309705 299.99sec
Rhodonis Rhodonis judgment 20271 6969729 23233 6.77 156011 335670 33.9 33.9 27.7% 0.0% 0.0% 0.0% 8.92sec 6969729 299.99sec
Rhodonis Rhodonis melee 0 9702487 32343 27.85 45472 94456 139.3 139.3 49.4% 0.0% 0.0% 0.0% 2.58sec 13860682 299.99sec
Rhodonis Rhodonis potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.48sec 0 299.99sec
Rhodonis Rhodonis sacrosanct_crusade_heal 461885 0 0 0.00 0 0 16.7 0.0 0.0% 0.0% 0.0% 0.0% 18.00sec 0 299.99sec
Rhodonis Rhodonis searing_light 407478 2313057 7710 1.35 253978 548181 6.8 6.8 29.9% 0.0% 0.0% 0.0% 42.43sec 2313057 299.99sec
Rhodonis Rhodonis searing_light_consecration 26573 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 42.43sec 0 299.99sec
Rhodonis Rhodonis searing_light_consecration_tick ticks -81297 1134929 3783 0.00 7284 15739 0.0 0.0 29.7% 0.0% 0.0% 0.0% 0.00sec 1134929 299.99sec
Rhodonis Rhodonis shield_of_vengeance 184662 0 0 1.00 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 63.35sec 0 299.99sec
Rhodonis Rhodonis shield_of_vengeance_proc 184689 10056477 33523 1.00 2011282 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 63.34sec 10056477 299.99sec
Rhodonis Rhodonis suffocating_darkness ticks -449217 7594469 25315 24.11 63006 0 23.4 120.5 0.0% 0.0% 0.0% 0.0% 12.53sec 7594469 299.99sec
Rhodonis Rhodonis templar_slash 406647 16006736 53358 6.17 373286 884894 30.9 30.9 28.4% 0.0% 0.0% 0.0% 9.62sec 16006736 299.99sec
Rhodonis Rhodonis templar_slash_dot ticks -447142 10296958 34323 24.48 84138 0 30.9 122.4 0.0% 0.0% 0.0% 0.0% 9.62sec 10296958 299.99sec
Rhodonis Rhodonis templar_strike 407480 9622783 32077 6.78 203378 483514 33.9 33.9 28.7% 0.0% 0.0% 0.0% 8.97sec 9622783 299.99sec
Rhodonis Rhodonis wake_of_ashes 255937 6160184 20535 1.99 451759 969782 9.9 9.9 32.4% 0.0% 0.0% 0.0% 31.15sec 6160184 299.99sec
Rhodonis Rhodonis truths_wake ticks -403695 8139503 27132 13.25 88692 194198 9.9 66.2 32.4% 0.0% 0.0% 0.0% 31.15sec 8139503 299.99sec
Rhodonis Rhodonis seething_flames_0 405345 4300381 14335 1.98 315651 677410 9.9 9.9 32.5% 0.0% 0.0% 0.0% 31.15sec 4300381 299.99sec
Rhodonis Rhodonis seething_flames_1 405350 4303528 14346 1.98 315574 677275 9.9 9.9 32.8% 0.0% 0.0% 0.0% 31.15sec 4303528 299.99sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health831,851.00.00.00%0.0100.0%

Scale Factors for other metrics

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Final Reckoning5.40.061.1s61.1s11.8s21.08%21.34%0.0 (0.0)5.2

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_final_reckoning
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.8s / 67.5s
  • trigger_min/max:60.0s / 67.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:18.89% / 23.31%

Stack Uptimes

  • final_reckoning_1:21.08%

Spelldata

  • id:343721
  • name:Final Reckoning
  • tooltip:Taking {$=}w3% increased damage from {$@=}auracaster's single target Holy Power abilities and {$s4=15}% increased damage from their other Holy Power abilities.
  • description:Call down a blast of heavenly energy, dealing {$s2=0} Holy damage to all targets in the area and causing them to take {$s3=30}% increased damage from your single target Holy Power abilities, and {$s4=15}% increased damage from other Holy Power abilities for {$d=12 seconds}. {$?s406158=false} [|cFFFFFFFFGenerates {$406158s1=3} Holy Power.][]
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:0.00%
Judgment70.70.010.3s4.2s11.0s81.56%86.91%0.0 (0.0)0.0

Buff Details

  • buff initial source:Rhodonis
  • cooldown name:buff_judgment
  • max_stacks:20
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 46.2s
  • trigger_min/max:0.0s / 22.9s
  • trigger_pct:99.80%
  • duration_min/max:0.0s / 36.5s
  • uptime_min/max:71.02% / 91.32%

Stack Uptimes

  • judgment_1:17.40%
  • judgment_2:21.37%
  • judgment_3:12.32%
  • judgment_4:12.29%
  • judgment_5:7.69%
  • judgment_6:5.76%
  • judgment_7:2.96%
  • judgment_8:1.35%
  • judgment_9:0.39%
  • judgment_10:0.03%
  • judgment_11:0.00%

Spelldata

  • id:197277
  • name:Judgment
  • tooltip:Taking {$=}w1% increased damage from {$@=}auracaster's next Holy Power ability.
  • description:{$@spelldesc20271=Judges the target, dealing {$s1=0} {$?s403664=false}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]}
  • max_stacks:20
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 848942.37
Minimum 765138.78
Maximum 934517.97
Spread ( max - min ) 169379.19
Range [ ( max - min ) / 2 * 100% ] 9.98%
Standard Deviation 21500.6893
5th Percentile 813339.63
95th Percentile 884148.86
( 95th Percentile - 5th Percentile ) 70809.23
Mean Distribution
Standard Deviation 215.0176
95.00% Confidence Interval ( 848520.94 - 849363.79 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2465
0.1 Scale Factor Error with Delta=300 3946285
0.05 Scale Factor Error with Delta=300 15785140
0.01 Scale Factor Error with Delta=300 394628489
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health01991803570
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.