SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.5.57171 Live (hotfix 2024-10-22/57171, git build 798d7fc4fd)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Lycrow : 842,228 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
842,227.7842,227.7587.0 / 0.070%116,735.9 / 13.9%30,439.7
Resource Out In Waiting APM Active
Energy27.726.919.86%43.7100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/lycrow
TalentCMQA27SZpS4XnmFfcXRqkppuwPjZmhxMYAAAAAAYWglZAAAAAAottZmxMzMGzMz2sNGjZYGzMzMmZz2YGgtZWGLMmxs0Y2WGmsNMsA
Scale Factors for Lycrow Damage Per Second
Wdps Agi Mastery Haste Crit Vers
Scale Factors 75.73 13.95 12.02 11.61 10.27 9.96
Normalized 5.43 1.00 0.86 0.83 0.74 0.71
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.40 0.37 0.37 0.36 0.36 0.36
Ranking
  • Wdps > Agi > Mastery > Haste > Crit ~= Vers
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, Agility=13.95, CritRating=10.27, HasteRating=11.61, MasteryRating=12.02, Versatility=9.96, Dps=75.73 )

Scale Factors for other metrics

Scale Factors for Lycrow Priority Target Damage Per Second
Wdps Agi Mastery Haste Crit Vers
Scale Factors 75.73 13.95 12.02 11.61 10.27 9.96
Normalized 5.43 1.00 0.86 0.83 0.74 0.71
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.40 0.37 0.37 0.36 0.36 0.36
Ranking
  • Wdps > Agi > Mastery > Haste > Crit ~= Vers
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, Agility=13.95, CritRating=10.27, HasteRating=11.61, MasteryRating=12.02, Versatility=9.96, Dps=75.73 )
Scale Factors for Lycrow Damage Per Second (Effective)
Wdps Agi Mastery Haste Crit Vers
Scale Factors 75.73 13.95 12.02 11.61 10.27 9.96
Normalized 5.43 1.00 0.86 0.83 0.74 0.71
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Agi > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, Agility=13.95, CritRating=10.27, HasteRating=11.61, MasteryRating=12.02, Versatility=9.96, Dps=75.73 )
Scale Factors for Lycrow Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Fight Length
Wdps Agi Vers Crit Haste Mastery
Scale Factors -0.00 -0.00 -0.00 -0.00 -0.00 -0.00
Normalized 1.03 1.00 0.51 0.51 0.03 0.01
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, Agility=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=0.00, Versatility=0.00, Dps=0.00 )
Scale Factors for Raid Damage Per Second
Wdps Agi Mastery Haste Crit Vers
Scale Factors 75.73 13.95 12.02 11.61 10.27 9.96
Normalized 5.43 1.00 0.86 0.83 0.74 0.71
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.40 0.37 0.37 0.36 0.36 0.36
Ranking
  • Wdps > Agi > Mastery > Haste > Crit ~= Vers
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, Agility=13.95, CritRating=10.27, HasteRating=11.61, MasteryRating=12.02, Versatility=9.96, Dps=75.73 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Lycrow842,228
Ambush 18,409 (40,015)2.2% (4.8%)24.312.67s494,879492,679Direct24.3 (48.5)167,098368,546227,60430.0% (15.0%)0.0%

Stats Details: Ambush

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage24.2524.250.000.000.001.00450.00005,519,610.717,885,150.2730.00%492,679.17492,679.17
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.97%16.97240167,097.5299,358208,232167,367.98140,582191,5402,835,2144,050,30130.00%
crit30.03%7.28021368,546.00218,587458,110368,798.980444,7432,684,3973,834,84929.97%

Action Details: Ambush

  • id:8676
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:60
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing {$s1=0} Physical damage.{$?s383281=false}[ Has a {$193315s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;{$?s383281=false}[ each time it strikes][].|r

Action Priority List

    direct
    [R]:21.62
  • if_expr:variable.use_filler&(buff.blindside.up|stealthed.rogue)&(!dot.kingsbane.ticking|debuff.deathmark.down|buff.blindside.up)
    stealthed
    [Y]:2.63
  • if_expr:!debuff.deathstalkers_mark.up&talent.deathstalkers_mark

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Resource CostVicious Venoms3816342ADD10.000
    Ambush (_vicious_venoms) 21,6052.6%0.00.00s00Direct24.3267,2650267,2650.0%0.0%

Stats Details: Ambush Vicious Venoms

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0024.250.000.000.000.00000.00006,481,561.126,481,561.120.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%24.25559267,265.1699,342648,621267,508.93181,991381,9466,481,5616,481,5610.00%

Action Details: Ambush Vicious Venoms

  • id:385794
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:83460.64
  • base_dd_max:83460.64
  • base_dd_mult:1.00
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385794
  • name:Ambush
  • school:nature
  • tooltip:
  • description:{$@spelldesc381634=Ambush and Mutilate cost {$s2=5} more Energy and deal {$s1=35}% additional damage as Nature.}
Amplifying Poison 21,8532.6%0.00.00s00Direct331.215,23730,57519,79029.7%0.0%

Stats Details: Amplifying Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00331.240.000.000.000.00000.00006,555,203.496,555,203.490.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.32%232.9214232415,237.509,63929,92515,231.3714,17916,6273,549,1783,549,1780.00%
crit29.68%98.325315830,574.8919,27859,85130,566.8627,96033,5053,006,0263,006,0260.00%

Action Details: Amplifying Poison

  • id:383414
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383414
  • name:Amplifying Poison
  • school:nature
  • tooltip:Envenom consumes stacks to amplify its damage.
  • description:{$@spelldesc381664=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy, dealing {$383414s1=0} Nature damage and applying Amplifying Poison for {$383414d=12 seconds}. Envenom can consume {$s2=10} stacks of Amplifying Poison to deal {$s1=35}% increased damage. Max {$383414u=20} stacks.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Auto Attack 0 (96,658)0.0% (11.5%)3.9121.21s7,495,4070

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.870.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 26,3613.1%344.11.01s22,98122,807Direct344.120,28240,59722,98029.6%16.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage344.05344.050.000.000.001.00760.00007,906,564.5111,295,080.8730.00%22,807.3122,807.31
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit54.06%186.0012225620,281.7917,88522,90620,280.6319,89420,8273,772,4955,389,27330.00%
crit29.60%101.834915640,596.6435,77045,81240,597.8239,76041,8444,134,0705,905,80830.00%
miss16.34%56.2227920.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 13,1371.6%343.11.01s11,48411,395Direct343.110,14120,30011,48429.6%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage343.07343.070.000.000.001.00790.00003,939,928.945,628,464.2930.00%11,394.7511,394.75
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit54.07%185.5112125810,141.248,94211,45310,140.709,94710,4141,881,2702,687,52530.00%
crit29.56%101.415016120,299.7117,88522,90620,299.9019,84820,9012,058,6592,940,93930.00%
miss16.37%56.1526920.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Hunt Them Down 57,1616.8%451.50.81s37,9820Direct451.529,27458,71437,98229.6%0.0%

Stats Details: Hunt Them Down

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage451.53451.530.000.000.000.00000.000017,150,138.8817,150,138.880.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.42%317.9721642729,273.6123,30154,31929,265.4227,67430,7959,307,9589,307,9580.00%
crit29.58%133.577619358,714.2446,602108,63858,713.6154,68163,3907,842,1817,842,1810.00%

Action Details: Hunt Them Down

  • id:457193
  • school:shadowstorm
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:457193
  • name:Hunt Them Down
  • school:shadowstorm
  • tooltip:
  • description:{$@spelldesc457054=Auto-attacks against Marked targets deal an additional {$457193s1=0} Plague damage.}
Deadly Poison (_driver) 0 (37,772)0.0% (4.5%)0.00.00s00

Stats Details: Deadly Poison Driver

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Deadly Poison Driver

  • id:2823
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2823
  • name:Deadly Poison
  • school:physical
  • tooltip:Each strike has a chance of causing the target to suffer Nature damage every {$2818t1=2} sec for {$2818d=12 seconds}. Subsequent poison applications deal instant Nature damage.
  • description:Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy for {$=}{{$2818m1=0}*{$2818d=12 seconds}/{$2818t1=2}} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Periodic AmountVirulent Poisons3815432PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Spell Periodic AmountFatal Concoction3923842PCT10.0%
    Deadly Poison (_instant) 21,7842.6%0.00.00s00Direct330.015,25130,60219,80729.7%0.0%

Stats Details: Deadly Poison Instant

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00329.950.000.000.000.00000.00006,535,122.826,535,122.820.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.32%232.0314831615,250.629,83229,92515,243.8014,33616,3663,538,5863,538,5860.00%
crit29.68%97.925414930,601.5419,66459,85130,591.5327,97433,1012,996,5362,996,5360.00%

Action Details: Deadly Poison Instant

  • id:113780
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Periodic AmountVirulent Poisons3815432PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Spell Periodic AmountFatal Concoction3923842PCT10.0%
    Deadly Poison (_dot) 15,9871.9%0.00.00s00Periodic177.520,83441,79627,02929.6%0.0%99.3%

Stats Details: Deadly Poison Dot

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.00177.47177.47329.950.00001.67904,796,735.704,796,735.700.00%16,097.890.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit70.45%125.028417020,833.7413,90141,81520,826.5119,53322,2252,604,6822,604,6820.00%
crit29.55%52.45278541,795.6916,61382,16241,786.6237,49146,9012,192,0532,192,0530.00%

Action Details: Deadly Poison Dot

  • id:2818
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.113740
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.21
  • base_multiplier:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=2} seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy for {$=}{{$2818m1=0}*{$2818d=12 seconds}/{$2818t1=2}} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Periodic AmountVirulent Poisons3815432PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Spell Periodic AmountFatal Concoction3923842PCT10.0%
Deathmark 9,579 (51,627)1.1% (6.1%)2.9123.67s5,296,5095,273,874Periodic30.3 (243.6)72,341144,67494,46630.6% (30.6%)0.0%

Stats Details: Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.910.0030.3130.310.001.00451.49922,863,603.522,863,603.520.00%319,103.445,273,873.95
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit69.41%21.0483172,341.1726100,73272,255.5558,99382,7761,522,1711,522,1710.00%
crit30.59%9.27021144,674.1370201,465144,628.320178,6521,341,4331,341,4330.00%

Action Details: Deathmark

  • id:360194
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:360194
  • name:Deathmark
  • school:physical
  • tooltip:Bleeding for {$=}w damage every $t sec. Duplicating {$@=}auracaster's Garrote, Rupture, and Lethal poisons applied.
  • description:Carve a deathmark into an enemy, dealing {$=}o1 Bleed damage over {$d=16 seconds}. While marked your Garrote, Rupture, and Lethal poisons applied to the target are duplicated, dealing {$?a134735=false}[{$=}{100+{$394331s1=0}+{$394331s3=50}}%][{$=}{100+{$394331s1=0}}%] of normal damage.

Action Priority List

    cds
    [G]:2.92
  • if_expr:(variable.deathmark_condition&target.time_to_die>=10)|fight_remains<=20
    Garrote (_deathmark) 16,4822.0%0.00.00s00Periodic28.9124,424275,336170,55530.6%0.0%15.1%

Stats Details: Garrote Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.0028.9128.912.660.00001.56654,930,340.544,930,340.540.00%108,878.400.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit69.43%20.07630124,424.3186180,366124,262.1393,867145,3982,497,2312,497,2310.00%
crit30.57%8.84121275,336.11151396,806275,223.47158,780358,8672,433,1102,433,1100.00%

Action Details: Garrote Deathmark

  • id:360830
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.346000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.38
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:360830
  • name:Garrote
  • school:physical
  • tooltip:Suffering {$=}w1 damage every {$t1=2} seconds.
  • description:{$@spelldesc360194=Carve a deathmark into an enemy, dealing {$=}o1 Bleed damage over {$d=16 seconds}. While marked your Garrote, Rupture, and Lethal poisons applied to the target are duplicated, dealing {$?a134735=false}[{$=}{100+{$394331s1=0}+{$394331s3=50}}%][{$=}{100+{$394331s1=0}}%] of normal damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Periodic AmountBloody Mess3816261PCT15.0%
Spell Periodic AmountShrouded Suffocation3854781PCT20.0%
    Rupture (_deathmark) 12,3121.5%0.00.00s00Periodic29.097,048194,145126,72130.6%0.0%15.2%

Stats Details: Rupture Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.0029.0429.040.610.00001.56923,679,393.213,679,393.210.00%80,750.430.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit69.44%20.1683097,047.6352130,70896,879.6980,392107,4041,956,9261,956,9260.00%
crit30.56%8.87119194,145.41678261,415193,975.55138,815238,0091,722,4671,722,4670.00%

Action Details: Rupture Deathmark

  • id:360826
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.314900
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.65
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:360826
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:{$@spelldesc360194=Carve a deathmark into an enemy, dealing {$=}o1 Bleed damage over {$d=16 seconds}. While marked your Garrote, Rupture, and Lethal poisons applied to the target are duplicated, dealing {$?a134735=false}[{$=}{100+{$394331s1=0}+{$394331s3=50}}%][{$=}{100+{$394331s1=0}}%] of normal damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountAssassination Rogue13703725PCT30.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountBloody Mess3816261PCT15.0%
Spell Periodic AmountSanguine Stratagem4575125PCT5.0%
    Amplifying Poison (_deathmark) 5,0230.6%0.00.00s00Direct63.118,23936,46623,78730.4%0.0%

Stats Details: Amplifying Poison Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0063.140.000.000.000.00000.00001,501,960.361,501,960.360.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.56%43.92137318,238.8110,83224,33118,202.1415,51820,528801,115801,1150.00%
crit30.44%19.2243936,466.0521,66548,66336,416.3229,00541,655700,845700,8450.00%

Action Details: Amplifying Poison Deathmark

  • id:394328
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394328
  • name:Amplifying Poison
  • school:nature
  • tooltip:Envenom consumes stacks to amplify its damage.
  • description:{$@spelldesc381664=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy, dealing {$383414s1=0} Nature damage and applying Amplifying Poison for {$383414d=12 seconds}. Envenom can consume {$s2=10} stacks of Amplifying Poison to deal {$s1=35}% increased damage. Max {$383414u=20} stacks.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
    Deadly Poison (_dot_deathmark) 3,2090.4%0.00.00s00Periodic29.025,29350,53933,02730.6%0.0%15.2%

Stats Details: Deadly Poison Dot Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.0029.0429.0463.180.00001.5728959,000.95959,000.950.00%20,998.950.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit69.36%20.1473025,293.1414,67433,99825,250.5121,04428,699509,434509,4340.00%
crit30.64%8.9002050,539.4930,27267,99650,496.45060,635449,567449,5670.00%

Action Details: Deadly Poison Dot Deathmark

  • id:394324
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.113740
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.21
  • base_multiplier:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:394324
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=2} seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy for {$=}{{$2818m1=0}*{$2818d=12 seconds}/{$2818t1=2}} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Periodic AmountVirulent Poisons3815432PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Spell Periodic AmountFatal Concoction3923842PCT10.0%
    Deadly Poison (_instant_deathmark) 5,0230.6%0.00.00s00Direct63.218,23736,47123,77830.4%0.0%

Stats Details: Deadly Poison Instant Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0063.180.000.000.000.00000.00001,502,330.461,502,330.460.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.62%43.99177018,237.4810,68624,33118,200.0615,24620,862802,202802,2020.00%
crit30.38%19.2053936,471.3621,37248,66336,429.0730,24241,956700,128700,1280.00%

Action Details: Deadly Poison Instant Deathmark

  • id:394325
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394325
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Periodic AmountVirulent Poisons3815432PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Spell Periodic AmountFatal Concoction3923842PCT10.0%
Deathstalker's Mark 25,5723.0%40.57.44s189,3500Direct40.5145,543292,287189,34029.9%0.0%

Stats Details: Deathstalkers Mark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage40.4740.470.000.000.000.00000.00007,662,672.007,662,672.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.15%28.391346145,542.56111,844260,732145,476.98128,465159,3864,131,4694,131,4690.00%
crit29.85%12.08226292,287.41223,689521,463292,262.68231,807360,5563,531,2033,531,2030.00%

Action Details: Deathstalkers Mark

  • id:457157
  • school:shadowstorm
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:457157
  • name:Deathstalker's Mark
  • school:shadowstorm
  • tooltip:
  • description:{$@spelldesc457052={$?=}c1[Ambush][Shadowstrike] from Stealth{$?=}c3[ or Shadow Dance][] applies {$s1=3} stacks of Deathstalker's Mark to your target. When you spend {$s2=5} or more combo points on attacks against a Marked target you consume an application of Deathstalker's Mark, dealing {$457157s1=0} Plague damage and increasing the damage of your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] by {$457160s1=50}%. You may only have one target Marked at a time.}
Envenom 156,243 (179,144)18.6% (21.3%)42.57.04s1,262,8901,257,261Direct42.5 (130.7)527,9311,484,6751,101,46459.9% (39.5%)0.0%

Stats Details: Envenom

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage42.5442.540.000.000.001.00450.000046,852,536.4646,852,536.460.00%1,257,261.201,257,261.20
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit40.06%17.04630527,931.35206,2271,197,054527,744.83404,340697,9328,996,5978,996,5970.00%
crit59.94%25.5014421,484,675.44411,0283,822,0261,488,152.181,220,3531,869,60437,855,94037,855,9400.00%

Action Details: Envenom

  • id:32645
  • school:nature
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.{$?a455072=true}[ Envenom damage increased by {$s3=0}%.][]{$?s340081=false}[ Poison critical strikes generate {$340426s1=1} Energy.][]{$?a393724=false}[ Poison damage increased by {$=}w7%][]
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : {$=}{{$m1=0}*1} damage, 1 sec 2 points: {$=}{{$m1=0}*2} damage, 2 sec 3 points: {$=}{{$m1=0}*3} damage, 3 sec 4 points: {$=}{{$m1=0}*4} damage, 4 sec 5 points: {$=}{{$m1=0}*5} damage, 5 sec{$?s193531=true}|((s457512)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage, 6 sec ][]{$?s193531=true}&s457512[ 7 points: {$=}{{$m1=0}*7} damage, 7 sec][]{$?a381669=false}[ Up to 2 Envenom applications can overlap.][]

Action Priority List

    direct
    [P]:28.41
  • if_expr:!buff.darkest_night.up&combo_points>=variable.effective_spend_cp&(variable.not_pooling|debuff.amplifying_poison.stack>=20|!variable.single_target)&!buff.vanish.up
    direct
    [Q]:11.83
  • if_expr:buff.darkest_night.up&effective_combo_points>=cp_max_spend
    stealthed
    [a]:2.31
  • if_expr:effective_combo_points>=variable.effective_spend_cp&dot.kingsbane.ticking&buff.envenom.remains<=3&(debuff.deathstalkers_mark.up|buff.edge_case.up|buff.cold_blood.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSanguine Stratagem4575124PCT5.0%
    Poison Bomb 22,9002.7%88.13.25s77,9490Direct88.160,061120,31877,94829.7%0.0%

Stats Details: Poison Bomb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage88.1488.140.000.000.000.00000.00006,870,234.796,870,234.790.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.31%61.971511060,060.6638,720114,42360,020.1350,84068,8243,722,0363,722,0360.00%
crit29.69%26.16562120,318.1877,439228,846120,252.9799,410148,8093,148,1993,148,1990.00%

Action Details: Poison Bomb

  • id:255546
  • school:nature
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:255546
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc255544=Envenom has a {$=}<chance>% chance per combo point spent to smash a vial of poison at the target's location, creating a pool of acidic death that deals {$=}{{$255546s1=0}*{$s2=4}} Nature damage over {$255545d=2 seconds} to all enemies within it.}
Fatal Intent 2,7310.3%1.00.00s823,6160Direct1.0642,8051,273,524823,46928.6%0.0%

Stats Details: Fatal Intent

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.001.000.000.000.000.00000.0000823,616.08823,616.080.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.38%0.7101642,804.57318,7571,344,148458,963.5001,344,148458,964458,9640.00%
crit28.62%0.29011,273,524.31607,1922,434,376364,652.5802,434,376364,653364,6530.00%

Action Details: Fatal Intent

  • id:461984
  • school:shadowstorm
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461984
  • name:Fatal Intent
  • school:shadowstorm
  • tooltip:
  • description:{$@spelldesc461980=Your damaging abilities against enemies above {$=}M3% health have a very high chance to apply Fatal Intent. When an enemy falls below {$=}M3% health, Fatal Intent inflicts {$=}{{$461984s1=0}*(1+{$@=}versadmg)} Plague damage per stack.}
Garrote 62,4937.4%16.917.49s1,111,8151,106,875Periodic175.278,575174,581106,98129.6%0.0%97.0%

Stats Details: Garrote

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.850.00175.16175.1612.671.00451.660718,739,400.4618,739,400.460.00%60,875.411,106,875.40
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit70.41%123.338116978,574.7130180,36678,582.0570,85086,0169,690,6939,690,6930.00%
crit29.59%51.832589174,581.1393396,806174,673.44146,659207,1199,048,7089,048,7080.00%

Action Details: Garrote

  • id:703
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.346000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.38
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering {$=}w1 damage every {$t1=2} seconds.
  • description:Garrote the enemy, causing {$=}o1 Bleed damage over {$d=18 seconds}.{$?a231719=true}[ Silences the target for {$1330d=5 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    core_dot
    [N]:13.02
  • if_expr:combo_points.deficit>=1&(pmultiplier<=1)&refreshable&target.time_to_die-remains>12
    stealthed
    [b]:3.83
  • if_expr:stealthed.improved_garrote&(pmultiplier<=1|remains<12|!variable.single_target&buff.master_assassin_aura.remains<3)&combo_points.deficit>=1+2*talent.shrouded_suffocation

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Periodic AmountBloody Mess3816261PCT15.0%
Spell Periodic AmountShrouded Suffocation3854781PCT20.0%
Internal Bleeding 16,1041.9%0.00.00s00Periodic75.249,54299,18464,28229.7%0.0%19.6%

Stats Details: Internal Bleeding

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.0075.1775.170.680.00000.78044,831,960.264,831,960.260.00%82,368.110.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit70.30%52.85328149,541.5449105,65349,545.0739,30362,3792,618,0732,618,0730.00%
crit29.70%22.3274299,184.4186211,30699,170.7170,033135,8002,213,8872,213,8870.00%

Action Details: Internal Bleeding

  • id:381628
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.054362
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.10
  • base_multiplier:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:381628
  • name:Internal Bleeding
  • school:physical
  • tooltip:Suffering {$=}w1 damage every {$t1=1} sec.
  • description:{$@spelldesc154904=Kidney Shot also deals up to {$?s193531=true}[{$=}{6*{$154953=}o1}][{$=}{5*{$154953=}o1}] Bleed damage over {$154953d=6 seconds}, based on combo points spent.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSanguine Stratagem4575125PCT5.0%
Kingsbane 67,3868.0%5.163.46s3,934,4283,917,282Direct5.1296,244725,984425,06230.0%0.0%
Periodic35.0356,463875,970514,71830.5%0.0%23.4%

Stats Details: Kingsbane

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.145.1435.0335.030.001.00452.000020,213,176.4320,213,176.430.00%268,713.633,917,282.25
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.03%3.6006296,243.62177,172418,776295,046.020409,4521,065,8791,065,8790.00%
crit29.97%1.5406725,984.48432,2991,021,813603,983.2101,009,0841,117,8901,117,8900.00%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit69.54%24.361038356,462.7932,375931,904356,592.82233,946523,6728,682,9458,682,9450.00%
crit30.46%10.67123875,969.6878,5752,296,402877,639.62239,3251,526,6249,346,4629,346,4620.00%

Action Details: Kingsbane

  • id:385627
  • school:nature
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.290000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:385627
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering {$=}w4 Nature damage every {$t4=2} sec.
  • description:Release a lethal poison from your weapons and inject it into your target, dealing {$s2=0} Nature damage instantly and an additional {$=}o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$394095s1=20}%, up to {$=}{{$394095s1=20}*{$394095u=50}}%. |cFFFFFFFFAwards {$s6=1} combo {$=}lpoint:points;.|r

Action Priority List

    cds
    [I]:5.14
  • if_expr:(debuff.shiv.up|cooldown.shiv.remains<6)&buff.envenom.up&(cooldown.deathmark.remains>=50|dot.deathmark.ticking)|fight_remains<=15

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Mutilate 0 (84,973)0.0% (10.1%)86.13.46s295,687294,365

Stats Details: Mutilate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage86.140.000.000.000.001.00450.00000.000.000.00%294,365.42294,365.42

Action Details: Mutilate

  • id:1329
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:60
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of {$=}<dmg> Physical damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    direct
    [S]:86.14
  • if_expr:variable.use_filler

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Resource CostVicious Venoms3816342ADD10.000
    Mutilate (_mh) 24,9323.0%86.13.46s86,7400Direct86.163,897140,84886,74029.7%0.0%

Stats Details: Mutilate Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage86.1486.140.000.000.000.00000.00007,471,354.6410,673,353.1030.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.32%60.57388563,897.4636,76277,04663,900.4755,33468,7393,870,0165,528,58930.00%
crit29.68%25.571045140,848.0980,877169,501140,853.39121,086155,7573,601,3385,144,76430.00%

Action Details: Mutilate Mh

  • id:5374
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for {$s2=0} Physical damage. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
    Mutilate (_oh) 12,4611.5%86.13.46s43,3580Direct86.131,94870,42643,36029.7%0.0%

Stats Details: Mutilate Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage86.1486.140.000.000.000.00000.00003,734,682.425,335,255.2630.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.35%60.59378531,948.4018,38138,52331,951.9628,83634,7221,935,8372,765,47930.00%
crit29.65%25.54104570,425.9040,43984,75070,423.4057,62277,0111,798,8452,569,77630.00%

Action Details: Mutilate Oh

  • id:27576
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:27576
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for {$s2=0} Physical damage. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
    Mutilate (_mh_vicious_venoms) 26,8393.2%0.00.00s00Direct86.193,404093,4040.0%0.0%

Stats Details: Mutilate Mh Vicious Venoms

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0086.140.000.000.000.00000.00008,045,352.318,045,352.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%86.146410893,403.6841,342232,99993,381.0877,438111,8598,045,3528,045,3520.00%

Action Details: Mutilate Mh Vicious Venoms

  • id:385806
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39946.63
  • base_dd_max:39946.63
  • base_dd_mult:1.00
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385806
  • name:Mutilate
  • school:nature
  • tooltip:
  • description:{$@spelldesc381634=Ambush and Mutilate cost {$s2=5} more Energy and deal {$s1=35}% additional damage as Nature.}
    Mutilate (_oh_vicious_venoms) 13,4171.6%0.00.00s00Direct86.146,696046,6960.0%0.0%

Stats Details: Mutilate Oh Vicious Venoms

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0086.140.000.000.000.00000.00004,022,110.884,022,110.880.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%86.146410846,696.0120,671116,50146,681.6937,36455,5164,022,1114,022,1110.00%

Action Details: Mutilate Oh Vicious Venoms

  • id:385802
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:43941.30
  • base_dd_max:43941.30
  • base_dd_mult:1.00
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385802
  • name:Mutilate
  • school:nature
  • tooltip:
  • description:{$@spelldesc381634=Ambush and Mutilate cost {$s2=5} more Energy and deal {$s1=35}% additional damage as Nature.}
    Mutilated Flesh 7,3240.9%0.00.00s00Periodic93.123,572023,5720.0%0.0%93.1%

Stats Details: Mutilated Flesh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.0093.1593.15163.790.00003.00002,195,584.752,195,584.750.00%7,856.890.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%93.157011623,571.523,67676,90523,596.7118,99028,3692,195,5852,195,5850.00%

Action Details: Mutilated Flesh

  • id:381672
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:unknown

Spelldata

  • id:381672
  • name:Mutilated Flesh
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every $t sec.
  • description:{$@spelldesc340082=Mutilate deals an additional {$s1=45}% Bleed damage over {$=}{{$340431d=6 seconds}+2} sec. Envenom damage increased by {$s2=5}% for each Bleed you have on the target.}
Rupture 57,415 (100,442)6.8% (11.9%)9.631.49s3,146,0603,132,149Periodic176.5 (372.9)75,174150,81697,55729.6% (29.6%)0.0%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.580.00176.53176.538.241.00451.677317,221,584.8817,221,584.880.00%98,574.763,132,148.83
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit70.41%124.297816675,173.5232131,79675,171.9270,52980,0389,343,3429,343,3420.00%
crit29.59%52.242594150,816.0767263,593150,828.79133,223168,9447,878,2437,878,2430.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.317523
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.65
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    core_dot
    [O]:9.58
  • if_expr:combo_points>=variable.effective_spend_cp&(pmultiplier<=1)&refreshable&target.time_to_die-remains>(4+(talent.dashing_scoundrel*5)+(variable.regen_saturated*6))&(!buff.darkest_night.up|talent.caustic_spatter&!debuff.caustic_spatter.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Periodic AmountAssassination Rogue13703725PCT30.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountBloody Mess3816261PCT15.0%
Spell Periodic AmountSanguine Stratagem4575125PCT5.0%
    Serrated Bone Spike 17,5322.1%19.214.89s274,6200Direct9.692,743207,767130,13032.5%0.0%
Periodic117.725,05455,39034,09629.8%0.0%98.9%

Stats Details: Serrated Bone Spike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.169.58117.74117.748.580.00002.51925,260,869.635,795,111.789.22%17,737.130.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.49%6.4611292,743.3586,561131,01992,714.1786,561112,724599,501856,42930.00%
crit32.51%3.11010207,766.88190,433288,243202,143.590274,517647,068924,38229.21%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit70.20%82.655611525,054.0717,88043,87925,053.9623,48826,7862,070,7192,070,7190.00%
crit29.80%35.09156155,390.1839,54696,53455,390.3848,25163,0471,943,5821,943,5820.00%

Action Details: Serrated Bone Spike

  • id:385424
  • school:physical
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385424
  • name:Serrated Bone Spike
  • school:physical
  • tooltip:
  • description:Embed a bone spike in the target, dealing {$s1=0} Physical damage and {$394036s1=0} Bleed damage every {$394036t1=3} sec until they die or leave combat. Refunds a charge when target dies. |cFFFFFFFFAwards 1 combo point plus 1 additional per active bone spike.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
    Corrupt the Blood 25,4953.0%186.81.61s40,9670Periodic186.831,61763,23640,96729.6%0.0%0.0%

Stats Details: Corrupt The Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage186.780.000.00186.780.000.00000.00007,651,949.367,651,949.360.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit70.43%131.558717631,617.172,64659,75131,597.4929,76933,5564,159,1824,159,1820.00%
crit29.57%55.23279163,235.765,291119,50263,212.6356,47570,0153,492,7673,492,7670.00%

Action Details: Corrupt The Blood

  • id:457133
  • school:shadowstorm
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:457133
  • name:Corrupt the Blood
  • school:shadowstorm
  • tooltip:{$@=}auracaster's Rupture corrupts your blood, dealing {$s2=0} Plague damage.
  • description:{$@spelldesc457066=Rupture deals an additional {$457133s2=0} Plague damage each time it deals damage, stacking up to {$457133u=10} times. Rupture duration increased by {$=}{{$s1=3000}/1000} sec.}
Shiv 3,2320.4%11.028.56s88,32587,929Direct11.064,741142,69288,32630.3%0.0%

Stats Details: Shiv

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.9710.970.000.000.001.00450.0000968,542.541,383,630.8230.00%87,929.4287,929.42
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.75%7.6521364,741.2062,29789,80464,728.7462,29772,899495,180707,39930.00%
crit30.25%3.3209142,691.70137,054197,569139,300.380191,972473,363676,23229.29%

Action Details: Shiv

  • id:5938
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:5938
  • name:Shiv
  • school:physical
  • tooltip:
  • description:Attack with your {$?s319032=true}[poisoned blades][off-hand], dealing $sw1 Physical damage, dispelling all enrage effects and applying a concentrated form of your {$?a3408=true}[Crippling Poison, reducing movement speed by {$115196s1=70}% for {$115196d=5 seconds}.]?a5761[Numbing Poison, reducing casting speed by {$359078s1=25}% for {$359078d=5 seconds}.][]{$?=}(!a3408&!a5761)[active Non-Lethal poison.][]{$?=}(a319032&a400783)[ Your Nature and Bleed ]?a319032[ Your Nature ]?a400783[ Your Bleed ][]{$?=}(a400783|a319032)[damage done to the target is increased by {$319504s1=30}% for {$319504d=8 seconds}.][]{$?a354124=false}[ The target's healing received is reduced by {$354124=}S1% for {$319504d=8 seconds}.][] |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    shiv
    [V]:7.80
  • if_expr:talent.lightweight_shiv.enabled&variable.shiv_kingsbane_condition&(dot.kingsbane.ticking|cooldown.kingsbane.remains<=1)
    shiv
    [W]:0.24
  • if_expr:talent.arterial_precision&variable.shiv_condition&debuff.deathmark.up
    shiv
    [X]:0.82
  • if_expr:fight_remains<=cooldown.shiv.charges*8
    stealthed
    [Z]:2.11
  • if_expr:talent.kingsbane&(dot.kingsbane.ticking|cooldown.kingsbane.up)&(!debuff.shiv.up&debuff.shiv.remains<1)&buff.envenom.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Modify Cooldown Charge (Category)Lightweight Shiv3949831SET1.000
Spell Direct AmountLightweight Shiv3949832PCT100.0%
Spell TargetsArterial Precision4007832ADD5.000
Sikran's Endless Arsenal 0 (15,937)0.0% (1.9%)5.163.49s933,3200

Stats Details: Sikrans Endless Arsenal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.120.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sikrans Endless Arsenal

  • id:447970
  • school:shadow
  • range:6.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:447970
  • name:Sikran's Endless Arsenal
  • school:shadow
  • tooltip:
  • description:{$?a447962=false}[{$@=}spellname448090 {$@spelldesc448090=Draw a polearm from the Arsenal to strike all enemies in a line, dealing {$=}{{$=}<rolemult>*{$445203s4=248845}} Physical damage split between all targets. Until the next weapon is drawn, your critical strikes deal {$445203s5=10}% bonus Shadow damage to absorb shields.}]?a447978[{$@=}spellname445475 {$@spelldesc445475=Draw a bow from the Arsenal to unleash a barrage of arrows in front of you, dealing {$=}{{$=}<rolemult>*{$445203s6=165897}} Shadow damage to all enemies within {$=}a1 yards. Until the next weapon is drawn, remain stationary to increase your speed by {$=}{{$445203s7=30}/{$448433u=5}}% for {$448436d=6 seconds} upon moving, increased by an additional {$=}{{$445203s7=30}/{$448433u=5}}% every {$448036t1=2} sec, up to {$448433u=5} times.}]?a448036[{$@=}spellname445434 {$@spelldesc445434=Conjure dual swords from the Arsenal to rend your target, dealing {$=}{{$=}<rolemult>*{$445203s1=298614}} Shadow damage over {$d=3 seconds}. Gain {$445203s2=647} Parry and {$445203s3=431} Avoidance until the next weapon is drawn. }][{$@=}spellname445434 {$@spelldesc445434=Conjure dual swords from the Arsenal to rend your target, dealing {$=}{{$=}<rolemult>*{$445203s1=298614}} Shadow damage over {$d=3 seconds}. Gain {$445203s2=647} Parry and {$445203s3=431} Avoidance until the next weapon is drawn. }]
    Surekian Flourish 6,5960.8%1.7190.48s1,164,4040Periodic5.1300,633602,292390,74129.9%0.0%1.7%

Stats Details: Surekian Flourish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.700.005.065.060.000.00001.00001,978,752.341,978,752.340.00%390,826.060.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit70.13%3.5506300,633.23290,985338,799297,614.100332,4801,067,5981,067,5980.00%
crit29.87%1.5106602,292.10581,969677,598486,007.640677,598911,154911,1540.00%

Action Details: Surekian Flourish

  • id:445434
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:259256.01
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:445434
  • name:Surekian Flourish
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=1} sec.
  • description:Conjure dual swords from the Arsenal to rend your target, dealing {$=}{{$=}<rolemult>*{$445203s1=298614}} Shadow damage over {$d=3 seconds}. Gain {$445203s2=647} Parry and {$445203s3=431} Avoidance until the next weapon is drawn.
    Surekian Decimation 5,6350.7%1.7190.79s982,2090Direct1.7752,1491,505,768982,55330.5%0.0%

Stats Details: Surekian Decimation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.721.720.000.000.000.00000.00001,689,176.081,689,176.080.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.46%1.1902752,148.82727,461846,997638,526.510846,997898,477898,4770.00%
crit30.54%0.53021,505,768.391,454,9231,693,995687,655.6801,693,995790,699790,6990.00%

Action Details: Surekian Decimation

  • id:448090
  • school:shadow
  • range:6.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:648140.38
  • base_dd_max:648140.38
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:448090
  • name:Surekian Decimation
  • school:shadow
  • tooltip:
  • description:Draw a polearm from the Arsenal to strike all enemies in a line, dealing {$=}{{$=}<rolemult>*{$445203s4=248845}} Physical damage split between all targets. Until the next weapon is drawn, your critical strikes deal {$445203s5=10}% bonus Shadow damage to absorb shields.
    Surekian Barrage 3,7050.4%1.7190.35s653,1390Direct1.7500,8761,002,352653,29230.4%0.0%

Stats Details: Surekian Barrage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.701.700.000.000.000.00000.00001,111,427.071,111,427.070.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.58%1.1802500,875.98484,974564,665421,366.300564,665592,827592,8270.00%
crit30.42%0.52021,002,351.98969,9481,129,329453,805.7701,129,329518,600518,6000.00%

Action Details: Surekian Barrage

  • id:445475
  • school:shadow
  • range:6.0
  • travel_speed:40.0000
  • radius:20.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:432092.84
  • base_dd_max:432092.84
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:445475
  • name:Surekian Barrage
  • school:shadow
  • tooltip:
  • description:Draw a bow from the Arsenal to unleash a barrage of arrows in front of you, dealing {$=}{{$=}<rolemult>*{$445203s6=165897}} Shadow damage to all enemies within {$=}a1 yards. Until the next weapon is drawn, remain stationary to increase your speed by {$=}{{$445203s7=30}/{$448433u=5}}% for {$448436d=6 seconds} upon moving, increased by an additional {$=}{{$445203s7=30}/{$448433u=5}}% every {$448036t1=2} sec, up to {$448433u=5} times.
Suffocating Darkness 36,2894.3%19.914.53s546,7440Periodic110.098,986098,9860.0%0.0%73.4%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.920.00110.03110.0312.990.00002.000010,891,566.7110,891,566.710.00%49,492.050.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%110.035616098,985.8445,254158,07298,313.1751,990134,61610,891,56710,891,5670.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:40320.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
Simple Action Stats Execute Interval
Lycrow
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 5.855.34s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.760.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [M]:5.76
  • if_expr:!buff.edge_case.up&cooldown.deathmark.remains>10&!buff.darkest_night.up&combo_points>=variable.effective_spend_cp&(variable.not_pooling|debuff.amplifying_poison.stack>=20|!variable.single_target)&!buff.vanish.up&(!cooldown.kingsbane.up|!variable.single_target)&!cooldown.deathmark.up
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5309.93s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    misc_cds
    [U]:1.48
  • if_expr:buff.bloodlust.react|fight_remains<30|debuff.deathmark.up
Slice and Dice (recuperator) 97.93.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal97.880.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Thistle Tea 4.955.48s

Stats Details: Thistle Tea

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.940.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Thistle Tea

  • id:381623
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:energy
  • energize_amount:100.0

Spelldata

  • id:381623
  • name:Thistle Tea
  • school:physical
  • tooltip:Mastery increased by {$=}{{$=}w2*$mas}.1%.
  • description:Restore {$s1=100} Energy. Mastery increased by {$=}{{$s2=8}*$mas}.1% for {$d=6 seconds}. When your Energy is reduced below {$469779s2=30}, drink a Thistle Tea.

Action Priority List

    cds
    [J]:4.93
  • if_expr:!buff.thistle_tea.up&debuff.shiv.remains>=4|spell_targets.fan_of_knives>=4&debuff.shiv.remains>=6|fight_remains<=cooldown.thistle_tea.charges*6
Vanish 2.9121.04s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.870.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    vanish
    [c]:1.77
  • if_expr:!talent.master_assassin&!talent.indiscriminate_carnage&talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up|cooldown.deathmark.remains<4)&combo_points.deficit>=(spell_targets.fan_of_knives>?4)
    vanish
    [d]:1.10
  • if_expr:talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up|cooldown.deathmark.remains<4)&raid_event.adds.in>30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.2573.6169.8s0.5s253.8s99.91%100.00%563.0 (563.0)0.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.1s / 354.4s
  • trigger_min/max:0.0s / 8.7s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 360.0s
  • uptime_min/max:97.51% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.24%
  • acrobatic_strikes_2:0.25%
  • acrobatic_strikes_3:0.25%
  • acrobatic_strikes_4:0.24%
  • acrobatic_strikes_5:0.24%
  • acrobatic_strikes_6:0.23%
  • acrobatic_strikes_7:0.22%
  • acrobatic_strikes_8:0.21%
  • acrobatic_strikes_9:0.19%
  • acrobatic_strikes_10:97.84%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity5.528.154.2s8.9s48.4s88.73%0.00%13.3 (13.3)4.6

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 340.5s
  • trigger_min/max:2.0s / 90.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 337.5s
  • uptime_min/max:57.55% / 99.36%

Stack Uptimes

  • alacrity_1:14.60%
  • alacrity_2:12.41%
  • alacrity_3:10.18%
  • alacrity_4:8.49%
  • alacrity_5:43.06%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Blindside22.40.013.0s13.0s2.2s16.10%0.00%0.0 (0.0)0.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_blindside
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 207.4s
  • trigger_min/max:1.0s / 202.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:2.02% / 36.40%

Stack Uptimes

  • blindside_1:16.10%

Spelldata

  • id:121153
  • name:Blindside
  • tooltip:Ambush is free and usable without Stealth.
  • description:{$@spelldesc111240=Exploits the vulnerability of foes with less than {$s4=35}% health, dealing {$s2=0} Physical damage to the target. Mutilate has a {$s5=25}% chance to make your next Blindside free and usable on any target, regardless of their health. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust1.00.00.0s0.0s40.0s13.51%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clear the Witnesses13.70.322.8s23.0s12.0s54.78%0.00%0.3 (0.3)13.1

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_clear_the_witnesses
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 54.9s
  • trigger_min/max:9.0s / 45.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 34.9s
  • uptime_min/max:45.18% / 64.44%

Stack Uptimes

  • clear_the_witnesses_1:54.78%

Spelldata

  • id:457178
  • name:Clear the Witnesses
  • tooltip:Your next {$?=}c1[Fan of Knives][Shuriken Storm] deals additional damage and generates {$=}w1 additional combo point.
  • description:{$@spelldesc457053=Your next {$?=}c1[Fan of Knives][Shuriken Storm] after applying Deathstalker's Mark deals an additional {$457179s1=0} Plague damage and generates {$457178s1=1} additional combo point.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Cold Blood5.80.055.6s55.6s0.9s0.30%1.99%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:45.0s / 149.1s
  • trigger_min/max:45.0s / 149.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.2s
  • uptime_min/max:0.00% / 3.24%

Stack Uptimes

  • cold_blood_1:0.30%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:45.00
  • default_chance:100.00%
Darkest Night14.00.022.3s22.3s5.0s22.13%30.76%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_darkest_night
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 55.9s
  • trigger_min/max:1.1s / 46.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 26.6s
  • uptime_min/max:14.78% / 30.83%

Stack Uptimes

  • darkest_night_1:22.13%

Spelldata

  • id:457280
  • name:Darkest Night
  • tooltip:Your next {$?=}c1[Envenom][Eviscerate] cast with maximum combo points is guaranteed to critically strike, deal {$=}w2% additional damage, and apply {$=}w3 stacks of Deathstalker's Mark to the target.
  • description:{$@spelldesc457058=When you consume the final Deathstalker's Mark from a target or your target dies, gain {$457280s1=40} Energy and your next {$?=}c1[Envenom][Eviscerate] cast with maximum combo points is guaranteed to critically strike, deals {$457280s2=60}% additional damage, and applies {$457280s3=3} stacks of Deathstalker's Mark to the target.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Deathstalker's Mark (_buff)22.418.113.6s7.4s9.4s69.93%100.00%18.1 (18.1)3.8

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_deathstalkers_mark_buff
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.50
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 98.8s
  • trigger_min/max:2.0s / 28.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 93.0s
  • uptime_min/max:49.27% / 87.17%

Stack Uptimes

  • deathstalkers_mark_buff_1:69.93%

Spelldata

  • id:457160
  • name:Deathstalker's Mark
  • tooltip:Your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] deals {$=}w1% additional damage.
  • description:{$@spelldesc457052={$?=}c1[Ambush][Shadowstrike] from Stealth{$?=}c3[ or Shadow Dance][] applies {$s1=3} stacks of Deathstalker's Mark to your target. When you spend {$s2=5} or more combo points on attacks against a Marked target you consume an application of Deathstalker's Mark, dealing {$457157s1=0} Plague damage and increasing the damage of your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] by {$457160s1=50}%. You may only have one target Marked at a time.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Envenom14.128.420.9s7.0s16.6s78.44%82.33%28.4 (28.4)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_envenom
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 118.9s
  • trigger_min/max:3.0s / 28.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 119.0s
  • uptime_min/max:66.36% / 91.13%

Stack Uptimes

  • envenom_1:78.44%

Spelldata

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.{$?a455072=true}[ Envenom damage increased by {$s3=0}%.][]{$?s340081=false}[ Poison critical strikes generate {$340426s1=1} Energy.][]{$?a393724=false}[ Poison damage increased by {$=}w7%][]
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : {$=}{{$m1=0}*1} damage, 1 sec 2 points: {$=}{{$m1=0}*2} damage, 2 sec 3 points: {$=}{{$m1=0}*3} damage, 3 sec 4 points: {$=}{{$m1=0}*4} damage, 4 sec 5 points: {$=}{{$m1=0}*5} damage, 5 sec{$?s193531=true}|((s457512)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage, 6 sec ][]{$?s193531=true}&s457512[ 7 points: {$=}{{$m1=0}*7} damage, 7 sec][]{$?a381669=false}[ Up to 2 Envenom applications can overlap.][]
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of Alchemical Chaos (Crit)2.10.6113.4s77.5s35.3s24.97%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 348.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 79.74%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.97%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6112.0s76.7s35.5s24.92%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 343.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 185.7s
  • uptime_min/max:0.00% / 79.71%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.92%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.9s76.9s35.3s25.01%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 344.8s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 84.82%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.01%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.1s76.2s35.5s25.10%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 346.8s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 88.85%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.10%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Improved Garrote3.90.083.9s83.9s6.0s7.73%0.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_improved_garrote
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 136.4s
  • trigger_min/max:14.0s / 136.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:6.67% / 9.22%

Stack Uptimes

  • improved_garrote_1:7.73%

Spelldata

  • id:392401
  • name:Improved Garrote
  • tooltip:Garrote deals {$=}w2% increased damage and has no cooldown.
  • description:{$@spelldesc381632=Garrote deals {$s1=50}% increased damage and has no cooldown when used from Stealth and for {$392401d=6 seconds} after breaking Stealth.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Improved Garrote (_aura)3.90.183.8s117.4s0.1s0.16%0.00%0.1 (0.1)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_improved_garrote_aura
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 136.4s
  • trigger_min/max:3.0s / 136.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.0s
  • uptime_min/max:0.00% / 3.73%

Stack Uptimes

  • improved_garrote_aura_1:0.16%

Spelldata

  • id:392401
  • name:Improved Garrote
  • tooltip:Garrote deals {$=}w2% increased damage and has no cooldown.
  • description:{$@spelldesc381632=Garrote deals {$s1=50}% increased damage and has no cooldown when used from Stealth and for {$392401d=6 seconds} after breaking Stealth.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Kingsbane5.1292.963.6s0.9s13.2s22.51%100.00%83.7 (83.7)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_kingsbane
  • max_stacks:50
  • base duration:14.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.20/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:55.7s / 138.0s
  • trigger_min/max:0.0s / 124.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s
  • uptime_min/max:12.61% / 26.15%

Stack Uptimes

  • kingsbane_1:0.31%
  • kingsbane_2:0.65%
  • kingsbane_3:0.29%
  • kingsbane_4:0.63%
  • kingsbane_5:0.29%
  • kingsbane_6:0.60%
  • kingsbane_7:0.29%
  • kingsbane_8:0.61%
  • kingsbane_9:0.30%
  • kingsbane_10:0.62%
  • kingsbane_11:0.29%
  • kingsbane_12:0.63%
  • kingsbane_13:0.29%
  • kingsbane_14:0.63%
  • kingsbane_15:0.30%
  • kingsbane_16:0.63%
  • kingsbane_17:0.30%
  • kingsbane_18:0.63%
  • kingsbane_19:0.30%
  • kingsbane_20:0.62%
  • kingsbane_21:0.30%
  • kingsbane_22:0.62%
  • kingsbane_23:0.29%
  • kingsbane_24:0.61%
  • kingsbane_25:0.28%
  • kingsbane_26:0.59%
  • kingsbane_27:0.25%
  • kingsbane_28:0.56%
  • kingsbane_29:0.23%
  • kingsbane_30:0.53%
  • kingsbane_31:0.19%
  • kingsbane_32:0.50%
  • kingsbane_33:0.15%
  • kingsbane_34:0.46%
  • kingsbane_35:0.12%
  • kingsbane_36:0.42%
  • kingsbane_37:0.08%
  • kingsbane_38:0.39%
  • kingsbane_39:0.05%
  • kingsbane_40:0.37%
  • kingsbane_41:0.03%
  • kingsbane_42:0.36%
  • kingsbane_43:0.02%
  • kingsbane_44:0.34%
  • kingsbane_45:0.01%
  • kingsbane_46:0.33%
  • kingsbane_47:0.01%
  • kingsbane_48:0.33%
  • kingsbane_49:0.01%
  • kingsbane_50:4.87%

Spelldata

  • id:394095
  • name:Kingsbane
  • tooltip:Kingsbane damage increased by {$s1=20}%.
  • description:{$@spelldesc385627=Release a lethal poison from your weapons and inject it into your target, dealing {$s2=0} Nature damage instantly and an additional {$=}o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$394095s1=20}%, up to {$=}{{$394095s1=20}*{$394095u=50}}%. |cFFFFFFFFAwards {$s6=1} combo {$=}lpoint:points;.|r}
  • max_stacks:50
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
Lingering Darkness2.90.0123.1s123.1s28.4s26.17%17.88%0.0 (0.0)2.5

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_lingering_darkness
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:104.0s / 140.8s
  • trigger_min/max:104.0s / 140.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:21.16% / 30.74%

Stack Uptimes

  • lingering_darkness_1:26.17%

Spelldata

  • id:457273
  • name:Lingering Darkness
  • tooltip:All {$?=}c1[Nature][Shadow] damage dealt increased by {$?=}c1[{$=}w1][{$=}w2]%.
  • description:{$@spelldesc457056=After {$?=}c1[Deathmark][Shadow Blades] expires, gain {$457273d=30 seconds} of {$457273s1=30}% increased {$?=}c1[Nature][Shadow] damage.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Crit)1.90.286.9s73.2s16.9s10.89%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2696.35

Trigger Details

  • interval_min/max:0.9s / 328.6s
  • trigger_min/max:0.1s / 328.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 62.1s
  • uptime_min/max:0.00% / 46.57%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.89%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.286.3s72.8s16.8s10.84%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2696.35

Trigger Details

  • interval_min/max:1.8s / 322.8s
  • trigger_min/max:0.1s / 322.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.3s
  • uptime_min/max:0.00% / 50.89%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.84%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.286.3s73.0s16.8s10.82%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2696.35

Trigger Details

  • interval_min/max:1.7s / 328.4s
  • trigger_min/max:0.1s / 328.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.1s
  • uptime_min/max:0.00% / 44.35%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.82%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.285.9s72.5s16.8s10.79%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2696.35

Trigger Details

  • interval_min/max:1.8s / 333.1s
  • trigger_min/max:0.0s / 333.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.9s
  • uptime_min/max:0.00% / 45.37%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.79%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Serrated Bone Spike (_charges)1.011.00.0s28.5s300.0s100.00%100.00%1.4 (1.4)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_serrated_bone_spike_charges
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • serrated_bone_spike_charges_1:1.07%
  • serrated_bone_spike_charges_2:53.99%
  • serrated_bone_spike_charges_3:44.94%

Spelldata

  • id:455366
  • name:Serrated Bone Spike
  • tooltip:Prepared a Serrated Bone Spike.
  • description:{$@spelldesc455352=Prepare a Serrated Bone Spike every {$s1=30} sec, stacking up to {$455366u=3}. Rupture spends a stack to embed a bone spike in its target. |cFFFFFFFF{$@=}spellicon385424 {$@=}spellname385424|r: Deals {$385424s1=0} Physical damage and {$394036s1=0} Bleed damage every {$394036t1=3} sec until the target dies or leaves combat. Refunds a stack when the target dies. |cFFFFFFFFAwards 1 combo point plus 1 additional per active bone spike.|r}
  • max_stacks:3
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Slice and Dice1.00.00.0s0.0s295.1s98.35%91.92%97.9 (97.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:235.0s / 355.7s
  • uptime_min/max:97.91% / 98.88%

Stack Uptimes

  • slice_and_dice_1:98.35%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stance - Surekian Barrage2.00.0172.2s190.2s48.8s33.14%0.00%48.9 (48.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_stance__surekian_barrage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:128.6s / 330.2s
  • trigger_min/max:180.1s / 330.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 136.5s
  • uptime_min/max:11.29% / 59.42%

Stack Uptimes

  • stance__surekian_barrage_1:33.14%

Spelldata

  • id:448036
  • name:Stance - Surekian Barrage
  • tooltip:Remain stationary to increase your speed by {$=}{{$445203s7=30}/{$448433u=5}}% for 6 sec upon moving, increased by an additional {$=}{{$445203s7=30}/{$448433u=5}}% every {$t1=2} sec, up to {$448433u=5} times.
  • description:{$@spelldesc445434=Conjure dual swords from the Arsenal to rend your target, dealing {$=}{{$=}<rolemult>*{$445203s1=298614}} Shadow damage over {$d=3 seconds}. Gain {$445203s2=647} Parry and {$445203s3=431} Avoidance until the next weapon is drawn. }
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Stance - Surekian Decimation2.00.0173.2s190.1s49.4s33.56%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_stance__surekian_decimation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:128.8s / 316.6s
  • trigger_min/max:180.1s / 316.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 137.2s
  • uptime_min/max:8.19% / 59.63%

Stack Uptimes

  • stance__surekian_decimation_1:33.56%

Spelldata

  • id:447978
  • name:Stance - Surekian Decimation
  • tooltip:Your critical strikes deal {$445203s5=10}% additional damage to absorb shields.
  • description:{$@spelldesc448090=Draw a polearm from the Arsenal to strike all enemies in a line, dealing {$=}{{$=}<rolemult>*{$445203s4=248845}} Physical damage split between all targets. Until the next weapon is drawn, your critical strikes deal {$445203s5=10}% bonus Shadow damage to absorb shields.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Stance - Surekian Flourish2.00.0172.0s190.1s48.9s33.30%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_stance__surekian_flourish
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:parry_rating
  • amount:0.00
  • stat:avoidance_rating
  • amount:0.00

Trigger Details

  • interval_min/max:128.5s / 311.7s
  • trigger_min/max:180.1s / 311.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 137.1s
  • uptime_min/max:8.63% / 58.50%

Stack Uptimes

  • stance__surekian_flourish_1:33.30%

Spelldata

  • id:447962
  • name:Stance - Surekian Flourish
  • tooltip:Parry increased by {$=}w1. Avoidance increased by {$=}w2.
  • description:{$@spelldesc445434=Conjure dual swords from the Arsenal to rend your target, dealing {$=}{{$=}<rolemult>*{$445203s1=298614}} Shadow damage over {$d=3 seconds}. Gain {$445203s2=647} Parry and {$445203s3=431} Avoidance until the next weapon is drawn. }
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.10.0202.8s124.5s0.1s0.03%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:122.1s / 266.8s
  • trigger_min/max:122.1s / 128.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s
  • uptime_min/max:0.00% / 1.79%

Stack Uptimes

  • stealth_1:0.03%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Surekian Grace29.547.99.0s3.5s9.2s90.01%0.00%47.9 (47.9)28.5

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_surekian_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 145.9s
  • trigger_min/max:0.0s / 6.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 145.9s
  • uptime_min/max:40.66% / 99.44%

Stack Uptimes

  • surekian_grace_1:90.01%

Spelldata

  • id:448436
  • name:Surekian Grace
  • tooltip:Movement speed increased by {$=}w1%.
  • description:{$@spelldesc448433={$@spelldesc445475=Draw a bow from the Arsenal to unleash a barrage of arrows in front of you, dealing {$=}{{$=}<rolemult>*{$445203s6=165897}} Shadow damage to all enemies within {$=}a1 yards. Until the next weapon is drawn, remain stationary to increase your speed by {$=}{{$445203s7=30}/{$448433u=5}}% for {$448436d=6 seconds} upon moving, increased by an additional {$=}{{$445203s7=30}/{$448433u=5}}% every {$448036t1=2} sec, up to {$448433u=5} times.}}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Tempered Potion1.50.0307.1s307.1s27.4s13.28%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.8s
  • trigger_min/max:300.0s / 329.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.92% / 18.06%

Stack Uptimes

  • tempered_potion_1:13.28%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Thistle Tea7.30.041.7s41.7s6.0s14.64%0.00%0.0 (0.0)7.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_thistle_tea
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:8.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:8.00%

Trigger Details

  • interval_min/max:6.0s / 88.5s
  • trigger_min/max:1.0s / 88.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.41% / 16.52%

Stack Uptimes

  • thistle_tea_1:14.64%

Spelldata

  • id:381623
  • name:Thistle Tea
  • tooltip:Mastery increased by {$=}{{$=}w2*$mas}.1%.
  • description:Restore {$s1=100} Energy. Mastery increased by {$=}{{$s2=8}*$mas}.1% for {$d=6 seconds}. When your Energy is reduced below {$469779s2=30}, drink a Thistle Tea.
  • max_stacks:0
  • duration:6.00
  • cooldown:1.00
  • default_chance:0.00%
Vanish2.90.0121.0s121.0s0.1s0.13%0.00%0.0 (0.0)0.1

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 136.4s
  • trigger_min/max:120.0s / 136.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s
  • uptime_min/max:0.00% / 2.11%

Stack Uptimes

  • vanish_1:0.13%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)47.920.082.06.2s0.7s86.5s
Skyfury (Off Hand)47.421.080.06.2s0.7s75.2s
Cold Blood kingsbane0.00.01.00.0s0.0s0.0s
Cold Blood envenom5.32.08.059.5s45.0s311.1s
Cold Blood mutilate0.30.03.0104.3s47.7s283.7s
Cold Blood ambush0.20.03.096.9s45.5s274.3s
Cold Blood shiv0.00.02.0114.6s47.8s194.3s
Serrated Bone Spike Refund0.00.01.00.0s0.0s0.0s
Serrated Bone Spike Refund Wasted0.80.01.00.0s0.0s0.0s
Serrated Bone Spike Refund Wasted (Partial)0.20.01.00.0s0.0s0.0s
Amplifying Poison Consumed31.821.044.09.2s3.0s47.3s
Amplifying Poison (Deathmark) Consumed6.22.010.045.7s3.0s248.6s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap0.49%0.00%2.89%0.5s0.0s4.6s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Lycrow
Darkest NightEnergy13.98531.416.58%38.0127.824.97%
Energy RegenEnergy3,472.163,905.5748.37%1.1225.620.65%
Improved AmbushCombo Points24.2518.055.31%0.746.2025.55%
Seal FateCombo Points63.2654.0015.89%0.859.2614.64%
Serrated Bone SpikeCombo Points9.5818.165.34%1.900.000.00%
Shrouded SuffocationCombo Points3.837.662.25%2.000.010.07%
Venomous VimEnergy409.643,246.8840.22%7.9330.270.92%
AmbushCombo Points24.2543.2812.74%1.795.2110.75%
GarroteCombo Points16.8616.864.96%1.000.000.00%
KingsbaneCombo Points5.144.341.28%0.850.7915.46%
MutilateCombo Points86.14168.7649.67%1.963.522.04%
ShivCombo Points10.978.672.55%0.792.3020.93%
Thistle TeaEnergy4.93389.884.83%79.00103.6121.00%
Usage Type Count Total Tot% Avg RPE APR
Lycrow
AmbushEnergy24.25133.331.61%5.505.5090,010.14
EnvenomEnergy42.541,488.8717.94%35.0035.0036,082.90
EnvenomCombo Points42.54276.2982.04%6.506.49194,440.65
GarroteEnergy16.86758.489.14%45.0045.0024,706.49
KingsbaneEnergy5.14179.792.17%35.0035.00112,423.79
MutilateEnergy86.145,168.3062.29%60.0060.004,927.94
RuptureEnergy9.58239.472.89%25.0025.00125,839.63
RuptureCombo Points9.5860.4717.96%6.316.31498,297.63
ShivEnergy10.97328.973.96%30.0030.002,944.14
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy300.026.9127.66187.476.50.0300.0
Combo Points0.01.131.1227.33.00.07.0

Statistics & Data Analysis

Fight Length
Lycrow Fight Length
Count 9999
Mean 300.01
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Lycrow Damage Per Second
Count 9999
Mean 842227.73
Minimum 728217.46
Maximum 948443.19
Spread ( max - min ) 220225.73
Range [ ( max - min ) / 2 * 100% ] 13.07%
Standard Deviation 29949.8967
5th Percentile 793791.72
95th Percentile 892095.08
( 95th Percentile - 5th Percentile ) 98303.36
Mean Distribution
Standard Deviation 299.5139
95.00% Confidence Interval ( 841640.69 - 842814.76 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4858
0.1 Scale Factor Error with Delta=300 7657277
0.05 Scale Factor Error with Delta=300 30629106
0.01 Scale Factor Error with Delta=300 765727643
Priority Target DPS
Lycrow Priority Target Damage Per Second
Count 9999
Mean 842227.73
Minimum 728217.46
Maximum 948443.19
Spread ( max - min ) 220225.73
Range [ ( max - min ) / 2 * 100% ] 13.07%
Standard Deviation 29949.8967
5th Percentile 793791.72
95th Percentile 892095.08
( 95th Percentile - 5th Percentile ) 98303.36
Mean Distribution
Standard Deviation 299.5139
95.00% Confidence Interval ( 841640.69 - 842814.76 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4858
0.1 Scale Factor Error with Delta=300 7657277
0.05 Scale Factor Error with Delta=300 30629106
0.01 Scale Factor Error with Delta=300 765727643
DPS(e)
Lycrow Damage Per Second (Effective)
Count 9999
Mean 842227.73
Minimum 728217.46
Maximum 948443.19
Spread ( max - min ) 220225.73
Range [ ( max - min ) / 2 * 100% ] 13.07%
Damage
Lycrow Damage
Count 9999
Mean 252558045.30
Minimum 179306801.25
Maximum 321811270.48
Spread ( max - min ) 142504469.23
Range [ ( max - min ) / 2 * 100% ] 28.21%
DTPS
Lycrow Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Lycrow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Lycrow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Lycrow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Lycrow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 flask
2 0.00 augmentation
3 0.00 food
4 0.00 snapshot_stats
5 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)&!trinket.2.is.treacherous_transmitter|trinket.1.is.treacherous_transmitter
6 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)&!trinket.1.is.treacherous_transmitter|trinket.2.is.treacherous_transmitter
7 0.00 variable,name=effective_spend_cp,value=cp_max_spend-2<?5*talent.hand_of_fate
8 0.00 stealth
9 0.00 slice_and_dice,precombat_seconds=1
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 kick
0.00 variable,name=single_target,value=spell_targets.fan_of_knives<2
0.00 variable,name=regen_saturated,value=energy.regen_combined>30
0.00 variable,name=in_cooldowns,value=dot.deathmark.ticking|dot.kingsbane.ticking|debuff.shiv.up
0.00 variable,name=clip_envenom,value=buff.envenom.up&buff.envenom.remains.1<=1
0.00 variable,name=upper_limit_energy,value=energy.pct>=(70-30*talent.sanguine_blades-10*talent.vicious_venoms.rank)
0.00 variable,name=avoid_tea,value=energy>40+50+5*talent.vicious_venoms.rank
0.00 variable,name=cd_soon,value=cooldown.kingsbane.remains<6&!cooldown.kingsbane.ready
0.00 variable,name=not_pooling,value=variable.in_cooldowns|!variable.cd_soon&variable.avoid_tea&buff.darkest_night.up|!variable.cd_soon&variable.avoid_tea&variable.clip_envenom|variable.upper_limit_energy|fight_remains<=20
A 0.00 call_action_list,name=stealthed,if=stealthed.rogue|stealthed.improved_garrote|master_assassin_remains>0
B 0.00 call_action_list,name=cds
C 0.00 call_action_list,name=core_dot
D 0.00 call_action_list,name=aoe_dot,if=!variable.single_target
E 0.00 call_action_list,name=direct
0.00 arcane_torrent,if=energy.deficit>=15+energy.regen_combined
0.00 arcane_pulse
0.00 lights_judgment
0.00 bag_of_tricks
actions.cds
# count action,conditions
0.00 variable,name=deathmark_ma_condition,value=!talent.master_assassin.enabled|dot.garrote.ticking
0.00 variable,name=deathmark_kingsbane_condition,value=!talent.kingsbane|cooldown.kingsbane.remains<=2
0.00 variable,name=deathmark_condition,value=!stealthed.rogue&buff.slice_and_dice.remains>5&dot.rupture.ticking&buff.envenom.up&!debuff.deathmark.up&variable.deathmark_ma_condition&variable.deathmark_kingsbane_condition
F 0.00 call_action_list,name=items
0.00 invoke_external_buff,name=power_infusion,if=dot.deathmark.ticking
G 2.92 deathmark,if=(variable.deathmark_condition&target.time_to_die>=10)|fight_remains<=20
H 0.00 call_action_list,name=shiv
I 5.14 kingsbane,if=(debuff.shiv.up|cooldown.shiv.remains<6)&buff.envenom.up&(cooldown.deathmark.remains>=50|dot.deathmark.ticking)|fight_remains<=15
J 4.93 thistle_tea,if=!buff.thistle_tea.up&debuff.shiv.remains>=4|spell_targets.fan_of_knives>=4&debuff.shiv.remains>=6|fight_remains<=cooldown.thistle_tea.charges*6
K 0.00 call_action_list,name=misc_cds
L 0.00 call_action_list,name=vanish,if=!stealthed.all&master_assassin_remains=0
M 5.76 cold_blood,if=!buff.edge_case.up&cooldown.deathmark.remains>10&!buff.darkest_night.up&combo_points>=variable.effective_spend_cp&(variable.not_pooling|debuff.amplifying_poison.stack>=20|!variable.single_target)&!buff.vanish.up&(!cooldown.kingsbane.up|!variable.single_target)&!cooldown.deathmark.up
actions.core_dot
# count action,conditions
N 13.02 garrote,if=combo_points.deficit>=1&(pmultiplier<=1)&refreshable&target.time_to_die-remains>12
O 9.58 rupture,if=combo_points>=variable.effective_spend_cp&(pmultiplier<=1)&refreshable&target.time_to_die-remains>(4+(talent.dashing_scoundrel*5)+(variable.regen_saturated*6))&(!buff.darkest_night.up|talent.caustic_spatter&!debuff.caustic_spatter.up)
actions.direct
# count action,conditions
P 28.41 envenom,if=!buff.darkest_night.up&combo_points>=variable.effective_spend_cp&(variable.not_pooling|debuff.amplifying_poison.stack>=20|!variable.single_target)&!buff.vanish.up
Q 11.83 envenom,if=buff.darkest_night.up&effective_combo_points>=cp_max_spend
0.00 variable,name=use_filler,value=combo_points.deficit>1|variable.not_pooling|!variable.single_target
0.00 variable,name=use_caustic_filler,value=talent.caustic_spatter&dot.rupture.ticking&(!debuff.caustic_spatter.up|debuff.caustic_spatter.remains<=2)&combo_points.deficit>1&!variable.single_target
0.00 mutilate,if=variable.use_caustic_filler
0.00 ambush,if=variable.use_caustic_filler
0.00 fan_of_knives,if=variable.use_filler&!priority_rotation&(spell_targets.fan_of_knives>=3-(talent.momentum_of_despair&talent.thrown_precision)|buff.clear_the_witnesses.up&!talent.vicious_venoms)
0.00 fan_of_knives,target_if=!dot.deadly_poison_dot.ticking&(!priority_rotation|dot.garrote.ticking|dot.rupture.ticking),if=variable.use_filler&spell_targets.fan_of_knives>=3-(talent.momentum_of_despair&talent.thrown_precision)
R 21.62 ambush,if=variable.use_filler&(buff.blindside.up|stealthed.rogue)&(!dot.kingsbane.ticking|debuff.deathmark.down|buff.blindside.up)
0.00 mutilate,target_if=!dot.deadly_poison_dot.ticking&!debuff.amplifying_poison.up,if=variable.use_filler&spell_targets.fan_of_knives=2
S 86.14 mutilate,if=variable.use_filler
actions.items
# count action,conditions
0.00 variable,name=base_trinket_condition,value=dot.rupture.ticking&cooldown.deathmark.remains<2|dot.deathmark.ticking|fight_remains<=22
0.00 use_item,name=ashes_of_the_embersoul,use_off_gcd=1,if=(dot.kingsbane.ticking&dot.kingsbane.remains<=11)|fight_remains<=22
0.00 use_item,name=algethar_puzzle_box,use_off_gcd=1,if=variable.base_trinket_condition
0.00 use_item,name=treacherous_transmitter,use_off_gcd=1,if=variable.base_trinket_condition
0.00 use_item,name=mad_queens_mandate,if=cooldown.deathmark.remains>=30&!dot.deathmark.ticking|fight_remains<=3
0.00 do_treacherous_transmitter_task,use_off_gcd=1,if=dot.deathmark.ticking&variable.single_target|buff.realigning_nexus_convergence_divergence.up&buff.realigning_nexus_convergence_divergence.remains<=2|buff.cryptic_instructions.up&buff.cryptic_instructions.remains<=2|buff.errant_manaforge_emission.up&buff.errant_manaforge_emission.remains<=2|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=variable.base_trinket_condition
T 5.12 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(debuff.deathmark.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&dot.kingsbane.ticking|!debuff.deathmark.up&cooldown.deathmark.remains>20&dot.kingsbane.ticking))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(debuff.deathmark.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&dot.kingsbane.ticking|!debuff.deathmark.up&cooldown.deathmark.remains>20&dot.kingsbane.ticking))|!variable.trinket_sync_slot)
actions.misc_cds
# count action,conditions
U 1.48 potion,if=buff.bloodlust.react|fight_remains<30|debuff.deathmark.up
0.00 blood_fury,if=debuff.deathmark.up
0.00 berserking,if=debuff.deathmark.up
0.00 fireblood,if=debuff.deathmark.up
0.00 ancestral_call,if=(!talent.kingsbane&debuff.deathmark.up&debuff.shiv.up)|(talent.kingsbane&debuff.deathmark.up&dot.kingsbane.ticking&dot.kingsbane.remains<8)
actions.shiv
# count action,conditions
0.00 variable,name=shiv_condition,value=!debuff.shiv.up&dot.garrote.ticking&dot.rupture.ticking
0.00 variable,name=shiv_kingsbane_condition,value=talent.kingsbane&buff.envenom.up&variable.shiv_condition
0.00 shiv,if=talent.arterial_precision&variable.shiv_condition&spell_targets.fan_of_knives>=4&dot.crimson_tempest.ticking
0.00 shiv,if=!talent.lightweight_shiv.enabled&variable.shiv_kingsbane_condition&(dot.kingsbane.ticking&dot.kingsbane.remains<8|!dot.kingsbane.ticking&cooldown.kingsbane.remains>=20)&(!talent.crimson_tempest.enabled|variable.single_target|dot.crimson_tempest.ticking)
V 7.80 shiv,if=talent.lightweight_shiv.enabled&variable.shiv_kingsbane_condition&(dot.kingsbane.ticking|cooldown.kingsbane.remains<=1)
W 0.24 shiv,if=talent.arterial_precision&variable.shiv_condition&debuff.deathmark.up
0.00 shiv,if=!talent.kingsbane&!talent.arterial_precision&variable.shiv_condition&(!talent.crimson_tempest.enabled|variable.single_target|dot.crimson_tempest.ticking)
X 0.82 shiv,if=fight_remains<=cooldown.shiv.charges*8
actions.stealthed
# count action,conditions
0.00 pool_resource,for_next=1
Y 2.63 ambush,if=!debuff.deathstalkers_mark.up&talent.deathstalkers_mark
Z 2.11 shiv,if=talent.kingsbane&(dot.kingsbane.ticking|cooldown.kingsbane.up)&(!debuff.shiv.up&debuff.shiv.remains<1)&buff.envenom.up
a 2.31 envenom,if=effective_combo_points>=variable.effective_spend_cp&dot.kingsbane.ticking&buff.envenom.remains<=3&(debuff.deathstalkers_mark.up|buff.edge_case.up|buff.cold_blood.up)
0.00 envenom,if=effective_combo_points>=variable.effective_spend_cp&buff.master_assassin_aura.up&variable.single_target&(debuff.deathstalkers_mark.up|buff.edge_case.up|buff.cold_blood.up)
0.00 rupture,target_if=effective_combo_points>=variable.effective_spend_cp&buff.indiscriminate_carnage.up&refreshable&(!variable.regen_saturated|!variable.scent_saturation|!dot.rupture.ticking)&target.time_to_die>15
0.00 garrote,target_if=min:remains,if=stealthed.improved_garrote&(remains<12|pmultiplier<=1|(buff.indiscriminate_carnage.up&active_dot.garrote<spell_targets.fan_of_knives))&!variable.single_target&target.time_to_die-remains>2
b 3.83 garrote,if=stealthed.improved_garrote&(pmultiplier<=1|remains<12|!variable.single_target&buff.master_assassin_aura.remains<3)&combo_points.deficit>=1+2*talent.shrouded_suffocation
actions.vanish
# count action,conditions
0.00 pool_resource,for_next=1,extra_amount=45
0.00 vanish,if=!buff.fatebound_lucky_coin.up&(buff.fatebound_coin_tails.stack>=5|buff.fatebound_coin_heads.stack>=5)
c 1.77 vanish,if=!talent.master_assassin&!talent.indiscriminate_carnage&talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up|cooldown.deathmark.remains<4)&combo_points.deficit>=(spell_targets.fan_of_knives>?4)
0.00 pool_resource,for_next=1,extra_amount=45
0.00 vanish,if=!talent.master_assassin&talent.indiscriminate_carnage&talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&spell_targets.fan_of_knives>2&(target.time_to_die-remains>15|raid_event.adds.in>20)
0.00 vanish,if=!talent.improved_garrote&talent.master_assassin&!dot.rupture.refreshable&dot.garrote.remains>3&debuff.deathmark.up&(debuff.shiv.up|debuff.deathmark.remains<4)
d 1.10 vanish,if=talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up|cooldown.deathmark.remains<4)&raid_event.adds.in>30

Sample Sequence

0123678YbUOSRPGVITJSMPSSSdYZabJSPSSPSSSQRSORPSSPSSNQSRPSSSNORSMPSSSSQVITJNSPRSPVSSPSSNSQSSOSNSMPSSSOSRQNSRGWJPITSScabSZPSSSQSRPSSSOSNMPSSSQSNSPSSSONRPVITJSSQSSSVPRNSMPSSRPSSQRNSORPRSPRNSSQRRPRSSdObGZJPYITSQRSVMPRSPSSPSSSQSRNPSRPSRPSSXSQ

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Lycrow 300.0/300 100% energy
0.0/7 0% CP
serrated_bone_spike_charges(3)
Pre1flask
[precombat]
Lycrow 300.0/300 100% energy
0.0/7 0% CP
serrated_bone_spike_charges(3)
Pre2augmentation
[precombat]
Lycrow 300.0/300 100% energy
0.0/7 0% CP
serrated_bone_spike_charges(3)
Pre3food
[precombat]
Lycrow 300.0/300 100% energy
0.0/7 0% CP
serrated_bone_spike_charges(3)
Pre6trinket_sync_slot
[precombat]
Lycrow 300.0/300 100% energy
0.0/7 0% CP
serrated_bone_spike_charges(3)
Pre7effective_spend_cp
[precombat]
Lycrow 300.0/300 100% energy
0.0/7 0% CP
serrated_bone_spike_charges(3)
Pre8stealth
[precombat]
Lycrow 300.0/300 100% energy
0.0/7 0% CP
serrated_bone_spike_charges(3)
0:00.000Yambush
[stealthed]
Fluffy_Pillow 300.0/300 100% energy
0.0/7 0% CP
stealth, improved_garrote_aura, serrated_bone_spike_charges(3)
0:01.006bgarrote
[stealthed]
Fluffy_Pillow 255.6/300 85% energy
3.0/7 43% CP
bloodlust, acrobatic_strikes(2), clear_the_witnesses, improved_garrote, serrated_bone_spike_charges(3)
0:02.011Upotion
[misc_cds]
Fluffy_Pillow 226.2/300 75% energy
6.0/7 86% CP
bloodlust, acrobatic_strikes(5), clear_the_witnesses, improved_garrote, serrated_bone_spike_charges(3)
0:02.011Orupture
[core_dot]
Fluffy_Pillow 226.2/300 75% energy
6.0/7 86% CP
bloodlust, acrobatic_strikes(5), clear_the_witnesses, improved_garrote, serrated_bone_spike_charges(3), tempered_potion
0:03.016Smutilate
[direct]
Fluffy_Pillow 225.5/300 75% energy
1.0/7 14% CP
bloodlust, acrobatic_strikes(6), alacrity, clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, serrated_bone_spike_charges(2), nascent_empowerment_Vers, tempered_potion
0:04.020Rambush
[direct]
Fluffy_Pillow 197.8/300 66% energy
3.0/7 43% CP
bloodlust, acrobatic_strikes(8), alacrity, clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, blindside, serrated_bone_spike_charges(2), nascent_empowerment_Vers, tempered_potion
0:05.025Penvenom
[direct]
Fluffy_Pillow 222.1/300 74% energy
6.0/7 86% CP
bloodlust, acrobatic_strikes(9), alacrity, clear_the_witnesses, improved_garrote, serrated_bone_spike_charges(2), nascent_empowerment_Vers, tempered_potion
0:06.029Gdeathmark
[cds]
Fluffy_Pillow 211.6/300 71% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), nascent_empowerment_Vers, tempered_potion
0:07.034Vshiv
[shiv]
Fluffy_Pillow 260.1/300 87% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), nascent_empowerment_Vers, tempered_potion
0:08.039Ikingsbane
[cds]
Fluffy_Pillow 278.5/300 93% energy
1.0/7 14% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), nascent_empowerment_Vers, tempered_potion
0:09.046Tuse_items
[items]
Fluffy_Pillow 276.1/300 92% energy
2.0/7 29% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), clear_the_witnesses, deathstalkers_mark_buff, kingsbane(2), serrated_bone_spike_charges(2), nascent_empowerment_Vers, tempered_potion
0:09.046Jthistle_tea
[cds]
Lycrow 276.1/300 92% energy
2.0/7 29% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), clear_the_witnesses, deathstalkers_mark_buff, kingsbane(2), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:09.046Smutilate
[direct]
Fluffy_Pillow 300.0/300 100% energy
2.0/7 29% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(2), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:10.050Mcold_blood
[cds]
Lycrow 272.5/300 91% energy
6.0/7 86% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(8), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:10.050Penvenom
[direct]
Fluffy_Pillow 272.5/300 91% energy
6.0/7 86% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), cold_blood, thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(8), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:11.053Smutilate
[direct]
Fluffy_Pillow 300.0/300 100% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, clear_the_witnesses, darkest_night, deathstalkers_mark_buff, kingsbane(12), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:12.059Smutilate
[direct]
Fluffy_Pillow 288.7/300 96% energy
3.0/7 43% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, darkest_night, deathstalkers_mark_buff, kingsbane(16), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:13.063Smutilate
[direct]
Fluffy_Pillow 261.3/300 87% energy
6.0/7 86% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, darkest_night, deathstalkers_mark_buff, kingsbane(24), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:14.069dvanish
[vanish]
Lycrow 233.9/300 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, darkest_night, deathstalkers_mark_buff, kingsbane(30), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:14.069Yambush
[stealthed]
Fluffy_Pillow 233.9/300 78% energy
7.0/7 100% CP
bloodlust, slice_and_dice, vanish, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, darkest_night, deathstalkers_mark_buff, improved_garrote_aura, kingsbane(30), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:15.074Zshiv
[stealthed]
Fluffy_Pillow 222.6/300 74% energy
7.0/7 100% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, darkest_night, improved_garrote, kingsbane(34), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:16.080aenvenom
[stealthed]
Fluffy_Pillow 241.3/300 80% energy
7.0/7 100% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, darkest_night, improved_garrote, kingsbane(38), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:17.084bgarrote
[stealthed]
Fluffy_Pillow 239.0/300 80% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, kingsbane(40), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:18.089Jthistle_tea
[cds]
Lycrow 242.8/300 81% energy
3.0/7 43% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, kingsbane(44), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:18.089Smutilate
[direct]
Fluffy_Pillow 300.0/300 100% energy
3.0/7 43% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, kingsbane(44), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:19.095Penvenom
[direct]
Fluffy_Pillow 272.8/300 91% energy
5.0/7 71% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, kingsbane(50), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:20.097Smutilate
[direct]
Fluffy_Pillow 286.7/300 96% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(50), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:21.101Smutilate
[direct]
Fluffy_Pillow 275.7/300 92% energy
3.0/7 43% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(50), serrated_bone_spike_charges(2), stance__surekian_decimation, nascent_empowerment_Vers, tempered_potion
0:22.104Penvenom
[direct]
Fluffy_Pillow 248.6/300 83% energy
5.0/7 71% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, tempered_potion
0:23.109Smutilate
[direct]
Fluffy_Pillow 278.6/300 93% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, tempered_potion
0:24.113Smutilate
[direct]
Fluffy_Pillow 251.5/300 84% energy
2.0/7 29% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, tempered_potion
0:25.118Smutilate
[direct]
Fluffy_Pillow 224.5/300 75% energy
4.0/7 57% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, tempered_potion
0:26.121Qenvenom
[direct]
Fluffy_Pillow 189.6/300 63% energy
7.0/7 100% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, lingering_darkness, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste, tempered_potion
0:27.125Rambush
[direct]
Fluffy_Pillow 180.5/300 60% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste, tempered_potion
0:28.128Smutilate
[direct]
Fluffy_Pillow 214.3/300 71% energy
3.0/7 43% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste, tempered_potion
0:29.131Orupture
[core_dot]
Fluffy_Pillow 188.1/300 63% energy
5.0/7 71% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, lingering_darkness, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste, tempered_potion
0:30.134Rambush
[direct]
Fluffy_Pillow 196.9/300 66% energy
2.0/7 29% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, blindside, serrated_bone_spike_charges, stance__surekian_decimation, flask_of_alchemical_chaos_haste, tempered_potion
0:31.138Penvenom
[direct]
Fluffy_Pillow 222.7/300 74% energy
5.0/7 71% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste, tempered_potion
0:32.142Smutilate
[direct]
Fluffy_Pillow 221.5/300 74% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:33.146Smutilate
[direct]
Fluffy_Pillow 186.7/300 62% energy
4.0/7 57% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:34.149Penvenom
[direct]
Fluffy_Pillow 159.9/300 53% energy
6.0/7 86% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:35.152Smutilate
[direct]
Fluffy_Pillow 198.1/300 66% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:36.156Smutilate
[direct]
Fluffy_Pillow 163.3/300 54% energy
3.0/7 43% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:37.161Ngarrote
[core_dot]
Fluffy_Pillow 136.5/300 46% energy
6.0/7 86% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:38.165Qenvenom
[direct]
Fluffy_Pillow 116.7/300 39% energy
7.0/7 100% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:39.171Smutilate
[direct]
Fluffy_Pillow 115.0/300 38% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:40.177Rambush
[direct]
Fluffy_Pillow 87.5/300 29% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:42.775Penvenom
[direct]
Fluffy_Pillow 152.8/300 51% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), clear_the_witnesses, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:43.781Smutilate
[direct]
Fluffy_Pillow 130.5/300 44% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:44.786Smutilate
[direct]
Fluffy_Pillow 99.3/300 33% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:46.279Smutilate
[direct]
Fluffy_Pillow 74.2/300 25% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:49.953Ngarrote
[core_dot]
Fluffy_Pillow 92.9/300 31% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:50.958Orupture
[core_dot]
Fluffy_Pillow 60.6/300 20% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, deathstalkers_mark_buff, lingering_darkness, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:51.962Rambush
[direct]
Fluffy_Pillow 64.5/300 21% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), thistle_tea, deathstalkers_mark_buff, lingering_darkness, blindside, serrated_bone_spike_charges, stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:52.967Smutilate
[direct]
Fluffy_Pillow 77.3/300 26% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), serrated_bone_spike_charges, stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:58.330Mcold_blood
[cds]
Lycrow 150.1/300 50% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), serrated_bone_spike_charges, stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:58.330Penvenom
[direct]
Fluffy_Pillow 150.1/300 50% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), cold_blood, serrated_bone_spike_charges, stance__surekian_decimation, flask_of_alchemical_chaos_haste
0:59.336Smutilate
[direct]
Fluffy_Pillow 168.1/300 56% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges, stance__surekian_decimation, flask_of_alchemical_chaos_haste
1:00.340Smutilate
[direct]
Fluffy_Pillow 137.1/300 46% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges, stance__surekian_decimation, flask_of_alchemical_chaos_haste
1:01.346Smutilate
[direct]
Fluffy_Pillow 90.1/300 30% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
1:06.849Smutilate
[direct]
Fluffy_Pillow 165.3/300 55% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
1:07.853Qenvenom
[direct]
Fluffy_Pillow 118.3/300 39% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
1:08.855Vshiv
[shiv]
Fluffy_Pillow 112.4/300 37% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
1:09.860Ikingsbane
[cds]
Fluffy_Pillow 95.5/300 32% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
1:10.863Tuse_items
[items]
Fluffy_Pillow 89.6/300 30% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), clear_the_witnesses, kingsbane(2), serrated_bone_spike_charges(2), stance__surekian_decimation, flask_of_alchemical_chaos_haste
1:10.863Jthistle_tea
[cds]
Lycrow 89.6/300 30% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), clear_the_witnesses, kingsbane(2), serrated_bone_spike_charges(2), stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:10.863Ngarrote
[core_dot]
Fluffy_Pillow 189.6/300 63% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), thistle_tea, clear_the_witnesses, kingsbane(2), serrated_bone_spike_charges(2), stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:11.867Smutilate
[direct]
Fluffy_Pillow 165.7/300 55% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), thistle_tea, clear_the_witnesses, kingsbane(5), serrated_bone_spike_charges(2), stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:12.870Penvenom
[direct]
Fluffy_Pillow 126.8/300 42% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), thistle_tea, clear_the_witnesses, blindside, kingsbane(8), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:13.873Rambush
[direct]
Fluffy_Pillow 121.1/300 40% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, blindside, kingsbane(12), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:14.878Smutilate
[direct]
Fluffy_Pillow 134.3/300 45% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, kingsbane(14), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:15.883Penvenom
[direct]
Fluffy_Pillow 103.6/300 35% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, kingsbane(17), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:16.888Vshiv
[shiv]
Fluffy_Pillow 89.8/300 30% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, kingsbane(18), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:17.893Smutilate
[direct]
Fluffy_Pillow 81.1/300 27% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, kingsbane(25), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:19.675Smutilate
[direct]
Fluffy_Pillow 60.6/300 20% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, kingsbane(30), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
1:21.149Penvenom
[direct]
Fluffy_Pillow 36.0/300 12% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, kingsbane(34), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:22.152Smutilate
[direct]
Fluffy_Pillow 70.3/300 23% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, kingsbane(39), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:24.819Smutilate
[direct]
Fluffy_Pillow 61.4/300 20% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
1:26.955Ngarrote
[core_dot]
Fluffy_Pillow 60.9/300 20% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:29.288Smutilate
[direct]
Fluffy_Pillow 61.3/300 20% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:30.791Qenvenom
[direct]
Fluffy_Pillow 36.2/300 12% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:33.939Smutilate
[direct]
Fluffy_Pillow 72.7/300 24% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:36.473Smutilate
[direct]
Fluffy_Pillow 60.4/300 20% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), clear_the_witnesses, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:37.897Orupture
[core_dot]
Fluffy_Pillow 25.4/300 8% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
1:41.120Smutilate
[direct]
Fluffy_Pillow 63.0/300 21% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_crit
1:43.990Ngarrote
[core_dot]
Fluffy_Pillow 61.4/300 20% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_crit
1:46.368Smutilate
[direct]
Fluffy_Pillow 60.9/300 20% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_crit
1:53.560Mcold_blood
[cds]
Lycrow 151.0/300 50% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_crit
1:53.560Penvenom
[direct]
Fluffy_Pillow 151.0/300 50% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), cold_blood, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_crit
1:54.564Smutilate
[direct]
Fluffy_Pillow 144.1/300 48% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, deathstalkers_mark_buff, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_crit
1:55.569Smutilate
[direct]
Fluffy_Pillow 96.7/300 32% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, deathstalkers_mark_buff, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_crit
1:56.572Smutilate
[direct]
Fluffy_Pillow 65.7/300 22% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, deathstalkers_mark_buff, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
1:58.469Orupture
[core_dot]
Fluffy_Pillow 46.7/300 16% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, deathstalkers_mark_buff, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
1:59.474Smutilate
[direct]
Fluffy_Pillow 83.0/300 28% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges, surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:00.479Rambush
[direct]
Fluffy_Pillow 44.4/300 15% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), darkest_night, deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:01.483Qenvenom
[direct]
Fluffy_Pillow 73.7/300 25% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), darkest_night, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:02.488Ngarrote
[core_dot]
Fluffy_Pillow 60.2/300 20% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:04.650Smutilate
[direct]
Fluffy_Pillow 68.2/300 23% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:05.656Rambush
[direct]
Fluffy_Pillow 21.7/300 7% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, blindside, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:07.939Gdeathmark
[cds]
Fluffy_Pillow 84.3/300 28% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:08.944Wshiv
[shiv]
Fluffy_Pillow 97.8/300 33% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:09.949Jthistle_tea
[cds]
Lycrow 113.2/300 38% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:09.949Penvenom
[direct]
Fluffy_Pillow 213.2/300 71% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), thistle_tea, clear_the_witnesses, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:10.952Ikingsbane
[cds]
Fluffy_Pillow 207.7/300 69% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:11.956Tuse_items
[items]
Fluffy_Pillow 202.2/300 67% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(2), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:11.956Smutilate
[direct]
Fluffy_Pillow 202.2/300 67% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(2), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:12.962Smutilate
[direct]
Fluffy_Pillow 187.7/300 63% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(10), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:13.965cvanish
[vanish]
Lycrow 157.1/300 52% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, deathstalkers_mark_buff, kingsbane(20), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:14.069aenvenom
[stealthed]
Fluffy_Pillow 158.5/300 53% energy
6.0/7 86% CP
slice_and_dice, vanish, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, deathstalkers_mark_buff, improved_garrote_aura, kingsbane(20), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Haste, flask_of_alchemical_chaos_haste
2:15.073bgarrote
[stealthed]
Fluffy_Pillow 152.9/300 51% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), thistle_tea, deathstalkers_mark_buff, improved_garrote, kingsbane(22), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:16.077Smutilate
[direct]
Fluffy_Pillow 153.0/300 51% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), deathstalkers_mark_buff, improved_garrote, kingsbane(28), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:17.080Zshiv
[stealthed]
Fluffy_Pillow 106.1/300 35% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), deathstalkers_mark_buff, improved_garrote, kingsbane(40), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:18.084Penvenom
[direct]
Fluffy_Pillow 121.2/300 40% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), deathstalkers_mark_buff, improved_garrote, kingsbane(46), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:19.089Smutilate
[direct]
Fluffy_Pillow 155.3/300 52% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), darkest_night, deathstalkers_mark_buff, improved_garrote, kingsbane(46), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:20.093Smutilate
[direct]
Fluffy_Pillow 124.4/300 41% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), darkest_night, deathstalkers_mark_buff, kingsbane(50), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:21.097Smutilate
[direct]
Fluffy_Pillow 109.6/300 37% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), darkest_night, deathstalkers_mark_buff, kingsbane(50), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:22.101Qenvenom
[direct]
Fluffy_Pillow 62.7/300 21% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), darkest_night, deathstalkers_mark_buff, kingsbane(50), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:23.104Smutilate
[direct]
Fluffy_Pillow 72.9/300 24% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, kingsbane(50), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:24.107Rambush
[direct]
Fluffy_Pillow 34.1/300 11% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, blindside, kingsbane(50), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:29.534Penvenom
[direct]
Fluffy_Pillow 161.7/300 54% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:30.539Smutilate
[direct]
Fluffy_Pillow 140.0/300 47% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:31.544Smutilate
[direct]
Fluffy_Pillow 109.2/300 36% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:32.549Smutilate
[direct]
Fluffy_Pillow 70.5/300 23% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:33.553Orupture
[core_dot]
Fluffy_Pillow 31.7/300 11% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_haste
2:35.896Smutilate
[direct]
Fluffy_Pillow 61.6/300 21% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:38.570Ngarrote
[core_dot]
Fluffy_Pillow 68.9/300 23% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:44.541Mcold_blood
[cds]
Lycrow 158.7/300 53% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:44.541Penvenom
[direct]
Fluffy_Pillow 158.7/300 53% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), cold_blood, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:45.546Smutilate
[direct]
Fluffy_Pillow 184.3/300 61% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:46.550Smutilate
[direct]
Fluffy_Pillow 144.9/300 48% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:47.555Smutilate
[direct]
Fluffy_Pillow 105.5/300 35% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:48.560Qenvenom
[direct]
Fluffy_Pillow 66.1/300 22% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:49.714Smutilate
[direct]
Fluffy_Pillow 61.8/300 21% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:51.888Ngarrote
[core_dot]
Fluffy_Pillow 45.4/300 15% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Vers, flask_of_alchemical_chaos_haste
2:54.818Smutilate
[direct]
Fluffy_Pillow 69.5/300 23% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
3:02.064Penvenom
[direct]
Fluffy_Pillow 161.5/300 54% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity, serrated_bone_spike_charges(3), stance__surekian_flourish, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:03.071Smutilate
[direct]
Fluffy_Pillow 146.7/300 49% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), deathstalkers_mark_buff, serrated_bone_spike_charges(3), stance__surekian_flourish, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:04.077Smutilate
[direct]
Fluffy_Pillow 107.0/300 36% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), deathstalkers_mark_buff, serrated_bone_spike_charges(3), stance__surekian_flourish, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:05.082Smutilate
[direct]
Fluffy_Pillow 67.2/300 22% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), deathstalkers_mark_buff, serrated_bone_spike_charges(3), stance__surekian_flourish, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:08.452Orupture
[core_dot]
Fluffy_Pillow 80.2/300 27% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(3), stance__surekian_flourish, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:09.456Ngarrote
[core_dot]
Fluffy_Pillow 75.5/300 25% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:10.460Rambush
[direct]
Fluffy_Pillow 50.8/300 17% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:15.547Penvenom
[direct]
Fluffy_Pillow 161.3/300 54% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(3), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_vers
3:16.553Vshiv
[shiv]
Fluffy_Pillow 186.7/300 62% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_vers
3:17.558Ikingsbane
[cds]
Fluffy_Pillow 177.0/300 59% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_vers
3:18.563Tuse_items
[items]
Fluffy_Pillow 162.3/300 54% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), darkest_night, deathstalkers_mark_buff, kingsbane(3), serrated_bone_spike_charges(2), stance__surekian_flourish, surekian_grace, flask_of_alchemical_chaos_vers
3:18.563Jthistle_tea
[cds]
Lycrow 162.3/300 54% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), darkest_night, deathstalkers_mark_buff, kingsbane(3), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:18.563Smutilate
[direct]
Fluffy_Pillow 262.3/300 87% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, darkest_night, deathstalkers_mark_buff, kingsbane(3), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:19.568Smutilate
[direct]
Fluffy_Pillow 222.7/300 74% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, darkest_night, deathstalkers_mark_buff, kingsbane(5), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:20.575Qenvenom
[direct]
Fluffy_Pillow 183.1/300 61% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, darkest_night, deathstalkers_mark_buff, kingsbane(7), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:21.579Smutilate
[direct]
Fluffy_Pillow 168.5/300 56% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(9), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:22.583Smutilate
[direct]
Fluffy_Pillow 129.0/300 43% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(12), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:23.587Smutilate
[direct]
Fluffy_Pillow 89.4/300 30% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(16), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:24.591Vshiv
[shiv]
Fluffy_Pillow 57.9/300 19% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), clear_the_witnesses, deathstalkers_mark_buff, blindside, kingsbane(17), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:25.597Penvenom
[direct]
Fluffy_Pillow 48.3/300 16% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), clear_the_witnesses, deathstalkers_mark_buff, blindside, kingsbane(20), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_vers
3:26.604Rambush
[direct]
Fluffy_Pillow 33.9/300 11% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, blindside, kingsbane(23), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:27.609Ngarrote
[core_dot]
Fluffy_Pillow 54.5/300 18% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(26), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:29.815Smutilate
[direct]
Fluffy_Pillow 61.1/300 20% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(31), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:30.821Mcold_blood
[cds]
Lycrow 21.7/300 7% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(35), serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:31.532Penvenom
[direct]
Fluffy_Pillow 38.6/300 13% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), cold_blood, clear_the_witnesses, kingsbane(35), serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:34.282Smutilate
[direct]
Fluffy_Pillow 62.1/300 21% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:37.126Smutilate
[direct]
Fluffy_Pillow 61.7/300 21% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:38.129Rambush
[direct]
Fluffy_Pillow 22.2/300 7% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:40.478Penvenom
[direct]
Fluffy_Pillow 75.6/300 25% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:41.483Smutilate
[direct]
Fluffy_Pillow 101.2/300 34% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:42.486Smutilate
[direct]
Fluffy_Pillow 61.8/300 21% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:43.956Qenvenom
[direct]
Fluffy_Pillow 36.2/300 12% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:44.961Rambush
[direct]
Fluffy_Pillow 21.8/300 7% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:46.283Ngarrote
[core_dot]
Fluffy_Pillow 46.3/300 15% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:49.150Smutilate
[direct]
Fluffy_Pillow 69.2/300 23% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:50.153Orupture
[core_dot]
Fluffy_Pillow 29.8/300 10% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, flask_of_alchemical_chaos_mastery
3:51.156Rambush
[direct]
Fluffy_Pillow 25.3/300 8% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
3:57.131Penvenom
[direct]
Fluffy_Pillow 156.2/300 52% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:58.134Rambush
[direct]
Fluffy_Pillow 141.8/300 47% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:59.138Smutilate
[direct]
Fluffy_Pillow 162.4/300 54% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:01.414Penvenom
[direct]
Fluffy_Pillow 155.0/300 52% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:02.417Rambush
[direct]
Fluffy_Pillow 180.6/300 60% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:03.424Ngarrote
[core_dot]
Fluffy_Pillow 201.3/300 67% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:04.428Smutilate
[direct]
Fluffy_Pillow 176.9/300 59% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:05.434Smutilate
[direct]
Fluffy_Pillow 137.6/300 46% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:06.437Qenvenom
[direct]
Fluffy_Pillow 98.2/300 33% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:07.443Rambush
[direct]
Fluffy_Pillow 83.8/300 28% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:08.447Rambush
[direct]
Fluffy_Pillow 112.4/300 37% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:10.185Penvenom
[direct]
Fluffy_Pillow 150.3/300 50% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:11.189Rambush
[direct]
Fluffy_Pillow 135.9/300 45% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:12.193Smutilate
[direct]
Fluffy_Pillow 156.5/300 52% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:13.196Smutilate
[direct]
Fluffy_Pillow 117.1/300 39% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:14.200dvanish
[vanish]
Lycrow 77.7/300 26% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:14.605Orupture
[core_dot]
Fluffy_Pillow 90.8/300 30% energy
7.0/7 100% CP
slice_and_dice, vanish, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, improved_garrote_aura, blindside, serrated_bone_spike_charges(3), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:15.608bgarrote
[stealthed]
Fluffy_Pillow 86.4/300 29% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:16.613Gdeathmark
[cds]
Fluffy_Pillow 62.1/300 21% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:17.618Zshiv
[stealthed]
Fluffy_Pillow 90.7/300 30% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:18.622Jthistle_tea
[cds]
Lycrow 89.3/300 30% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, improved_garrote, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:18.622Penvenom
[direct]
Fluffy_Pillow 189.3/300 63% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), thistle_tea, deathstalkers_mark_buff, improved_garrote, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:19.628Yambush
[stealthed]
Fluffy_Pillow 223.0/300 74% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, darkest_night, deathstalkers_mark_buff, improved_garrote, blindside, serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:20.634Ikingsbane
[cds]
Fluffy_Pillow 267.6/300 89% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, darkest_night, serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:21.637Tuse_items
[items]
Fluffy_Pillow 261.2/300 87% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, darkest_night, kingsbane(6), serrated_bone_spike_charges(2), stance__surekian_decimation, surekian_grace, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:21.637Smutilate
[direct]
Fluffy_Pillow 261.2/300 87% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, darkest_night, kingsbane(6), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:22.642Qenvenom
[direct]
Fluffy_Pillow 229.9/300 77% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, darkest_night, blindside, kingsbane(6), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:23.644Rambush
[direct]
Fluffy_Pillow 223.5/300 74% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, blindside, kingsbane(10), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_vers
4:24.649Smutilate
[direct]
Fluffy_Pillow 252.1/300 84% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(14), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_vers
4:25.654Vshiv
[shiv]
Fluffy_Pillow 220.7/300 74% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, blindside, kingsbane(20), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_vers
4:26.659Mcold_blood
[cds]
Lycrow 219.9/300 73% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, blindside, kingsbane(26), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:26.659Penvenom
[direct]
Fluffy_Pillow 219.9/300 73% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), cold_blood, clear_the_witnesses, blindside, kingsbane(26), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:27.666Rambush
[direct]
Fluffy_Pillow 230.1/300 77% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, blindside, kingsbane(30), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:28.669Smutilate
[direct]
Fluffy_Pillow 259.4/300 86% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(34), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:29.672Penvenom
[direct]
Fluffy_Pillow 228.6/300 76% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(50), serrated_bone_spike_charges(2), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:30.676Smutilate
[direct]
Fluffy_Pillow 222.8/300 74% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, kingsbane(50), serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:31.680Smutilate
[direct]
Fluffy_Pillow 192.1/300 64% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, kingsbane(50), serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:32.683Penvenom
[direct]
Fluffy_Pillow 177.3/300 59% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, kingsbane(50), serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:33.688Smutilate
[direct]
Fluffy_Pillow 203.6/300 68% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, lingering_darkness, kingsbane(50), serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:34.694Smutilate
[direct]
Fluffy_Pillow 164.8/300 55% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:35.698Smutilate
[direct]
Fluffy_Pillow 126.1/300 42% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:36.700Qenvenom
[direct]
Fluffy_Pillow 87.3/300 29% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:37.703Smutilate
[direct]
Fluffy_Pillow 81.5/300 27% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:38.706Rambush
[direct]
Fluffy_Pillow 42.8/300 14% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, blindside, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:39.712Ngarrote
[core_dot]
Fluffy_Pillow 64.0/300 21% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:40.718Penvenom
[direct]
Fluffy_Pillow 40.3/300 13% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:43.120Smutilate
[direct]
Fluffy_Pillow 61.0/300 20% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:44.125Rambush
[direct]
Fluffy_Pillow 22.2/300 7% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, blindside, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:45.128Penvenom
[direct]
Fluffy_Pillow 51.5/300 17% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:47.256Smutilate
[direct]
Fluffy_Pillow 60.5/300 20% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:48.260Rambush
[direct]
Fluffy_Pillow 21.8/300 7% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, lingering_darkness, blindside, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:49.266Penvenom
[direct]
Fluffy_Pillow 43.0/300 14% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:50.269Smutilate
[direct]
Fluffy_Pillow 77.3/300 26% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:52.418Smutilate
[direct]
Fluffy_Pillow 61.6/300 21% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, nascent_empowerment_Crit, flask_of_alchemical_chaos_haste
4:53.544Xshiv
[shiv]
Fluffy_Pillow 32.5/300 11% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_haste
4:56.489Smutilate
[direct]
Fluffy_Pillow 64.4/300 21% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_vers
4:57.747Qenvenom
[direct]
Fluffy_Pillow 35.4/300 12% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), surekian_grace, stance__surekian_barrage, flask_of_alchemical_chaos_vers

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470497074847028515 (24673)
Stamina864520243825232215145763
Intellect12000012360120000
Spirit00000
Health487650046443000
Energy3003000
Combo Points770
Spell Power12360120000
Crit27.08%27.50%10849
Haste14.20%8.84%5833
Versatility8.97%6.35%4951
Attack Power5317749408938
Mastery34.60%31.20%7245
Armor215892158921589
Run Speed80215
Leech6.00%6.00%3060

Gear

Source Slot Average Item Level: 603.00
Local Head Beyond's Dark Visage
ilevel: 597, stats: { 2,609 Armor, +13,369 Sta, +503 Crit, +1,136 Vers, +2,566 AgiInt }
Local Neck Gold-Thread Choker
ilevel: 606, stats: { +8,601 Sta, +2,771 Crit, +1,960 Vers }
Local Shoulders K'areshi Phantom's Shoulderpads
ilevel: 619, stats: { 2,701 Armor, +13,812 Sta, +900 Vers, +481 Mastery, +2,362 AgiInt }
Local Shirt Lucky Shirt
ilevel: 1
Local Chest Lockstitch Vest of the Fireflash (lockstitch_vest)
ilevel: 593, stats: { 3,406 Armor, +12,583 Sta, +2,472 AgiInt, +1,145 Crit, +458 Haste }, enchant: { +440 Agi, +215 RunSpeed (stormriders_agility_2) }
Local Waist Behemoth's Eroded Cinch
ilevel: 606, stats: { 2,054 Armor, +11,469 Sta, +434 Crit, +857 Haste, +2,093 AgiInt }
Local Legs Treasure-Seeker's Breeches
ilevel: 606, stats: { 3,195 Armor, +15,291 Sta, +787 Haste, +934 Mastery, +2,790 AgiInt }, enchant: { +980 BonusArmor, +930 StrAgi (defenders_armor_kit_3) }
Local Feet Treasure-Seeker's Boots
ilevel: 606, stats: { 2,282 Armor, +11,469 Sta, +563 Crit, +729 Mastery, +2,093 AgiInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Treasure-Seeker's Bindings
ilevel: 616, stats: { 1,931 Armor, +9,938 Sta, +554 Haste, +466 Mastery, +1,723 AgiInt }, enchant: { +2,040 Leech (chant_of_armored_leech_3) }
Local Hands Lockstitch Grips of the Quickblade (lockstitch_grips)
ilevel: 593, stats: { 1,916 Armor, +9,438 Sta, +1,854 AgiInt, +343 Crit, +858 Vers }
Local Finger1 Band of the Ancient Dredger
ilevel: 606, stats: { +8,601 Sta, +2,487 Crit, +2,244 Haste }, enchant: { +190 Crit (glimmering_critical_strike_3) }
Local Finger2 Umbriss Band
ilevel: 606, stats: { +8,601 Sta, +1,419 Crit, +3,311 Mastery }, enchant: { +190 Crit (glimmering_critical_strike_3) }
Local Trinket1 Sikran's Endless Arsenal
ilevel: 606, stats: { +2,652 StrAgi }
item effects: { equip: Sikran's Endless Arsenal, use: Sikran's Endless Arsenal }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 597, stats: { +2,439 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Royal Emblem of Nerub-ar
ilevel: 610, stats: { 1,495 Armor, +9,112 Sta, +311 Crit, +678 Mastery, +1,629 StrAgiInt }, enchant: { +1,020 Leech (chant_of_leeching_fangs_3) }
Local Main Hand Splice 'n Dice
ilevel: 593, weapon: { 1,896 - 3,162, 1.8 }, stats: { +1,236 Agi, +6,292 Sta, +280 Crit, +521 Haste }, enchant: authority_of_the_depths_2, temporary_enchant: Ironclaw Sharpened Weapon
Local Off Hand Crepuscular Carver
ilevel: 593, weapon: { 1,896 - 3,162, 1.8 }, stats: { +1,236 Agi, +6,292 Sta, +298 Haste, +504 Mastery }, enchant: authority_of_the_depths_2, temporary_enchant: Ironclaw Sharpened Weapon

Profile

rogue="Lycrow"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/lycrow"
spec=assassination
level=80
race=human
role=attack
position=back
talents=CMQA27SZpS4XnmFfcXRqkppuwPjZmhxMYAAAAAAYWglZAAAAAAottZmxMzMGzMz2sNGjZYGzMzMmZz2YGgtZWGLMmxs0Y2WGmsNMsA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/flask
actions.precombat+=/augmentation
actions.precombat+=/food
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)&!trinket.2.is.treacherous_transmitter|trinket.1.is.treacherous_transmitter
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)&!trinket.1.is.treacherous_transmitter|trinket.2.is.treacherous_transmitter
actions.precombat+=/variable,name=effective_spend_cp,value=cp_max_spend-2<?5*talent.hand_of_fate
actions.precombat+=/stealth
actions.precombat+=/slice_and_dice,precombat_seconds=1

# Executed every time the actor is available.
actions=stealth
actions+=/kick
actions+=/variable,name=single_target,value=spell_targets.fan_of_knives<2
actions+=/variable,name=regen_saturated,value=energy.regen_combined>30
actions+=/variable,name=in_cooldowns,value=dot.deathmark.ticking|dot.kingsbane.ticking|debuff.shiv.up
actions+=/variable,name=clip_envenom,value=buff.envenom.up&buff.envenom.remains.1<=1
actions+=/variable,name=upper_limit_energy,value=energy.pct>=(70-30*talent.sanguine_blades-10*talent.vicious_venoms.rank)
actions+=/variable,name=avoid_tea,value=energy>40+50+5*talent.vicious_venoms.rank
actions+=/variable,name=cd_soon,value=cooldown.kingsbane.remains<6&!cooldown.kingsbane.ready
actions+=/variable,name=not_pooling,value=variable.in_cooldowns|!variable.cd_soon&variable.avoid_tea&buff.darkest_night.up|!variable.cd_soon&variable.avoid_tea&variable.clip_envenom|variable.upper_limit_energy|fight_remains<=20
actions+=/call_action_list,name=stealthed,if=stealthed.rogue|stealthed.improved_garrote|master_assassin_remains>0
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=core_dot
actions+=/call_action_list,name=aoe_dot,if=!variable.single_target
actions+=/call_action_list,name=direct
actions+=/arcane_torrent,if=energy.deficit>=15+energy.regen_combined
actions+=/arcane_pulse
actions+=/lights_judgment
actions+=/bag_of_tricks

actions.aoe_dot=variable,name=scent_effective_max_stacks,value=(spell_targets.fan_of_knives*talent.scent_of_blood.rank*2)>?20
actions.aoe_dot+=/variable,name=scent_saturation,value=buff.scent_of_blood.stack>=variable.scent_effective_max_stacks
actions.aoe_dot+=/variable,name=dot_finisher_condition,value=combo_points>=variable.effective_spend_cp&(pmultiplier<=1)
actions.aoe_dot+=/crimson_tempest,target_if=min:remains,if=spell_targets>=2&variable.dot_finisher_condition&refreshable&target.time_to_die-remains>6
actions.aoe_dot+=/garrote,cycle_targets=1,if=combo_points.deficit>=1&(pmultiplier<=1)&refreshable&!variable.regen_saturated&target.time_to_die-remains>12
actions.aoe_dot+=/rupture,cycle_targets=1,if=variable.dot_finisher_condition&refreshable&(!dot.kingsbane.ticking|buff.cold_blood.up)&(!variable.regen_saturated&(talent.scent_of_blood.rank=2|talent.scent_of_blood.rank<=1&(buff.indiscriminate_carnage.up|target.time_to_die-remains>15)))&target.time_to_die-remains>(7+(talent.dashing_scoundrel*5)+(variable.regen_saturated*6))&!buff.darkest_night.up
actions.aoe_dot+=/rupture,cycle_targets=1,if=variable.dot_finisher_condition&refreshable&(!dot.kingsbane.ticking|buff.cold_blood.up)&variable.regen_saturated&!variable.scent_saturation&target.time_to_die-remains>19&!buff.darkest_night.up
actions.aoe_dot+=/garrote,if=refreshable&combo_points.deficit>=1&(pmultiplier<=1|remains<=tick_time&spell_targets.fan_of_knives>=3)&(remains<=tick_time*2&spell_targets.fan_of_knives>=3)&(target.time_to_die-remains)>4&master_assassin_remains=0

actions.cds=variable,name=deathmark_ma_condition,value=!talent.master_assassin.enabled|dot.garrote.ticking
actions.cds+=/variable,name=deathmark_kingsbane_condition,value=!talent.kingsbane|cooldown.kingsbane.remains<=2
actions.cds+=/variable,name=deathmark_condition,value=!stealthed.rogue&buff.slice_and_dice.remains>5&dot.rupture.ticking&buff.envenom.up&!debuff.deathmark.up&variable.deathmark_ma_condition&variable.deathmark_kingsbane_condition
actions.cds+=/call_action_list,name=items
actions.cds+=/invoke_external_buff,name=power_infusion,if=dot.deathmark.ticking
actions.cds+=/deathmark,if=(variable.deathmark_condition&target.time_to_die>=10)|fight_remains<=20
actions.cds+=/call_action_list,name=shiv
actions.cds+=/kingsbane,if=(debuff.shiv.up|cooldown.shiv.remains<6)&buff.envenom.up&(cooldown.deathmark.remains>=50|dot.deathmark.ticking)|fight_remains<=15
actions.cds+=/thistle_tea,if=!buff.thistle_tea.up&debuff.shiv.remains>=4|spell_targets.fan_of_knives>=4&debuff.shiv.remains>=6|fight_remains<=cooldown.thistle_tea.charges*6
actions.cds+=/call_action_list,name=misc_cds
actions.cds+=/call_action_list,name=vanish,if=!stealthed.all&master_assassin_remains=0
actions.cds+=/cold_blood,if=!buff.edge_case.up&cooldown.deathmark.remains>10&!buff.darkest_night.up&combo_points>=variable.effective_spend_cp&(variable.not_pooling|debuff.amplifying_poison.stack>=20|!variable.single_target)&!buff.vanish.up&(!cooldown.kingsbane.up|!variable.single_target)&!cooldown.deathmark.up

actions.core_dot=garrote,if=combo_points.deficit>=1&(pmultiplier<=1)&refreshable&target.time_to_die-remains>12
actions.core_dot+=/rupture,if=combo_points>=variable.effective_spend_cp&(pmultiplier<=1)&refreshable&target.time_to_die-remains>(4+(talent.dashing_scoundrel*5)+(variable.regen_saturated*6))&(!buff.darkest_night.up|talent.caustic_spatter&!debuff.caustic_spatter.up)

actions.direct=envenom,if=!buff.darkest_night.up&combo_points>=variable.effective_spend_cp&(variable.not_pooling|debuff.amplifying_poison.stack>=20|!variable.single_target)&!buff.vanish.up
actions.direct+=/envenom,if=buff.darkest_night.up&effective_combo_points>=cp_max_spend
actions.direct+=/variable,name=use_filler,value=combo_points.deficit>1|variable.not_pooling|!variable.single_target
actions.direct+=/variable,name=use_caustic_filler,value=talent.caustic_spatter&dot.rupture.ticking&(!debuff.caustic_spatter.up|debuff.caustic_spatter.remains<=2)&combo_points.deficit>1&!variable.single_target
actions.direct+=/mutilate,if=variable.use_caustic_filler
actions.direct+=/ambush,if=variable.use_caustic_filler
actions.direct+=/fan_of_knives,if=variable.use_filler&!priority_rotation&(spell_targets.fan_of_knives>=3-(talent.momentum_of_despair&talent.thrown_precision)|buff.clear_the_witnesses.up&!talent.vicious_venoms)
actions.direct+=/fan_of_knives,target_if=!dot.deadly_poison_dot.ticking&(!priority_rotation|dot.garrote.ticking|dot.rupture.ticking),if=variable.use_filler&spell_targets.fan_of_knives>=3-(talent.momentum_of_despair&talent.thrown_precision)
actions.direct+=/ambush,if=variable.use_filler&(buff.blindside.up|stealthed.rogue)&(!dot.kingsbane.ticking|debuff.deathmark.down|buff.blindside.up)
actions.direct+=/mutilate,target_if=!dot.deadly_poison_dot.ticking&!debuff.amplifying_poison.up,if=variable.use_filler&spell_targets.fan_of_knives=2
actions.direct+=/mutilate,if=variable.use_filler

actions.items=variable,name=base_trinket_condition,value=dot.rupture.ticking&cooldown.deathmark.remains<2|dot.deathmark.ticking|fight_remains<=22
actions.items+=/use_item,name=ashes_of_the_embersoul,use_off_gcd=1,if=(dot.kingsbane.ticking&dot.kingsbane.remains<=11)|fight_remains<=22
actions.items+=/use_item,name=algethar_puzzle_box,use_off_gcd=1,if=variable.base_trinket_condition
actions.items+=/use_item,name=treacherous_transmitter,use_off_gcd=1,if=variable.base_trinket_condition
actions.items+=/use_item,name=mad_queens_mandate,if=cooldown.deathmark.remains>=30&!dot.deathmark.ticking|fight_remains<=3
actions.items+=/do_treacherous_transmitter_task,use_off_gcd=1,if=dot.deathmark.ticking&variable.single_target|buff.realigning_nexus_convergence_divergence.up&buff.realigning_nexus_convergence_divergence.remains<=2|buff.cryptic_instructions.up&buff.cryptic_instructions.remains<=2|buff.errant_manaforge_emission.up&buff.errant_manaforge_emission.remains<=2|fight_remains<=15
actions.items+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=variable.base_trinket_condition
actions.items+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(debuff.deathmark.up|fight_remains<=20)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready&dot.kingsbane.ticking|!debuff.deathmark.up&cooldown.deathmark.remains>20&dot.kingsbane.ticking))|!variable.trinket_sync_slot)
actions.items+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(debuff.deathmark.up|fight_remains<=20)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready&dot.kingsbane.ticking|!debuff.deathmark.up&cooldown.deathmark.remains>20&dot.kingsbane.ticking))|!variable.trinket_sync_slot)

actions.misc_cds=potion,if=buff.bloodlust.react|fight_remains<30|debuff.deathmark.up
actions.misc_cds+=/blood_fury,if=debuff.deathmark.up
actions.misc_cds+=/berserking,if=debuff.deathmark.up
actions.misc_cds+=/fireblood,if=debuff.deathmark.up
actions.misc_cds+=/ancestral_call,if=(!talent.kingsbane&debuff.deathmark.up&debuff.shiv.up)|(talent.kingsbane&debuff.deathmark.up&dot.kingsbane.ticking&dot.kingsbane.remains<8)

actions.shiv=variable,name=shiv_condition,value=!debuff.shiv.up&dot.garrote.ticking&dot.rupture.ticking
actions.shiv+=/variable,name=shiv_kingsbane_condition,value=talent.kingsbane&buff.envenom.up&variable.shiv_condition
actions.shiv+=/shiv,if=talent.arterial_precision&variable.shiv_condition&spell_targets.fan_of_knives>=4&dot.crimson_tempest.ticking
actions.shiv+=/shiv,if=!talent.lightweight_shiv.enabled&variable.shiv_kingsbane_condition&(dot.kingsbane.ticking&dot.kingsbane.remains<8|!dot.kingsbane.ticking&cooldown.kingsbane.remains>=20)&(!talent.crimson_tempest.enabled|variable.single_target|dot.crimson_tempest.ticking)
actions.shiv+=/shiv,if=talent.lightweight_shiv.enabled&variable.shiv_kingsbane_condition&(dot.kingsbane.ticking|cooldown.kingsbane.remains<=1)
actions.shiv+=/shiv,if=talent.arterial_precision&variable.shiv_condition&debuff.deathmark.up
actions.shiv+=/shiv,if=!talent.kingsbane&!talent.arterial_precision&variable.shiv_condition&(!talent.crimson_tempest.enabled|variable.single_target|dot.crimson_tempest.ticking)
actions.shiv+=/shiv,if=fight_remains<=cooldown.shiv.charges*8

actions.stealthed=pool_resource,for_next=1
actions.stealthed+=/ambush,if=!debuff.deathstalkers_mark.up&talent.deathstalkers_mark
actions.stealthed+=/shiv,if=talent.kingsbane&(dot.kingsbane.ticking|cooldown.kingsbane.up)&(!debuff.shiv.up&debuff.shiv.remains<1)&buff.envenom.up
actions.stealthed+=/envenom,if=effective_combo_points>=variable.effective_spend_cp&dot.kingsbane.ticking&buff.envenom.remains<=3&(debuff.deathstalkers_mark.up|buff.edge_case.up|buff.cold_blood.up)
actions.stealthed+=/envenom,if=effective_combo_points>=variable.effective_spend_cp&buff.master_assassin_aura.up&variable.single_target&(debuff.deathstalkers_mark.up|buff.edge_case.up|buff.cold_blood.up)
actions.stealthed+=/rupture,target_if=effective_combo_points>=variable.effective_spend_cp&buff.indiscriminate_carnage.up&refreshable&(!variable.regen_saturated|!variable.scent_saturation|!dot.rupture.ticking)&target.time_to_die>15
actions.stealthed+=/garrote,target_if=min:remains,if=stealthed.improved_garrote&(remains<12|pmultiplier<=1|(buff.indiscriminate_carnage.up&active_dot.garrote<spell_targets.fan_of_knives))&!variable.single_target&target.time_to_die-remains>2
actions.stealthed+=/garrote,if=stealthed.improved_garrote&(pmultiplier<=1|remains<12|!variable.single_target&buff.master_assassin_aura.remains<3)&combo_points.deficit>=1+2*talent.shrouded_suffocation

actions.vanish=pool_resource,for_next=1,extra_amount=45
actions.vanish+=/vanish,if=!buff.fatebound_lucky_coin.up&(buff.fatebound_coin_tails.stack>=5|buff.fatebound_coin_heads.stack>=5)
actions.vanish+=/vanish,if=!talent.master_assassin&!talent.indiscriminate_carnage&talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up|cooldown.deathmark.remains<4)&combo_points.deficit>=(spell_targets.fan_of_knives>?4)
actions.vanish+=/pool_resource,for_next=1,extra_amount=45
actions.vanish+=/vanish,if=!talent.master_assassin&talent.indiscriminate_carnage&talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&spell_targets.fan_of_knives>2&(target.time_to_die-remains>15|raid_event.adds.in>20)
actions.vanish+=/vanish,if=!talent.improved_garrote&talent.master_assassin&!dot.rupture.refreshable&dot.garrote.remains>3&debuff.deathmark.up&(debuff.shiv.up|debuff.deathmark.remains<4)
actions.vanish+=/vanish,if=talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up|cooldown.deathmark.remains<4)&raid_event.adds.in>30

head=beyonds_dark_visage,id=212417,bonus_id=6652/10877/10376/10354/10273/1498/10255
neck=goldthread_choker,id=219217,bonus_id=6652/10395/10392/10270/3185/10255
shoulders=kareshi_phantoms_shoulderpads,id=212036,bonus_id=10369/6652/10262/1520/10255
back=royal_emblem_of_nerubar,id=212446,bonus_id=6652/10379/10355/10265/1511/10255,enchant=chant_of_leeching_fangs_3
chest=lockstitch_vest,id=224674,bonus_id=6652/1690/10377/10278/1665/10255,enchant=stormriders_agility_2
shirt=lucky_shirt,id=138385
wrists=treasureseekers_bindings,id=211020,bonus_id=10263/6652/10876/10377/3195/10255,enchant=chant_of_armored_leech_3
hands=lockstitch_grips,id=224676,bonus_id=6652/1682/10377/10278/1665/10255
waist=behemoths_eroded_cinch,id=225583,bonus_id=6652/10876/10376/10354/10270/1507/10255
legs=treasureseekers_breeches,id=211018,bonus_id=6652/10377/10270/3185/10255,enchant=defenders_armor_kit_3
feet=treasureseekers_boots,id=211015,bonus_id=6652/10377/10270/3185/10255,enchant=defenders_march_3
finger1=band_of_the_ancient_dredger,id=159461,bonus_id=10389/6652/10395/10392/10383/10274/10014/10255,enchant=glimmering_critical_strike_3
finger2=umbriss_band,id=133286,bonus_id=10389/6652/10395/10393/10383/10274/10036/10255,enchant=glimmering_critical_strike_3
trinket1=sikrans_endless_arsenal,id=212449,bonus_id=6652/10354/10270/1507/10255
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10273/10390/6652/10383/1632/10255
main_hand=splice_n_dice,id=221183,bonus_id=10388/6652/10290/1628/10255,enchant=authority_of_the_depths_2
off_hand=crepuscular_carver,id=221110,bonus_id=10388/6652/10290/1628/10255,enchant=authority_of_the_depths_2

# Gear Summary
# gear_ilvl=603.31
# gear_agility=28515
# gear_stamina=145763
# gear_attack_power=938
# gear_crit_rating=10636
# gear_haste_rating=5719
# gear_mastery_rating=7103
# gear_versatility_rating=4854
# gear_leech_rating=3060
# gear_speed_rating=215
# gear_armor=21589

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 112498151
Max Event Queue: 132
Sim Seconds: 3007017
CPU Seconds: 109.3148
Physical Seconds: 13.6242
Speed Up: 27508

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Lycrow Lycrow ambush 8676 5519611 18398 4.85 167098 368546 24.3 24.3 30.0% 0.0% 0.0% 0.0% 12.67sec 7885150 300.01sec
Lycrow Lycrow ambush_vicious_venoms 385794 6481561 21604 4.85 267265 0 0.0 24.3 0.0% 0.0% 0.0% 0.0% 0.00sec 6481561 300.01sec
Lycrow Lycrow amplifying_poison 383414 6555203 21850 66.25 15237 30575 0.0 331.2 29.7% 0.0% 0.0% 0.0% 0.00sec 6555203 300.01sec
Lycrow Lycrow augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Lycrow Lycrow auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 121.21sec 0 300.01sec
Lycrow Lycrow auto_attack_mh 0 7906565 26354 68.81 20282 40597 344.1 344.1 29.6% 16.3% 0.0% 0.0% 1.01sec 11295081 300.01sec
Lycrow Lycrow auto_attack_oh 1 3939929 13133 68.61 10141 20300 343.1 343.1 29.6% 16.4% 0.0% 0.0% 1.01sec 5628464 300.01sec
Lycrow Lycrow hunt_them_down 457193 17150139 57165 90.30 29274 58714 451.5 451.5 29.6% 0.0% 0.0% 0.0% 0.81sec 17150139 300.01sec
Lycrow Lycrow cold_blood 382245 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 55.34sec 0 300.01sec
Lycrow Lycrow deadly_poison_driver 2823 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Lycrow Lycrow deadly_poison_instant 113780 6535123 21783 65.99 15251 30602 0.0 330.0 29.7% 0.0% 0.0% 0.0% 0.00sec 6535123 300.01sec
Lycrow Lycrow deadly_poison_dot ticks -2818 4796736 15989 35.49 20834 41796 0.0 177.5 29.6% 0.0% 0.0% 0.0% 0.00sec 4796736 300.01sec
Lycrow Lycrow deathmark ticks -360194 2863604 9545 6.06 72341 144674 2.9 30.3 30.6% 0.0% 0.0% 0.0% 123.67sec 2863604 300.01sec
Lycrow Lycrow garrote_deathmark ticks -360830 4930341 16434 5.78 124424 275336 0.0 28.9 30.6% 0.0% 0.0% 0.0% 0.00sec 4930341 300.01sec
Lycrow Lycrow rupture_deathmark ticks -360826 3679393 12265 5.81 97048 194145 0.0 29.0 30.6% 0.0% 0.0% 0.0% 0.00sec 3679393 300.01sec
Lycrow Lycrow amplifying_poison_deathmark 394328 1501960 5006 12.63 18239 36466 0.0 63.1 30.4% 0.0% 0.0% 0.0% 0.00sec 1501960 300.01sec
Lycrow Lycrow deadly_poison_dot_deathmark ticks -394324 959001 3197 5.81 25293 50539 0.0 29.0 30.6% 0.0% 0.0% 0.0% 0.00sec 959001 300.01sec
Lycrow Lycrow deadly_poison_instant_deathmark 394325 1502330 5008 12.64 18237 36471 0.0 63.2 30.4% 0.0% 0.0% 0.0% 0.00sec 1502330 300.01sec
Lycrow Lycrow deathstalkers_mark 457157 7662672 25541 8.09 145543 292287 40.5 40.5 29.9% 0.0% 0.0% 0.0% 7.44sec 7662672 300.01sec
Lycrow Lycrow envenom 32645 46852536 156169 8.51 527931 1484675 42.5 42.5 59.9% 0.0% 0.0% 0.0% 7.04sec 46852536 300.01sec
Lycrow Lycrow poison_bomb 255546 6870235 22900 17.63 60061 120318 88.1 88.1 29.7% 0.0% 0.0% 0.0% 3.25sec 6870235 300.01sec
Lycrow Lycrow fatal_intent 461984 823616 2745 0.20 642805 1273524 1.0 1.0 28.6% 0.0% 0.0% 0.0% 0.00sec 823616 300.01sec
Lycrow Lycrow flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Lycrow Lycrow food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Lycrow Lycrow garrote ticks -703 18739400 62465 35.03 78575 174581 16.9 175.2 29.6% 0.0% 0.0% 0.0% 17.49sec 18739400 300.01sec
Lycrow Lycrow internal_bleeding ticks -381628 4831960 16107 15.03 49542 99184 0.0 75.2 29.7% 0.0% 0.0% 0.0% 0.00sec 4831960 300.01sec
Lycrow Lycrow kingsbane 385627 2183769 7279 1.03 296244 725984 5.1 5.1 30.0% 0.0% 0.0% 0.0% 63.46sec 20213176 300.01sec
Lycrow Lycrow kingsbane ticks -385627 18029407 60098 7.01 356463 875970 5.1 35.0 30.5% 0.0% 0.0% 0.0% 63.46sec 20213176 300.01sec
Lycrow Lycrow mutilate 1329 0 0 0.00 0 0 86.1 0.0 0.0% 0.0% 0.0% 0.0% 3.46sec 0 300.01sec
Lycrow Lycrow mutilate_mh 5374 7471355 24904 17.23 63897 140848 86.1 86.1 29.7% 0.0% 0.0% 0.0% 3.46sec 10673353 300.01sec
Lycrow Lycrow mutilate_oh 27576 3734682 12448 17.23 31948 70426 86.1 86.1 29.7% 0.0% 0.0% 0.0% 3.46sec 5335255 300.01sec
Lycrow Lycrow mutilate_mh_vicious_venoms 385806 8045352 26817 17.23 93404 0 0.0 86.1 0.0% 0.0% 0.0% 0.0% 0.00sec 8045352 300.01sec
Lycrow Lycrow mutilate_oh_vicious_venoms 385802 4022111 13407 17.23 46696 0 0.0 86.1 0.0% 0.0% 0.0% 0.0% 0.00sec 4022111 300.01sec
Lycrow Lycrow mutilated_flesh ticks -381672 2195585 7319 18.63 23572 0 0.0 93.1 0.0% 0.0% 0.0% 0.0% 0.00sec 2195585 300.01sec
Lycrow Lycrow potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 309.93sec 0 300.01sec
Lycrow Lycrow recuperator 426605 0 0 0.00 0 0 97.9 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 300.01sec
Lycrow Lycrow rupture ticks -1943 17221585 57405 35.31 75174 150816 9.6 176.5 29.6% 0.0% 0.0% 0.0% 31.49sec 17221585 300.01sec
Lycrow Lycrow serrated_bone_spike 385424 1246569 4155 1.92 92743 207767 19.2 9.6 32.5% 0.0% 0.0% 0.0% 14.89sec 5795112 300.01sec
Lycrow Lycrow serrated_bone_spike ticks -385424 4014300 13381 23.55 25054 55390 19.2 117.7 29.8% 0.0% 0.0% 0.0% 14.89sec 5795112 300.01sec
Lycrow Lycrow corrupt_the_blood ticks -457133 7651949 25506 0.00 31617 63236 186.8 0.0 29.6% 0.0% 0.0% 0.0% 1.61sec 7651949 300.01sec
Lycrow Lycrow shiv 5938 968543 3228 2.19 64741 142692 11.0 11.0 30.3% 0.0% 0.0% 0.0% 28.56sec 1383631 300.01sec
Lycrow Lycrow sikrans_endless_arsenal 447970 0 0 0.00 0 0 5.1 0.0 0.0% 0.0% 0.0% 0.0% 63.49sec 0 300.01sec
Lycrow Lycrow surekian_flourish ticks -445434 1978752 6596 1.01 300633 602292 1.7 5.1 29.9% 0.0% 0.0% 0.0% 190.48sec 1978752 300.01sec
Lycrow Lycrow surekian_decimation 448090 1689176 5630 0.34 752149 1505768 1.7 1.7 30.5% 0.0% 0.0% 0.0% 190.79sec 1689176 300.01sec
Lycrow Lycrow surekian_barrage 445475 1111427 3705 0.34 500876 1002352 1.7 1.7 30.4% 0.0% 0.0% 0.0% 190.35sec 1111427 300.01sec
Lycrow Lycrow stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Lycrow Lycrow suffocating_darkness ticks -449217 10891567 36305 22.01 98986 0 19.9 110.0 0.0% 0.0% 0.0% 0.0% 14.53sec 10891567 300.01sec
Lycrow Lycrow thistle_tea 381623 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 55.48sec 0 300.01sec
Lycrow Lycrow vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.04sec 0 300.01sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health828,079.10.00.00%0.0100.0%

Scale Factors for other metrics

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Amplifying Poison3.8327.473.0s0.9s77.5s98.83%99.91%5.1 (5.1)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_amplifying_poison
  • max_stacks:20
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 352.2s
  • trigger_min/max:0.0s / 17.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.9s
  • uptime_min/max:94.27% / 100.00%

Stack Uptimes

  • amplifying_poison_1:2.01%
  • amplifying_poison_2:2.73%
  • amplifying_poison_3:3.50%
  • amplifying_poison_4:4.29%
  • amplifying_poison_5:5.04%
  • amplifying_poison_6:5.77%
  • amplifying_poison_7:6.45%
  • amplifying_poison_8:7.02%
  • amplifying_poison_9:7.54%
  • amplifying_poison_10:8.34%
  • amplifying_poison_11:7.56%
  • amplifying_poison_12:6.91%
  • amplifying_poison_13:6.26%
  • amplifying_poison_14:5.60%
  • amplifying_poison_15:4.91%
  • amplifying_poison_16:4.23%
  • amplifying_poison_17:3.58%
  • amplifying_poison_18:2.97%
  • amplifying_poison_19:2.37%
  • amplifying_poison_20:1.77%

Spelldata

  • id:383414
  • name:Amplifying Poison
  • tooltip:Envenom consumes stacks to amplify its damage.
  • description:{$@spelldesc381664=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy, dealing {$383414s1=0} Nature damage and applying Amplifying Poison for {$383414d=12 seconds}. Envenom can consume {$s2=10} stacks of Amplifying Poison to deal {$s1=35}% increased damage. Max {$383414u=20} stacks.}
  • max_stacks:20
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Amplifying Poison (_deathmark)3.762.386.9s3.9s12.1s15.12%22.33%0.3 (0.3)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_amplifying_poison_deathmark
  • max_stacks:20
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 140.7s
  • trigger_min/max:0.0s / 125.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:11.15% / 18.30%

Stack Uptimes

  • amplifying_poison_deathmark_1:0.34%
  • amplifying_poison_deathmark_2:0.54%
  • amplifying_poison_deathmark_3:0.75%
  • amplifying_poison_deathmark_4:0.96%
  • amplifying_poison_deathmark_5:1.13%
  • amplifying_poison_deathmark_6:1.25%
  • amplifying_poison_deathmark_7:1.34%
  • amplifying_poison_deathmark_8:1.39%
  • amplifying_poison_deathmark_9:1.41%
  • amplifying_poison_deathmark_10:1.34%
  • amplifying_poison_deathmark_11:1.15%
  • amplifying_poison_deathmark_12:0.94%
  • amplifying_poison_deathmark_13:0.75%
  • amplifying_poison_deathmark_14:0.56%
  • amplifying_poison_deathmark_15:0.41%
  • amplifying_poison_deathmark_16:0.29%
  • amplifying_poison_deathmark_17:0.20%
  • amplifying_poison_deathmark_18:0.13%
  • amplifying_poison_deathmark_19:0.09%
  • amplifying_poison_deathmark_20:0.12%

Spelldata

  • id:394328
  • name:Amplifying Poison
  • tooltip:Envenom consumes stacks to amplify its damage.
  • description:{$@spelldesc381664=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy, dealing {$383414s1=0} Nature damage and applying Amplifying Poison for {$383414d=12 seconds}. Envenom can consume {$s2=10} stacks of Amplifying Poison to deal {$s1=35}% increased damage. Max {$383414u=20} stacks.}
  • max_stacks:20
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Atrophic Poison1.0329.8147.3s0.9s285.4s99.59%0.00%329.8 (329.8)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_atrophic_poison
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 332.5s
  • trigger_min/max:0.0s / 15.6s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 359.9s
  • uptime_min/max:96.95% / 100.00%

Stack Uptimes

  • atrophic_poison_1:99.59%

Spelldata

  • id:392388
  • name:Atrophic Poison
  • tooltip:Damage reduced by {$=}{{$=}W1*-1}.1%.
  • description:{$@spelldesc381637=Coats your weapons with a Non-Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy, reducing their damage by {$=}{{$392388s1=3}*-1}.1% for {$392388d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Corrupt the Blood1.0185.82.0s1.6s298.0s99.32%0.00%176.8 (176.8)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_corrupt_the_blood
  • max_stacks:10
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 2.0s
  • trigger_min/max:0.0s / 14.8s
  • trigger_pct:100.00%
  • duration_min/max:238.0s / 358.0s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • corrupt_the_blood_1:0.46%
  • corrupt_the_blood_2:0.45%
  • corrupt_the_blood_3:0.45%
  • corrupt_the_blood_4:0.45%
  • corrupt_the_blood_5:0.45%
  • corrupt_the_blood_6:0.45%
  • corrupt_the_blood_7:0.45%
  • corrupt_the_blood_8:0.45%
  • corrupt_the_blood_9:0.45%
  • corrupt_the_blood_10:95.27%

Spelldata

  • id:457133
  • name:Corrupt the Blood
  • tooltip:{$@=}auracaster's Rupture corrupts your blood, dealing {$s2=0} Plague damage.
  • description:{$@spelldesc457066=Rupture deals an additional {$457133s2=0} Plague damage each time it deals damage, stacking up to {$457133u=10} times. Rupture duration increased by {$=}{{$s1=3000}/1000} sec.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deathmark2.90.0123.5s123.6s15.6s15.24%0.00%0.0 (0.0)2.8

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_deathmark
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:6.0s / 140.8s
  • trigger_min/max:120.0s / 140.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:12.20% / 18.30%

Stack Uptimes

  • deathmark_1:15.24%

Spelldata

  • id:394331
  • name:Deathmark
  • tooltip:
  • description:{$@spelldesc360194=Carve a deathmark into an enemy, dealing {$=}o1 Bleed damage over {$d=16 seconds}. While marked your Garrote, Rupture, and Lethal poisons applied to the target are duplicated, dealing {$?a134735=false}[{$=}{100+{$394331s1=0}+{$394331s3=50}}%][{$=}{100+{$394331s1=0}}%] of normal damage.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:0.00%
Deathstalker's Mark14.00.022.3s23.0s16.9s78.78%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_deathstalkers_mark
  • max_stacks:3
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 45.7s
  • trigger_min/max:9.0s / 45.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.2s
  • uptime_min/max:70.97% / 85.22%

Stack Uptimes

  • deathstalkers_mark_1:26.99%
  • deathstalkers_mark_2:25.28%
  • deathstalkers_mark_3:26.51%

Spelldata

  • id:457129
  • name:Deathstalker's Mark
  • tooltip:Marked by {$@=}auracaster, suffering additional Plague damage from their abilities.
  • description:{$@spelldesc457052={$?=}c1[Ambush][Shadowstrike] from Stealth{$?=}c3[ or Shadow Dance][] applies {$s1=3} stacks of Deathstalker's Mark to your target. When you spend {$s2=5} or more combo points on attacks against a Marked target you consume an application of Deathstalker's Mark, dealing {$457157s1=0} Plague damage and increasing the damage of your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] by {$457160s1=50}%. You may only have one target Marked at a time.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Fatal Intent1.030.45.4s7.6s241.1s80.38%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_fatal_intent
  • max_stacks:999
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 14.1s
  • trigger_min/max:1.0s / 55.4s
  • trigger_pct:100.00%
  • duration_min/max:174.5s / 317.3s
  • uptime_min/max:70.43% / 92.78%

Stack Uptimes

  • fatal_intent_1:1.71%
  • fatal_intent_2:1.74%
  • fatal_intent_3:1.66%
  • fatal_intent_4:1.62%
  • fatal_intent_5:1.71%
  • fatal_intent_6:1.89%
  • fatal_intent_7:2.22%
  • fatal_intent_8:2.58%
  • fatal_intent_9:2.75%
  • fatal_intent_10:2.93%
  • fatal_intent_11:2.96%
  • fatal_intent_12:2.96%
  • fatal_intent_13:2.99%
  • fatal_intent_14:2.97%
  • fatal_intent_15:3.00%
  • fatal_intent_16:2.90%
  • fatal_intent_17:2.87%
  • fatal_intent_18:2.82%
  • fatal_intent_19:2.79%
  • fatal_intent_20:2.82%
  • fatal_intent_21:2.83%
  • fatal_intent_22:2.81%
  • fatal_intent_23:2.82%
  • fatal_intent_24:2.71%
  • fatal_intent_25:2.63%
  • fatal_intent_26:2.45%
  • fatal_intent_27:2.25%
  • fatal_intent_28:2.08%
  • fatal_intent_29:1.85%
  • fatal_intent_30:1.65%
  • fatal_intent_31:1.37%
  • fatal_intent_32:1.15%
  • fatal_intent_33:0.96%
  • fatal_intent_34:0.79%
  • fatal_intent_35:0.62%
  • fatal_intent_36:0.47%
  • fatal_intent_37:0.38%
  • fatal_intent_38:0.25%
  • fatal_intent_39:0.19%
  • fatal_intent_40:0.14%
  • fatal_intent_41:0.10%
  • fatal_intent_42:0.08%
  • fatal_intent_43:0.06%
  • fatal_intent_44:0.05%
  • fatal_intent_45:0.03%
  • fatal_intent_46:0.04%
  • fatal_intent_47:0.03%
  • fatal_intent_48:0.08%
  • fatal_intent_49:0.04%
  • fatal_intent_50:0.02%
  • fatal_intent_51:0.02%
  • fatal_intent_52:0.03%
  • fatal_intent_53:0.01%
  • fatal_intent_54:0.01%
  • fatal_intent_55:0.02%

Spelldata

  • id:461981
  • name:Fatal Intent
  • tooltip:Falling below {$461980=}M~3% health will cause Fatal Intent to inflict {$=}{{$461984s1=0}*(1+{$@=}versadmg)} Plague damage.
  • description:{$@spelldesc461980=Your damaging abilities against enemies above {$=}M3% health have a very high chance to apply Fatal Intent. When an enemy falls below {$=}M3% health, Fatal Intent inflicts {$=}{{$461984s1=0}*(1+{$@=}versadmg)} Plague damage per stack.}
  • max_stacks:999
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Shiv10.70.229.1s28.6s8.0s28.53%27.74%0.2 (0.2)10.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_shiv
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:5.0s / 116.4s
  • trigger_min/max:1.0s / 116.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.9s
  • uptime_min/max:22.88% / 30.77%

Stack Uptimes

  • shiv_1:28.53%

Spelldata

  • id:319504
  • name:Shiv
  • tooltip:{$=}w1% increased Nature {$?a400783=true}[and Bleed ][]damage taken from {$@=}auracaster.{$?=}{$=}{{$=}W2<0}[ Healing received reduced by {$=}w2%.][]
  • description:{$@spelldesc245388=Stab your enemy with a toxic poisoned blade, dealing {$s2=0} Nature damage. Your Nature damage done against the target is increased by {$245389s1=30}% for {$245389d=9 seconds}. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 300.01
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 842227.73
Minimum 728217.46
Maximum 948443.19
Spread ( max - min ) 220225.73
Range [ ( max - min ) / 2 * 100% ] 13.07%
Standard Deviation 29949.8967
5th Percentile 793791.72
95th Percentile 892095.08
( 95th Percentile - 5th Percentile ) 98303.36
Mean Distribution
Standard Deviation 299.5139
95.00% Confidence Interval ( 841640.69 - 842814.76 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4858
0.1 Scale Factor Error with Delta=300 7657277
0.05 Scale Factor Error with Delta=300 30629106
0.01 Scale Factor Error with Delta=300 765727643
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health03077838200
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.