SimulationCraft 1120-01      berechnet von Metaux@Antonidas

for World of Warcraft 11.2.0.62801 Live (hotfix 2025-08-27/62801, git build 62ef600643)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Balance Druid aura does not increase Regrowth cost
Balance Druid (effect#6) base_value 0.00 47.00

Evoker

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-06-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 30.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Monk

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-08-03 Manually revert TWW3-SPM-4p hotfixes (effect#2).
Monk Shado-Pan 11.2 Class Set 4pc (effect#2) base_value 120.00 150.00
2025-08-03 Manually revert TWW3-SPM-4p hotfixes (effect#1).
Monk Shado-Pan 11.2 Class Set 4pc (effect#1) base_value 100.00 50.00
2025-08-03 Manually revert TWW3-SPM-2p hotfixes (effect#3).
Monk Shado-Pan 11.2 Class Set 2pc (effect#3) base_value 100.00 70.00

Rogue

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-07-29 Fatebound Lucky Coin Expiry
Fateful Ending (effect#2) base_value 15.00 10.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Lycrow : 765,449 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
765,448.5765,448.5557.4 / 0.073%110,905.8 / 14.5%28,003.9
Resource Out In Waiting APM Active
Energy27.326.617.86%43.1100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/lycrow
TalentCMQAA0tw2gAD7pPTLoW5IGZDeMjZmhxMYAAAAAAYWGsMDAAAAAAttNzMmZmBzMz2sNGjZYGzMzMmZz2YGgtZWGLMmxs0Y2WGmsNMsA
Scale Factors for Lycrow Damage Per Second
Wdps Agi Mastery Haste Crit Vers
Scale Factors 90.04 16.88 12.13 11.15 9.88 8.31
Normalized 5.34 1.00 0.72 0.66 0.59 0.49
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.39 0.35 0.35 0.34 0.35 0.35
Ranking
  • Wdps > Agi > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, Agility=16.88, CritRating=9.88, HasteRating=11.15, MasteryRating=12.13, Versatility=8.31, Dps=90.04 )

Scale Factors for other metrics

Scale Factors for Lycrow Priority Target Damage Per Second
Wdps Agi Mastery Haste Crit Vers
Scale Factors 90.04 16.88 12.13 11.15 9.88 8.31
Normalized 5.34 1.00 0.72 0.66 0.59 0.49
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.39 0.35 0.35 0.34 0.35 0.35
Ranking
  • Wdps > Agi > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, Agility=16.88, CritRating=9.88, HasteRating=11.15, MasteryRating=12.13, Versatility=8.31, Dps=90.04 )
Scale Factors for Lycrow Damage Per Second (Effective)
Wdps Agi Mastery Haste Crit Vers
Scale Factors 90.04 16.88 12.13 11.15 9.88 8.31
Normalized 5.34 1.00 0.72 0.66 0.59 0.49
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Agi > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, Agility=16.88, CritRating=9.88, HasteRating=11.15, MasteryRating=12.13, Versatility=8.31, Dps=90.04 )
Scale Factors for Lycrow Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, )
Scale Factors for Lycrow Fight Length
Agi Crit Wdps Haste Vers Mastery
Scale Factors 0.00 0.00 0.00 0.00 0.00 -0.00
Normalized 1.00 1.00 0.50 0.01 0.00 -1.01
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Agi > Crit > Wdps > Haste > Vers > Mastery
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, Agility=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=-0.00, Versatility=0.00, Dps=0.00 )
Scale Factors for Raid Damage Per Second
Wdps Agi Mastery Haste Crit Vers
Scale Factors 90.04 16.88 12.13 11.15 9.88 8.31
Normalized 5.34 1.00 0.72 0.66 0.59 0.49
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.39 0.35 0.35 0.34 0.35 0.35
Ranking
  • Wdps > Agi > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Lycrow-Assassination": Class=Rogue, Spec=Assassination, Agility=16.88, CritRating=9.88, HasteRating=11.15, MasteryRating=12.13, Versatility=8.31, Dps=90.04 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Lycrow765,449
Ambush 20,644 (50,346)2.7% (6.6%)22.413.40s674,494671,494Direct22.4 (44.8)216,448476,102276,43923.1% (11.6%)0.0%

Stats Details: Ambush

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.4022.400.000.000.001.00450.00006,191,242.968,844,623.9630.00%671,493.88671,493.88
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit76.90%17.22340216,448.17149,245342,509216,127.53176,941268,2113,727,7245,325,31530.00%
crit23.10%5.17016476,102.25328,340753,521472,739.530733,1232,463,5193,519,30929.81%

Action Details: Ambush

  • id:8676
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:60
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing {$s1=0} Physical damage.{$?s383281=false}[ Has a {$193315s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;{$?s383281=false}[ each time it strikes][].|r

Action Priority List

    direct
    [P]:20.96
  • if_expr:variable.use_filler&(buff.blindside.up|stealthed.rogue)&(!dot.kingsbane.ticking|debuff.deathmark.down|buff.blindside.up)
    stealthed
    [X]:1.44
  • if_expr:!debuff.deathstalkers_mark.up&hero_tree.deathstalker&combo_points<variable.effective_spend_cp&(dot.rupture.ticking|variable.single_target|!talent.subterfuge)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Direct AmountAssassination Rogue13703726PCT50.0%
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Resource CostVicious Venoms3816342ADD10.000
    Ambush (_vicious_venoms) 29,7023.9%0.00.00s00Direct22.4398,0560398,0560.0%0.0%

Stats Details: Ambush Vicious Venoms

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0022.400.000.000.000.00000.00008,914,683.318,914,683.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%22.40645398,056.44160,1231,548,468396,971.75248,660675,3158,914,6838,914,6830.00%

Action Details: Ambush Vicious Venoms

  • id:385794
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:237215.91
  • base_dd_max:237215.91
  • base_dd_mult:1.20
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385794
  • name:Ambush
  • school:nature
  • tooltip:
  • description:{$@spelldesc381634=Ambush and Mutilate cost {$s2=5} more Energy and deal {$s1=35}% additional damage as Nature.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Amplifying Poison 18,7402.4%0.00.00s00Direct311.214,73629,56318,06222.4%0.0%

Stats Details: Amplifying Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00311.230.000.000.000.00000.00005,621,390.105,621,390.100.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.56%241.4015633714,735.718,95230,30414,728.1813,55215,8163,557,0433,557,0430.00%
crit22.44%69.833111429,562.7917,90559,58229,551.3625,66232,8852,064,3472,064,3470.00%

Action Details: Amplifying Poison

  • id:383414
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383414
  • name:Amplifying Poison
  • school:nature
  • tooltip:Envenom consumes stacks to amplify its damage.
  • description:{$@spelldesc381664=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy, dealing {$383414s1=0} Nature damage and applying Amplifying Poison for {$383414d=12 seconds}. Envenom can consume {$s2=10} stacks of Amplifying Poison to deal {$s1=35}% increased damage. Max {$383414u=20} stacks.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Auto Attack 0 (82,455)0.0% (10.8%)3.9121.03s6,393,5910

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.870.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 22,8573.0%323.61.08s21,18719,782Direct323.619,98140,02621,18722.3%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage323.57323.570.000.000.001.07100.00006,855,485.669,793,541.1530.00%19,781.9319,781.93
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.31%198.3712627119,980.5317,18724,10419,978.6819,50720,5193,963,5195,662,16530.00%
crit22.33%72.253811140,025.9934,37448,20740,027.2138,85041,5712,891,9664,131,37630.00%
miss16.36%52.9528880.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 11,4031.5%322.61.08s10,6019,886Direct322.69,99320,02110,60122.4%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage322.62322.620.000.000.001.07240.00003,420,123.504,885,885.8330.00%9,885.729,885.72
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.23%197.541292699,992.648,59312,0529,991.839,73010,2511,973,9832,819,97330.00%
crit22.39%72.233711620,021.4017,18724,10420,021.6619,35520,8261,446,1402,065,91330.00%
miss16.38%52.8525920.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Hunt Them Down 48,1946.3%419.80.87s34,4420Direct419.828,11756,41234,44322.4%0.0%

Stats Details: Hunt Them Down

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage419.81419.810.000.000.000.00000.000014,459,193.9914,459,193.990.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.64%325.9522644628,117.0821,64151,14928,109.7426,25929,9449,164,5309,164,5300.00%
crit22.36%93.865115456,411.6243,283101,98356,410.2050,60962,1465,294,6645,294,6640.00%

Action Details: Hunt Them Down

  • id:457193
  • school:shadowstorm
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:457193
  • name:Hunt Them Down
  • school:shadowstorm
  • tooltip:
  • description:{$@spelldesc457054=Auto-attacks against Marked targets deal an additional {$457193s1=0} Plague damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Deadly Poison (_driver) 0 (32,306)0.0% (4.2%)0.00.00s00

Stats Details: Deadly Poison Driver

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Deadly Poison Driver

  • id:2823
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2823
  • name:Deadly Poison
  • school:physical
  • tooltip:Each strike has a chance of causing the target to suffer Nature damage every {$2818t1=2} sec for {$2818d=12 seconds}. Subsequent poison applications deal instant Nature damage.
  • description:Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy for {$=}{{$2818m1=0}*{$2818d=12 seconds}/{$2818t1=2}} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Periodic AmountVirulent Poisons3815432PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Spell Periodic AmountFatal Concoction3923842PCT10.0%
    Deadly Poison (_instant) 18,7042.4%0.00.00s00Direct310.314,75429,59618,08322.4%0.0%

Stats Details: Deadly Poison Instant

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00310.320.000.000.000.00000.00005,611,268.845,611,268.840.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.57%240.7115833714,753.879,13229,79114,746.5613,52615,8643,551,3423,551,3420.00%
crit22.43%69.603211329,595.5618,26360,60929,582.9926,09133,3872,059,9272,059,9270.00%

Action Details: Deadly Poison Instant

  • id:113780
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Periodic AmountVirulent Poisons3815432PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Spell Periodic AmountFatal Concoction3923842PCT10.0%
    Deadly Poison (_dot) 13,6031.8%0.00.00s00Periodic166.719,98640,12924,48422.3%0.0%99.3%

Stats Details: Deadly Poison Dot

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.00166.71166.71310.320.00001.78694,081,619.054,081,619.050.00%13,701.670.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit77.67%129.488917219,986.1413,01041,62719,977.7618,69621,3822,587,7602,587,7600.00%
crit22.33%37.23166140,128.7223,44282,00140,113.7533,36446,5281,493,8591,493,8590.00%

Action Details: Deadly Poison Dot

  • id:2818
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.113740
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.45
  • base_multiplier:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=2} seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy for {$=}{{$2818m1=0}*{$2818d=12 seconds}/{$2818t1=2}} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Periodic AmountVirulent Poisons3815432PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Spell Periodic AmountFatal Concoction3923842PCT10.0%
Deathmark 8,446 (49,270)1.1% (6.4%)2.9122.91s5,064,9845,043,135Periodic28.7 (231.5)71,549142,98888,18423.3% (23.3%)0.0%

Stats Details: Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.910.0028.6628.660.001.00451.58382,526,784.092,526,784.090.00%305,154.225,043,135.46
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit76.72%21.98103171,549.3846104,68771,393.2757,64380,8391,573,0191,573,0190.00%
crit23.28%6.67017142,988.27502209,374142,648.390198,233953,765953,7650.00%

Action Details: Deathmark

  • id:360194
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.20
  • base_multiplier:1.00
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:360194
  • name:Deathmark
  • school:physical
  • tooltip:Bleeding for {$=}w damage every $t sec. Duplicating {$@=}auracaster's Garrote, Rupture, and Lethal poisons applied.
  • description:Carve a deathmark into an enemy, dealing {$=}o1 Bleed damage over {$d=16 seconds}. While marked your Garrote, Rupture, and Lethal poisons applied to the target are duplicated, dealing {$?a134735=false}[{$=}{100+{$394331s1=0}+{$394331s3=50}}%][{$=}{100+{$394331s1=0}}%] of normal damage.

Action Priority List

    cds
    [E]:2.91
  • if_expr:(variable.deathmark_condition&target.time_to_die>=10)|fight_remains<=20

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
    Garrote (_deathmark) 16,3612.1%0.00.00s00Periodic26.8142,385314,920182,50023.3%0.0%14.9%

Stats Details: Garrote Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.0026.8326.832.670.00001.66974,896,881.824,896,881.820.00%109,307.840.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit76.74%20.59929142,384.93121211,826142,124.68113,035165,9992,931,8242,931,8240.00%
crit23.26%6.24017314,920.40121466,018314,532.380457,2751,965,0581,965,0580.00%

Action Details: Garrote Deathmark

  • id:360830
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.391000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.65
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:360830
  • name:Garrote
  • school:physical
  • tooltip:Suffering {$=}w1 damage every {$t1=2} seconds.
  • description:{$@spelldesc360194=Carve a deathmark into an enemy, dealing {$=}o1 Bleed damage over {$d=16 seconds}. While marked your Garrote, Rupture, and Lethal poisons applied to the target are duplicated, dealing {$?a134735=false}[{$=}{100+{$394331s1=0}+{$394331s3=50}}%][{$=}{100+{$394331s1=0}}%] of normal damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Periodic AmountBloody Mess3816261PCT15.0%
Spell Periodic AmountShrouded Suffocation3854781PCT20.0%
    Rupture (_deathmark) 12,4211.6%0.00.00s00Periodic27.0111,808223,414137,70023.2%0.0%15.0%

Stats Details: Rupture Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.0026.9726.970.600.00001.66583,714,315.223,714,315.220.00%82,665.250.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit76.80%20.72629111,808.4559156,357111,583.9393,400125,1832,316,2212,316,2210.00%
crit23.20%6.26015223,413.77363312,714222,822.960298,1791,398,0941,398,0940.00%

Action Details: Rupture Deathmark

  • id:360826
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.336574
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:2.13
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:360826
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:{$@spelldesc360194=Carve a deathmark into an enemy, dealing {$=}o1 Bleed damage over {$d=16 seconds}. While marked your Garrote, Rupture, and Lethal poisons applied to the target are duplicated, dealing {$?a134735=false}[{$=}{100+{$394331s1=0}+{$394331s3=50}}%][{$=}{100+{$394331s1=0}}%] of normal damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Periodic AmountAssassination Rogue13703725PCT40.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountBloody Mess3816261PCT15.0%
Spell Periodic AmountSanguine Stratagem4575125PCT5.0%
    Amplifying Poison (_deathmark) 4,6000.6%0.00.00s00Direct60.918,33636,60622,61123.4%0.0%

Stats Details: Amplifying Poison Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0060.880.000.000.000.00000.00001,376,471.821,376,471.820.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit76.61%46.64167418,336.0810,06125,28718,291.4615,06520,636855,126855,1260.00%
crit23.39%14.2423036,606.2620,23850,57336,562.8329,49643,227521,346521,3460.00%

Action Details: Amplifying Poison Deathmark

  • id:394328
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394328
  • name:Amplifying Poison
  • school:nature
  • tooltip:Envenom consumes stacks to amplify its damage.
  • description:{$@spelldesc381664=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy, dealing {$383414s1=0} Nature damage and applying Amplifying Poison for {$383414d=12 seconds}. Envenom can consume {$s2=10} stacks of Amplifying Poison to deal {$s1=35}% increased damage. Max {$383414u=20} stacks.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
    Deadly Poison (_dot_deathmark) 2,8480.4%0.00.00s00Periodic27.225,34750,72231,27423.4%0.0%15.2%

Stats Details: Deadly Poison Dot Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.0027.2327.2360.880.00001.6723851,686.66851,686.660.00%18,700.300.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit76.65%20.8783025,346.9214,10335,33325,298.8421,16327,970529,078529,0780.00%
crit23.35%6.3601550,721.9328,59370,66650,621.57068,543322,608322,6080.00%

Action Details: Deadly Poison Dot Deathmark

  • id:394324
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.113740
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.45
  • base_multiplier:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:394324
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=2} seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy for {$=}{{$2818m1=0}*{$2818d=12 seconds}/{$2818t1=2}} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Periodic AmountVirulent Poisons3815432PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Spell Periodic AmountFatal Concoction3923842PCT10.0%
    Deadly Poison (_instant_deathmark) 4,5940.6%0.00.00s00Direct60.918,33536,60022,58523.3%0.0%

Stats Details: Deadly Poison Instant Deathmark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0060.880.000.000.000.00000.00001,374,945.351,374,945.350.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit76.73%46.71197618,334.8610,06125,28718,293.2615,43420,336856,474856,4740.00%
crit23.27%14.1713436,600.2520,12250,57336,544.9127,12543,668518,471518,4710.00%

Action Details: Deadly Poison Instant Deathmark

  • id:394325
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394325
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Direct AmountVirulent Poisons3815431PCT10.0%
Spell Periodic AmountVirulent Poisons3815432PCT10.0%
Spell Direct AmountFatal Concoction3923841PCT10.0%
Spell Periodic AmountFatal Concoction3923842PCT10.0%
Deathstalker's Mark 22,4992.9%38.87.73s173,8030Direct38.8141,649284,161173,80722.6%0.0%

Stats Details: Deathstalkers Mark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage38.8038.800.000.000.000.00000.00006,744,009.236,744,009.230.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.44%30.051746141,649.20103,878240,687141,609.68123,105155,6444,255,9774,255,9770.00%
crit22.56%8.76121284,160.90207,756481,373284,316.21208,088399,8382,488,0322,488,0320.00%

Action Details: Deathstalkers Mark

  • id:457157
  • school:shadowstorm
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:457157
  • name:Deathstalker's Mark
  • school:shadowstorm
  • tooltip:
  • description:{$@spelldesc457052={$?=}c1[Ambush][Shadowstrike] from Stealth{$?=}c3[ or Shadow Dance][] applies {$s1=3} stacks of Deathstalker's Mark to your target. When you spend {$s2=5} or more combo points on attacks against a Marked target you consume an application of Deathstalker's Mark, dealing {$457157s1=0} Plague damage and increasing the damage of your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] by {$457160s1=50}%. You may only have one target Marked at a time.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Envenom 141,987 (162,425)18.5% (21.2%)41.77.15s1,169,1761,163,947Direct41.7 (126.9)528,0551,558,3261,022,04547.9% (30.9%)0.0%

Stats Details: Envenom

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage41.6641.660.000.000.001.00450.000042,575,638.3842,575,638.380.00%1,163,947.031,163,947.03
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit52.05%21.681034528,054.77198,5111,290,925527,858.35407,078677,00111,450,06011,450,0600.00%
crit47.95%19.979331,558,326.06397,0224,130,9601,564,620.841,211,0872,011,45731,125,57831,125,5780.00%

Action Details: Envenom

  • id:32645
  • school:nature
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.{$?a455072=true}[ Envenom damage increased by {$s3=0}%.][]{$?s340081=false}[ Poison critical strikes generate {$340426s1=1} Energy.][]{$?a393724=false}[ Poison damage increased by {$=}w7%][]
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : {$=}{{$m1=0}*1} damage, 1 sec 2 points: {$=}{{$m1=0}*2} damage, 2 sec 3 points: {$=}{{$m1=0}*3} damage, 3 sec 4 points: {$=}{{$m1=0}*4} damage, 4 sec 5 points: {$=}{{$m1=0}*5} damage, 5 sec{$?s193531=true}|((s457512)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage, 6 sec ][]{$?s193531=true}&s457512[ 7 points: {$=}{{$m1=0}*7} damage, 7 sec][]{$?a381669=false}[ Up to 2 Envenom applications can overlap.][]

Action Priority List

    direct
    [M]:27.81
  • if_expr:!buff.darkest_night.up&combo_points>=variable.effective_spend_cp&(variable.not_pooling|debuff.amplifying_poison.stack>=20|!variable.single_target)
    direct
    [N]:11.23
  • if_expr:buff.darkest_night.up&effective_combo_points>=cp_max_spend
    stealthed
    [Z]:2.62
  • if_expr:effective_combo_points>=variable.effective_spend_cp&dot.kingsbane.ticking&buff.envenom.remains<=3&(debuff.deathstalkers_mark.up|buff.cold_blood.up|buff.darkest_night.up&combo_points=7)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountSanguine Stratagem4575124PCT5.0%
    Poison Bomb 20,4382.7%85.23.33s71,9490Direct85.258,686117,51771,95122.5%0.0%

Stats Details: Poison Bomb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage85.2185.210.000.000.000.00000.00006,130,888.916,130,888.910.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.46%66.001811258,686.2636,501117,94258,647.7347,23169,6183,873,2713,873,2710.00%
crit22.54%19.21243117,516.5673,002232,336117,506.6382,760148,0482,257,6182,257,6180.00%

Action Details: Poison Bomb

  • id:255546
  • school:nature
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:255546
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc255544=Envenom has a {$=}<chance>% chance per combo point spent to smash a vial of poison at the target's location, creating a pool of acidic death that deals {$=}{{$255546s1=0}*{$s2=4}} Nature damage over {$255545d=2 seconds} to all enemies within it.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Fan of Knives 1,013 (4,233)0.1% (0.6%)5.748.36s220,809219,825Direct5.7 (11.5)40,67091,23352,87824.1% (23.6%)0.0%

Stats Details: Fan Of Knives

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.755.740.000.000.001.00450.0000303,769.11433,955.4330.00%219,824.64219,824.64
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit75.85%4.360840,670.3238,30645,29140,643.57044,253177,219253,17029.98%
crit24.15%1.390691,232.9184,274114,34969,918.630105,853126,550180,78523.12%

Action Details: Fan Of Knives

  • id:51723
  • school:physical
  • range:0.0
  • travel_speed:35.0000
  • radius:10.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Spelldata

  • id:51723
  • name:Fan of Knives
  • school:physical
  • tooltip:
  • description:Sprays knives at all enemies within {$=}A1 yards, dealing {$s1=0} Physical damage and applying your active poisons at their normal rate. Deals reduced damage beyond {$s3=5} targets. |cFFFFFFFFAwards {$s2=1} combo {$=}lpoint:points;.|r

Action Priority List

    direct
    [O]:5.75
  • if_expr:buff.clear_the_witnesses.up&(spell_targets.fan_of_knives>=2-(buff.lingering_darkness.up|!talent.vicious_venoms))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
    Clear the Witnesses 3,2200.4%5.748.36s167,9540Direct5.7136,655272,019167,94623.1%0.0%

Stats Details: Clear The Witnesses

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.755.750.000.000.000.00000.0000965,278.55965,278.550.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit76.88%4.4208136,654.55112,535203,966136,687.430191,249603,836603,8360.00%
crit23.12%1.3306272,018.50225,069409,195209,449.270391,250361,442361,4420.00%

Action Details: Clear The Witnesses

  • id:457179
  • school:shadowstorm
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:457179
  • name:Clear the Witnesses
  • school:shadowstorm
  • tooltip:
  • description:{$@spelldesc457053=Your next {$?=}c1[Fan of Knives][Shuriken Storm] after applying Deathstalker's Mark deals an additional {$457179s1=0} Plague damage and generates {$457178s1=1} additional combo point.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Fatal Intent 2,5910.3%1.00.00s784,1110Direct1.0647,6521,282,857783,65421.4%0.0%

Stats Details: Fatal Intent

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.001.000.000.000.000.00000.0000784,111.02784,111.020.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit78.56%0.7901647,651.98292,1171,480,269509,057.8001,480,269509,058509,0580.00%
crit21.44%0.21011,282,856.81595,5222,669,432275,053.2202,669,432275,053275,0530.00%

Action Details: Fatal Intent

  • id:461984
  • school:shadowstorm
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461984
  • name:Fatal Intent
  • school:shadowstorm
  • tooltip:
  • description:{$@spelldesc461980=Your damaging abilities against enemies above {$=}M3% health have a very high chance to apply Fatal Intent. When an enemy falls below {$=}M3% health, Fatal Intent inflicts {$=}{{$461984s1=0}*(1+{$@=}versadmg)} Plague damage per stack.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Garrote 59,7547.8%16.917.39s1,059,5281,054,812Periodic164.985,316189,810108,67122.3%0.0%97.2%

Stats Details: Garrote

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.910.00164.89164.8913.181.00451.768917,918,092.4217,918,092.420.00%58,051.041,054,812.06
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit77.65%128.048517285,316.4931211,82685,317.0777,81494,20310,923,54410,923,5440.00%
crit22.35%36.851664189,810.37178466,018189,922.87147,198238,7286,994,5486,994,5480.00%

Action Details: Garrote

  • id:703
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.391000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.65
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering {$=}w1 damage every {$t1=2} seconds.
  • description:Garrote the enemy, causing {$=}o1 Bleed damage over {$d=18 seconds}.{$?a196861=false}[ Silences the target for {$1330d=5 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    core_dot
    [K]:13.06
  • if_expr:combo_points.deficit>=1&(pmultiplier<=1)&refreshable&target.time_to_die-remains>12
    stealthed
    [a]:3.85
  • if_expr:stealthed.improved_garrote&(pmultiplier<=1|refreshable)&combo_points.deficit>=1+2*talent.shrouded_suffocation

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Periodic AmountBloody Mess3816261PCT15.0%
Spell Periodic AmountShrouded Suffocation3854781PCT20.0%
Internal Bleeding 13,4001.8%0.00.00s00Periodic73.344,75289,62654,86922.5%0.0%19.8%

Stats Details: Internal Bleeding

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.0073.2873.280.730.00000.80914,021,228.714,021,228.710.00%67,815.040.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit77.45%56.76368144,751.8077109,80144,723.9434,90058,6822,540,1802,540,1800.00%
crit22.55%16.5243689,626.48174218,90289,595.8060,865137,4811,481,0491,481,0490.00%

Action Details: Internal Bleeding

  • id:381628
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.054362
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.32
  • base_multiplier:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:381628
  • name:Internal Bleeding
  • school:physical
  • tooltip:Suffering {$=}w1 damage every {$t1=1} sec.
  • description:{$@spelldesc154904=Kidney Shot also deals up to {$?s193531=true}[{$=}{6*{$154953=}o1}][{$=}{5*{$154953=}o1}] Bleed damage over {$154953d=6 seconds}, based on combo points spent.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountSanguine Stratagem4575125PCT5.0%
Kingsbane 59,6197.8%5.263.06s3,464,1623,449,283Direct5.2219,852633,022448,96855.5%0.0%
Periodic35.3342,174741,065441,80225.0%0.0%23.5%

Stats Details: Kingsbane

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.175.1735.2635.260.001.00452.000017,894,880.3017,894,880.300.00%236,370.223,449,283.02
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit44.55%2.3005219,851.73165,078430,160212,854.370423,657505,979505,9790.00%
crit55.45%2.8616633,022.36363,172945,549639,828.93466,174827,5831,813,1411,813,1410.00%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit75.02%26.451039342,173.8030,505981,492342,013.00204,696467,7919,050,7369,050,7360.00%
crit24.98%8.81019741,065.3767,5942,122,685741,046.2601,553,2086,525,0246,525,0240.00%

Action Details: Kingsbane

  • id:385627
  • school:nature
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.290000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.20
  • base_multiplier:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:385627
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering {$=}w4 Nature damage every {$t4=2} sec.
  • description:Release a lethal poison from your weapons and inject it into your target, dealing {$s2=0} Nature damage instantly and an additional {$=}o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$394095s1=20}%, up to {$=}{{$394095s1=20}*{$394095u=50}}%. |cFFFFFFFFAwards {$s6=1} combo {$=}lpoint:points;.|r

Action Priority List

    cds
    [F]:5.17
  • if_expr:(debuff.shiv.up|cooldown.shiv.remains<6)&(buff.envenom.up|spell_targets.fan_of_knives>1)&(cooldown.deathmark.remains>=50-15*(set_bonus.tww3_fatebound_4pc)|dot.deathmark.ticking)|fight_remains<=15

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Mutilate 0 (110,505)0.0% (14.4%)82.83.60s400,196398,408

Stats Details: Mutilate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage82.760.000.000.000.001.00450.00000.000.000.00%398,407.62398,407.62

Action Details: Mutilate

  • id:1329
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:60
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of {$=}<dmg> Physical damage. |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;.|r

Action Priority List

    direct
    [Q]:82.76
  • if_expr:variable.use_filler

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Spell Resource CostVicious Venoms3816342ADD10.000
    Mutilate (_mh) 30,6534.0%82.83.60s110,9950Direct82.887,280192,606110,99722.5%0.0%

Stats Details: Mutilate Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage82.7682.760.000.000.000.00000.00009,186,224.7613,123,165.1130.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.48%64.13368887,279.6657,211131,29587,286.8681,82493,6105,596,8947,995,55530.00%
crit22.52%18.64535192,605.91125,864288,850192,606.92159,046236,1193,589,3315,127,61030.00%

Action Details: Mutilate Mh

  • id:5374
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for {$s2=0} Physical damage. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
    Mutilate (_oh) 15,3252.0%82.83.60s55,4890Direct82.843,64596,26455,49022.5%0.0%

Stats Details: Mutilate Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage82.7682.760.000.000.000.00000.00004,592,443.996,560,627.7130.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.49%64.13408743,645.0128,60565,64843,648.9040,50746,6262,799,0043,998,57330.00%
crit22.51%18.6353796,263.8262,932144,42596,261.3478,729121,8221,793,4402,562,05430.00%

Action Details: Mutilate Oh

  • id:27576
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:27576
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for {$s2=0} Physical damage. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
    Mutilate (_mh_vicious_venoms) 37,0094.8%0.00.00s00Direct82.8134,0490134,0490.0%0.0%

Stats Details: Mutilate Mh Vicious Venoms

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0082.760.000.000.000.00000.000011,094,221.2511,094,221.250.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%82.7662102134,049.4771,511450,961134,018.39110,060164,63011,094,22111,094,2210.00%

Action Details: Mutilate Mh Vicious Venoms

  • id:385806
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90932.76
  • base_dd_max:90932.76
  • base_dd_mult:1.20
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385806
  • name:Mutilate
  • school:nature
  • tooltip:
  • description:{$@spelldesc381634=Ambush and Mutilate cost {$s2=5} more Energy and deal {$s1=35}% additional damage as Nature.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
    Mutilate (_oh_vicious_venoms) 18,5022.4%0.00.00s00Direct82.867,013067,0130.0%0.0%

Stats Details: Mutilate Oh Vicious Venoms

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0082.760.000.000.000.00000.00005,546,106.665,546,106.660.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%82.766210267,012.7235,756225,48266,999.9955,78980,0215,546,1075,546,1070.00%

Action Details: Mutilate Oh Vicious Venoms

  • id:385802
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20666.54
  • base_dd_max:20666.54
  • base_dd_mult:1.20
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385802
  • name:Mutilate
  • school:nature
  • tooltip:
  • description:{$@spelldesc381634=Ambush and Mutilate cost {$s2=5} more Energy and deal {$s1=35}% additional damage as Nature.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
    Mutilated Flesh 9,0161.2%0.00.00s00Periodic95.628,278028,2780.0%0.0%95.6%

Stats Details: Mutilated Flesh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.0095.5695.56158.760.00003.00002,702,222.732,702,222.730.00%9,425.760.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%95.567211828,277.875,72188,78728,307.6524,01233,7402,702,2232,702,2230.00%

Action Details: Mutilated Flesh

  • id:394021
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:unknown

Spelldata

  • id:394021
  • name:Mutilated Flesh
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every $t sec.
  • description:{$@spelldesc340082=Mutilate deals an additional {$s1=45}% Bleed damage over {$=}{{$340431d=6 seconds}+2} sec. Envenom damage increased by {$s2=5}% for each Bleed you have on the target.}
Rupture 55,217 (94,259)7.2% (12.3%)9.731.26s2,925,4562,912,461Periodic164.8 (349.7)82,002164,617100,48322.4% (22.7%)0.0%

Stats Details: Rupture

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.670.00164.83164.837.791.00451.781516,561,935.0316,561,935.030.00%93,228.702,912,460.68
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit77.63%127.968517582,002.4343156,35781,993.0776,83487,81510,493,00710,493,0070.00%
crit22.37%36.871664164,617.45171312,714164,618.13139,769196,8916,068,9286,068,9280.00%

Action Details: Rupture

  • id:1943
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.336574
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:2.13
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for {$=}w1 damage every {$t1=2} sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : {$=}{{$=}o1*2} over 8 sec 2 points: {$=}{{$=}o1*3} over 12 sec 3 points: {$=}{{$=}o1*4} over 16 sec 4 points: {$=}{{$=}o1*5} over 20 sec 5 points: {$=}{{$=}o1*6} over 24 sec{$?s193531=true}|((s394320|s394321}s457512)&!s193531)[ 6 points: {$=}{{$=}o1*7} over 28 sec][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: {$=}{{$=}o1*8} over 32 sec][]

Action Priority List

    core_dot
    [L]:9.67
  • if_expr:combo_points>=variable.effective_spend_cp&(pmultiplier<=1)&refreshable&!buff.cold_blood.up&target.time_to_die-remains>(4+(talent.dashing_scoundrel*5)+(variable.regen_saturated*6))&(!buff.darkest_night.up|talent.caustic_spatter&!debuff.caustic_spatter.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Periodic AmountAssassination Rogue13703725PCT40.0%
Spell Periodic AmountDeeper Stratagem1935315PCT5.0%
Spell Periodic AmountBloody Mess3816261PCT15.0%
Spell Periodic AmountSanguine Stratagem4575125PCT5.0%
    Serrated Bone Spike 15,2912.0%19.314.79s237,2760Direct9.794,545208,025120,10222.5%0.0%
Periodic110.623,89953,82030,98323.7%0.0%98.8%

Stats Details: Serrated Bone Spike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.339.67110.58110.588.670.00002.68114,587,431.945,085,039.749.79%15,472.830.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.47%7.4921294,545.3386,682136,83094,487.7186,682117,675708,0891,011,55430.00%
crit22.53%2.1808208,025.42190,700301,026189,233.430301,026453,000647,14227.27%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit76.32%84.405311523,898.6216,65945,60223,896.4422,26825,6262,016,9502,016,9500.00%
crit23.68%26.1985153,820.0037,210100,32453,831.8345,15164,4451,409,3941,409,3940.00%

Action Details: Serrated Bone Spike

  • id:385424
  • school:physical
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385424
  • name:Serrated Bone Spike
  • school:physical
  • tooltip:
  • description:Embed a bone spike in the target, dealing {$s1=0} Physical damage and {$394036s1=0} Bleed damage every {$394036t1=3} sec until they die or leave combat. Refunds a charge when target dies. |cFFFFFFFFAwards 1 combo point plus 1 additional per active bone spike.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
    Corrupt the Blood 23,7513.1%175.21.71s40,6940Periodic175.233,27366,39640,69422.4%0.0%0.0%

Stats Details: Corrupt The Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage175.230.000.00175.230.000.00000.00007,130,626.267,130,626.260.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit77.59%135.979218133,273.352,46071,70533,242.5130,75035,9794,524,0194,524,0190.00%
crit22.41%39.26176566,396.184,920143,40966,342.1855,97077,0582,606,6072,606,6070.00%

Action Details: Corrupt The Blood

  • id:457133
  • school:shadowstorm
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:457133
  • name:Corrupt the Blood
  • school:shadowstorm
  • tooltip:{$@=}auracaster's Rupture corrupts your blood, dealing {$s2=0} Plague damage.
  • description:{$@spelldesc457066=Rupture deals an additional {$457133s2=0} Plague damage each time it deals damage, stacking up to {$457133u=10} times. Rupture duration increased by {$=}{{$s1=3000}/1000} sec.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Shiv 3,0470.4%10.530.05s87,13086,740Direct10.568,148150,70987,12823.0%0.0%

Stats Details: Shiv

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.4710.470.000.000.001.00450.0000912,071.471,302,957.9430.00%86,740.0486,740.04
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.01%8.0621368,148.4062,38595,88868,153.5763,24876,563549,372784,81630.00%
crit22.99%2.4109150,708.90137,246216,647139,729.640210,953362,700518,14227.81%

Action Details: Shiv

  • id:5938
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:30
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:5938
  • name:Shiv
  • school:physical
  • tooltip:
  • description:Attack with your {$?s319032=true}[poisoned blades][off-hand], dealing $sw1 Physical damage, dispelling all enrage effects and applying a concentrated form of your {$?a3408=true}[Crippling Poison, reducing movement speed by {$115196s1=70}% for {$115196d=5 seconds}.]?a5761[Numbing Poison, reducing casting speed by {$359078s1=25}% for {$359078d=5 seconds}.][]{$?=}(!a3408&!a5761)[active Non-Lethal poison.][]{$?=}(a319032&a400783)[ Your Nature and Bleed ]?a319032[ Your Nature ]?a400783[ Your Bleed ][]{$?=}(a400783|a319032)[damage done to the target is increased by {$319504s1=30}% for {$319504d=8 seconds}.][]{$?a354124=false}[ The target's healing received is reduced by {$354124=}S1% for {$319504d=8 seconds}.][] |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r

Action Priority List

    shiv
    [T]:2.33
  • if_expr:debuff.deathstalkers_mark.stack<=2&combo_points>=variable.effective_spend_cp&buff.lingering_darkness.up
    shiv
    [U]:4.74
  • if_expr:talent.lightweight_shiv.enabled&variable.shiv_kingsbane_condition&(dot.kingsbane.ticking&dot.kingsbane.remains<(8+3*(set_bonus.tww3_deathstalker_4pc))&dot.kingsbane.remains>4|cooldown.kingsbane.remains<=1&cooldown.shiv.charges_fractional>=1.7)
    shiv
    [V]:0.99
  • if_expr:debuff.deathmark.up&talent.arterial_precision&!debuff.shiv.up&dot.garrote.ticking&dot.rupture.ticking
    shiv
    [W]:0.67
  • if_expr:fight_remains<=cooldown.shiv.charges*(8+3*(set_bonus.tww3_deathstalker_4pc))
    stealthed
    [Y]:1.73
  • if_expr:talent.kingsbane&dot.kingsbane.ticking&dot.kingsbane.remains<8&(!debuff.shiv.up&debuff.shiv.remains<1)&buff.envenom.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountAssassination Rogue1370371PCT12.0%
Spell Periodic AmountAssassination Rogue1370372PCT12.0%
Spell Direct AmountAssassination Rogue13703720PCT7.0%
Spell Periodic AmountAssassination Rogue13703721PCT7.0%
Spell Critical Bonus MultiplierLethality3822382PCT20.0%
Modify Cooldown Charge (Category)Lightweight Shiv3949831SET1.000
Spell Direct AmountLightweight Shiv3949832PCT100.0%
Spell TargetsArterial Precision4007832ADD8.000
Simple Action Stats Execute Interval
Lycrow
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Cold Blood 5.067.79s

Stats Details: Cold Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Cold Blood

  • id:382245
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382245
  • name:Cold Blood
  • school:physical
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.

Action Priority List

    cds
    [J]:5.00
  • if_expr:(buff.fatebound_coin_tails.stack>0&buff.fatebound_coin_heads.stack>0)|debuff.shiv.up&(cooldown.deathmark.remains>50&(!set_bonus.tww3_fatebound_4pc)|dot.kingsbane.ticking&(set_bonus.tww3_fatebound_4pc)|!talent.inevitabile_end&effective_combo_points>=variable.effective_spend_cp)
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5307.11s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    misc_cds
    [S]:1.48
  • if_expr:buff.bloodlust.react|fight_remains<30|debuff.deathmark.up
Slice and Dice (recuperator) 97.93.00s

Stats Details: Recuperator

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal97.860.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Recuperator

  • id:426605
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:426605
  • name:Slice and Dice
  • school:physical
  • tooltip:
  • description:{$@spelldesc378996=Slice and Dice heals you for up to {$s1=1}% of your maximum health per $426605t sec.}
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Thistle Tea 3.365.42s

Stats Details: Thistle Tea

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.260.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Thistle Tea

  • id:381623
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:energy
  • energize_amount:100.0

Spelldata

  • id:381623
  • name:Thistle Tea
  • school:physical
  • tooltip:Mastery increased by {$=}{{$=}w2*$mas}.1%.
  • description:Restore {$s1=100} Energy. Mastery increased by {$=}{{$s2=8}*$mas}.1% for {$d=6 seconds}. When your Energy is reduced below {$469779s2=30}, drink a Thistle Tea.

Action Priority List

    cds
    [G]:3.26
  • if_expr:hero_tree.deathstalker&(!buff.thistle_tea.up&debuff.shiv.remains>=6|!buff.thistle_tea.up&dot.kingsbane.ticking&dot.kingsbane.remains<=6|!buff.thistle_tea.up&fight_remains<=cooldown.thistle_tea.charges*6)
Thistle Tea (_auto) 4.065.79s

Stats Details: Thistle Tea Auto

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.950.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Thistle Tea Auto

  • id:381623
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:energy
  • energize_amount:100.0

Spelldata

  • id:381623
  • name:Thistle Tea
  • school:physical
  • tooltip:Mastery increased by {$=}{{$=}w2*$mas}.1%.
  • description:Restore {$s1=100} Energy. Mastery increased by {$=}{{$s2=8}*$mas}.1% for {$d=6 seconds}. When your Energy is reduced below {$469779s2=30}, drink a Thistle Tea.
Vanish 2.9120.97s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.870.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lycrow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    vanish
    [b]:1.93
  • if_expr:!talent.master_assassin&!talent.indiscriminate_carnage&talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up|cooldown.deathmark.remains<4)&combo_points.deficit>=(spell_targets.fan_of_knives>?4)
    vanish
    [c]:0.94
  • if_expr:talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up)&raid_event.adds.in>30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Acrobatic Strikes1.1539.3163.7s0.6s264.1s99.92%100.00%529.1 (529.1)0.1

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:3.2s / 351.5s
  • trigger_min/max:0.0s / 6.1s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 360.0s
  • uptime_min/max:98.61% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.25%
  • acrobatic_strikes_2:0.26%
  • acrobatic_strikes_3:0.25%
  • acrobatic_strikes_4:0.25%
  • acrobatic_strikes_5:0.24%
  • acrobatic_strikes_6:0.23%
  • acrobatic_strikes_7:0.22%
  • acrobatic_strikes_8:0.20%
  • acrobatic_strikes_9:0.19%
  • acrobatic_strikes_10:97.82%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Alacrity5.627.153.8s9.1s47.1s88.17%0.00%12.6 (12.6)4.7

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:15.0s / 314.6s
  • trigger_min/max:2.0s / 85.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.2s
  • uptime_min/max:61.91% / 99.44%

Stack Uptimes

  • alacrity_1:15.68%
  • alacrity_2:12.61%
  • alacrity_3:10.08%
  • alacrity_4:8.26%
  • alacrity_5:41.54%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Blindside21.30.013.6s13.6s1.9s13.56%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_blindside
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 199.2s
  • trigger_min/max:1.0s / 199.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:2.84% / 33.24%

Stack Uptimes

  • blindside_1:13.56%

Spelldata

  • id:121153
  • name:Blindside
  • tooltip:Ambush is free and usable without Stealth.
  • description:{$@spelldesc111240=Exploits the vulnerability of foes with less than {$s4=35}% health, dealing {$s2=0} Physical damage to the target. Mutilate has a {$s5=25}% chance to make your next Blindside free and usable on any target, regardless of their health. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clear the Witnesses13.40.023.1s23.9s8.2s36.62%0.00%0.0 (0.0)7.3

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_clear_the_witnesses
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:11.0s / 50.1s
  • trigger_min/max:10.0s / 50.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.9s
  • uptime_min/max:26.63% / 47.20%

Stack Uptimes

  • clear_the_witnesses_1:36.62%

Spelldata

  • id:457178
  • name:Clear the Witnesses
  • tooltip:Your next {$?=}c1[Fan of Knives][Shuriken Storm] deals additional damage and generates {$=}w1 additional combo point.
  • description:{$@spelldesc457053=Your next {$?=}c1[Fan of Knives][Shuriken Storm] after applying Deathstalker's Mark deals an additional {$457179s1=0} Plague damage and generates {$457178s1=1} additional combo point.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Cold Blood5.00.067.4s67.4s1.2s2.03%2.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_cold_blood
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:2.00
  • is_stacking:false

Trigger Details

  • interval_min/max:45.0s / 140.1s
  • trigger_min/max:45.0s / 140.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.9s
  • uptime_min/max:0.87% / 4.83%

Stack Uptimes

  • cold_blood_1:2.03%

Spelldata

  • id:382245
  • name:Cold Blood
  • tooltip:Critical strike chance of your next damaging ability increased by {$s1=100}%.
  • description:Increases the critical strike chance of your next damaging ability by {$s1=100}%.
  • max_stacks:0
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
Darkest Night13.40.023.3s23.3s5.3s22.47%30.06%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_darkest_night
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.1s / 50.3s
  • trigger_min/max:1.2s / 50.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.2s
  • uptime_min/max:14.90% / 30.96%

Stack Uptimes

  • darkest_night_1:22.47%

Spelldata

  • id:457280
  • name:Darkest Night
  • tooltip:Your next {$?=}c1[Envenom][Eviscerate] cast with maximum combo points is guaranteed to critically strike, deal {$=}w2% additional damage, and apply {$=}w3 stacks of Deathstalker's Mark to the target.
  • description:{$@spelldesc457058=When you consume the final Deathstalker's Mark from a target or your target dies, gain {$457280s1=40} Energy and your next {$?=}c1[Envenom][Eviscerate] cast with maximum combo points is guaranteed to critically strike, deals {$457280s2=60}% additional damage, and applies {$457280s3=3} stacks of Deathstalker's Mark to the target.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Deathstalker's Mark (_buff)38.40.47.8s7.8s1.8s22.68%100.00%0.4 (0.4)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_deathstalkers_mark_buff
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.50
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:2.0s / 31.4s
  • trigger_min/max:2.0s / 31.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.1s
  • uptime_min/max:16.17% / 30.07%

Stack Uptimes

  • deathstalkers_mark_buff_1:22.68%

Spelldata

  • id:457160
  • name:Deathstalker's Mark
  • tooltip:Your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] deals {$=}w1% additional damage.
  • description:{$@spelldesc457052={$?=}c1[Ambush][Shadowstrike] from Stealth{$?=}c3[ or Shadow Dance][] applies {$s1=3} stacks of Deathstalker's Mark to your target. When you spend {$s2=5} or more combo points on attacks against a Marked target you consume an application of Deathstalker's Mark, dealing {$457157s1=0} Plague damage and increasing the damage of your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] by {$457160s1=50}%. You may only have one target Marked at a time.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Envenom16.525.118.1s7.2s13.8s76.16%79.73%25.1 (25.1)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_envenom
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 109.0s
  • trigger_min/max:3.0s / 26.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 104.0s
  • uptime_min/max:65.17% / 89.35%

Stack Uptimes

  • envenom_1:76.16%

Spelldata

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.{$?a455072=true}[ Envenom damage increased by {$s3=0}%.][]{$?s340081=false}[ Poison critical strikes generate {$340426s1=1} Energy.][]{$?a393724=false}[ Poison damage increased by {$=}w7%][]
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : {$=}{{$m1=0}*1} damage, 1 sec 2 points: {$=}{{$m1=0}*2} damage, 2 sec 3 points: {$=}{{$m1=0}*3} damage, 3 sec 4 points: {$=}{{$m1=0}*4} damage, 4 sec 5 points: {$=}{{$m1=0}*5} damage, 5 sec{$?s193531=true}|((s457512)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage, 6 sec ][]{$?s193531=true}&s457512[ 7 points: {$=}{{$m1=0}*7} damage, 7 sec][]{$?a381669=false}[ Up to 2 Envenom applications can overlap.][]
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of Alchemical Chaos (Crit)2.10.6112.1s76.2s35.4s25.11%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 342.2s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 83.54%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.11%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6112.5s77.1s35.2s24.94%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 345.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 80.41%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.94%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6112.4s76.9s35.3s24.87%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 352.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 80.08%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.87%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6112.5s76.7s35.5s25.08%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 348.7s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 213.7s
  • uptime_min/max:0.00% / 75.95%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.08%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge5.20.063.1s63.1s14.6s25.17%0.00%0.0 (0.0)4.9

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Forged Aspirant's Badge of Ferocity

Stat Details

  • stat:agility
  • amount:4486.41

Trigger Details

  • interval_min/max:60.0s / 134.5s
  • trigger_min/max:60.0s / 134.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:15.24% / 28.33%

Stack Uptimes

  • gladiators_badge_1:25.17%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by {$=}w1.
  • description:Increases primary stat by {$s1=5064} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Improved Garrote3.90.083.8s83.8s6.0s7.73%0.00%0.0 (0.0)3.8

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_improved_garrote
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 133.8s
  • trigger_min/max:14.0s / 133.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:6.67% / 9.22%

Stack Uptimes

  • improved_garrote_1:7.73%

Spelldata

  • id:392401
  • name:Improved Garrote
  • tooltip:Garrote deals {$=}w2% increased damage and has no cooldown.
  • description:{$@spelldesc381632=Garrote deals {$s1=50}% increased damage and has no cooldown when used from Stealth and for {$392401d=6 seconds} after breaking Stealth.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Improved Garrote (_aura)3.90.083.8s120.6s0.1s0.10%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_improved_garrote_aura
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 134.9s
  • trigger_min/max:3.0s / 134.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.6s
  • uptime_min/max:0.00% / 1.97%

Stack Uptimes

  • improved_garrote_aura_1:0.10%

Spelldata

  • id:392401
  • name:Improved Garrote
  • tooltip:Garrote deals {$=}w2% increased damage and has no cooldown.
  • description:{$@spelldesc381632=Garrote deals {$s1=50}% increased damage and has no cooldown when used from Stealth and for {$392401d=6 seconds} after breaking Stealth.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Kingsbane5.2279.563.1s1.0s13.1s22.58%100.00%75.4 (75.4)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_kingsbane
  • max_stacks:50
  • base duration:14.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.20/stack
  • auto_attack:1.00 + 0.00/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:56.2s / 143.9s
  • trigger_min/max:0.0s / 131.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s
  • uptime_min/max:13.05% / 25.94%

Stack Uptimes

  • kingsbane_1:0.35%
  • kingsbane_2:0.71%
  • kingsbane_3:0.35%
  • kingsbane_4:0.71%
  • kingsbane_5:0.36%
  • kingsbane_6:0.69%
  • kingsbane_7:0.36%
  • kingsbane_8:0.71%
  • kingsbane_9:0.36%
  • kingsbane_10:0.71%
  • kingsbane_11:0.35%
  • kingsbane_12:0.70%
  • kingsbane_13:0.33%
  • kingsbane_14:0.68%
  • kingsbane_15:0.32%
  • kingsbane_16:0.66%
  • kingsbane_17:0.31%
  • kingsbane_18:0.65%
  • kingsbane_19:0.30%
  • kingsbane_20:0.64%
  • kingsbane_21:0.29%
  • kingsbane_22:0.62%
  • kingsbane_23:0.28%
  • kingsbane_24:0.61%
  • kingsbane_25:0.26%
  • kingsbane_26:0.58%
  • kingsbane_27:0.23%
  • kingsbane_28:0.54%
  • kingsbane_29:0.18%
  • kingsbane_30:0.50%
  • kingsbane_31:0.14%
  • kingsbane_32:0.45%
  • kingsbane_33:0.10%
  • kingsbane_34:0.42%
  • kingsbane_35:0.06%
  • kingsbane_36:0.39%
  • kingsbane_37:0.04%
  • kingsbane_38:0.37%
  • kingsbane_39:0.02%
  • kingsbane_40:0.35%
  • kingsbane_41:0.01%
  • kingsbane_42:0.34%
  • kingsbane_43:0.01%
  • kingsbane_44:0.33%
  • kingsbane_45:0.01%
  • kingsbane_46:0.33%
  • kingsbane_47:0.01%
  • kingsbane_48:0.32%
  • kingsbane_49:0.01%
  • kingsbane_50:4.50%

Spelldata

  • id:394095
  • name:Kingsbane
  • tooltip:Kingsbane damage increased by {$s1=20}%.
  • description:{$@spelldesc385627=Release a lethal poison from your weapons and inject it into your target, dealing {$s2=0} Nature damage instantly and an additional {$=}o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$394095s1=20}%, up to {$=}{{$394095s1=20}*{$394095u=50}}%. |cFFFFFFFFAwards {$s6=1} combo {$=}lpoint:points;.|r}
  • max_stacks:50
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
Lingering Darkness2.90.0122.5s122.5s28.4s26.20%17.47%0.0 (0.0)2.5

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_lingering_darkness
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:104.0s / 140.5s
  • trigger_min/max:104.0s / 140.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:21.49% / 30.74%

Stack Uptimes

  • lingering_darkness_1:26.20%

Spelldata

  • id:457273
  • name:Lingering Darkness
  • tooltip:All {$?=}c1[Nature][Shadow] damage dealt increased by {$?=}c1[{$=}w1][{$=}w2]%.
  • description:{$@spelldesc457056=After {$?=}c1[Deathmark][Shadow Blades] expires, gain {$457273d=30 seconds} of {$457273s1=30}% increased {$?=}c1[Nature][Shadow] damage.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum of Despair1.30.1116.7s91.6s12.4s5.19%18.64%0.1 (0.1)1.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_momentum_of_despair
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.15
  • is_stacking:false

Trigger Details

  • interval_min/max:12.0s / 280.8s
  • trigger_min/max:2.2s / 280.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s
  • uptime_min/max:0.00% / 21.99%

Stack Uptimes

  • momentum_of_despair_1:5.19%

Spelldata

  • id:457115
  • name:Momentum of Despair
  • tooltip:Critical strike chance of {$?s51723=true}[Fan of Knives]{$?s197835=true}[Shuriken Storm] and {$?s121411=false}[Crimson Tempest]{$?s319175=true}[Black Powder] increased by {$=}w1% and critical strike damage increased by {$=}w2%.
  • description:{$@spelldesc457067=If you have critically struck with {$?s51723=true}[Fan of Knives]{$?s197835=true}[Shuriken Storm], increase the critical strike chance of {$?s51723=true}[Fan of Knives]{$?s197835=true}[Shuriken Storm] and {$?s121411=false}[Crimson Tempest]{$?s319175=true}[Black Powder] by {$457115s1=15}% and critical strike damage by {$457115s2=32}% for {$457115d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Crit)1.90.286.4s72.6s16.9s10.92%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_nascent_empowerment_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2696.35

Trigger Details

  • interval_min/max:0.9s / 342.7s
  • trigger_min/max:0.1s / 342.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.8s
  • uptime_min/max:0.00% / 46.75%

Stack Uptimes

  • nascent_empowerment_Crit_1:10.92%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Haste)1.90.287.0s72.9s16.9s10.79%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_nascent_empowerment_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2696.35

Trigger Details

  • interval_min/max:1.8s / 331.1s
  • trigger_min/max:0.0s / 331.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.2s
  • uptime_min/max:0.00% / 45.57%

Stack Uptimes

  • nascent_empowerment_Haste_1:10.79%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Mastery)1.90.285.9s72.3s16.8s10.83%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_nascent_empowerment_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2696.35

Trigger Details

  • interval_min/max:1.3s / 340.8s
  • trigger_min/max:0.1s / 340.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 63.5s
  • uptime_min/max:0.00% / 51.97%

Stack Uptimes

  • nascent_empowerment_Mastery_1:10.84%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Nascent Empowerment (Vers)1.90.286.6s72.9s16.9s10.87%0.00%0.2 (0.2)1.2

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_nascent_empowerment_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2696.35

Trigger Details

  • interval_min/max:1.3s / 331.2s
  • trigger_min/max:0.0s / 330.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.3s
  • uptime_min/max:0.00% / 51.58%

Stack Uptimes

  • nascent_empowerment_Vers_1:10.87%

Spelldata

  • id:449275
  • name:Nascent Empowerment
  • tooltip:{$?=}e0[Critical Strike]?e1[Haste]?e2[Mastery]?e3[Versatility][Highest secondary stat] increased by {$s1=4409}.
  • description:{$@spelldesc443538=Your spells and abilities have a chance to let loose a nascent empowerment from the crystal, increasing a random secondary stat by {$449275s1=4409} for {$449275d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Serrated Bone Spike (_charges)1.011.00.0s28.5s300.0s100.00%100.00%1.3 (1.3)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_serrated_bone_spike_charges
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • serrated_bone_spike_charges_1:1.39%
  • serrated_bone_spike_charges_2:55.59%
  • serrated_bone_spike_charges_3:43.02%

Spelldata

  • id:455366
  • name:Serrated Bone Spike
  • tooltip:Prepared a Serrated Bone Spike.
  • description:{$@spelldesc455352=Prepare a Serrated Bone Spike every {$s1=30} sec, stacking up to {$455366u=3}. Rupture spends a stack to embed a bone spike in its target. |cFFFFFFFF{$@=}spellicon385424 {$@=}spellname385424|r: Deals {$385424s1=0} Physical damage and {$394036s1=0} Bleed damage every {$394036t1=3} sec until the target dies or leaves combat. Refunds a stack when the target dies. |cFFFFFFFFAwards 1 combo point plus 1 additional per active bone spike.|r}
  • max_stacks:3
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Slice and Dice1.00.00.0s0.0s295.1s98.33%91.88%97.9 (97.9)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:235.0s / 355.5s
  • uptime_min/max:97.91% / 98.88%

Stack Uptimes

  • slice_and_dice_1:98.33%

Spelldata

  • id:315496
  • name:Slice and Dice
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth1.00.0194.1s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_stealth
  • max_stacks:1
  • base duration:150.00
  • duration modifier:1.00
  • base cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:137.1s / 261.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 1.6s
  • uptime_min/max:0.00% / 0.58%

Stack Uptimes

  • stealth_1:0.00%

Spelldata

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Tempered Potion1.50.0307.1s307.1s27.4s13.28%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 329.5s
  • trigger_min/max:300.0s / 329.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.92% / 18.06%

Stack Uptimes

  • tempered_potion_1:13.28%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Thistle Tea7.00.242.5s41.0s6.1s14.26%0.00%0.2 (0.2)6.9

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_thistle_tea
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:8.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:8.00%

Trigger Details

  • interval_min/max:6.0s / 75.0s
  • trigger_min/max:3.0s / 75.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:12.30% / 16.11%

Stack Uptimes

  • thistle_tea_1:14.26%

Spelldata

  • id:381623
  • name:Thistle Tea
  • tooltip:Mastery increased by {$=}{{$=}w2*$mas}.1%.
  • description:Restore {$s1=100} Energy. Mastery increased by {$=}{{$s2=8}*$mas}.1% for {$d=6 seconds}. When your Energy is reduced below {$469779s2=30}, drink a Thistle Tea.
  • max_stacks:0
  • duration:6.00
  • cooldown:1.00
  • default_chance:0.00%
Vanish2.90.0121.0s121.0s0.1s0.10%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_vanish
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 134.9s
  • trigger_min/max:120.0s / 134.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s
  • uptime_min/max:0.00% / 1.97%

Stack Uptimes

  • vanish_1:0.10%

Spelldata

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Amplifying Poison (Deathmark) Consumed6.12.010.046.1s3.0s252.7s
Amplifying Poison Consumed29.920.041.09.8s3.0s53.9s
Cold Blood ambush0.20.03.097.9s44.0s252.4s
Cold Blood envenom1.20.05.0108.6s36.5s296.4s
Cold Blood fan_of_knives0.00.01.00.0s0.0s0.0s
Cold Blood kingsbane2.21.05.0139.3s60.0s327.4s
Cold Blood mutilate1.30.05.0103.7s41.3s279.0s
Cold Blood shiv0.00.01.00.0s0.0s0.0s
Serrated Bone Spike Refund Wasted0.70.01.00.0s0.0s0.0s
Serrated Bone Spike Refund Wasted (Partial)0.30.01.00.0s0.0s0.0s
Skyfury (Main Hand)45.118.080.06.5s0.8s78.0s
Skyfury (Off Hand)44.717.080.06.6s0.8s74.6s
Uptime Avg % Min Max Avg Dur Min Max
Energy Cap0.14%0.00%2.66%0.5s0.0s3.6s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Lycrow
Darkest NightEnergy13.44530.296.66%39.477.151.33%
Energy RegenEnergy3,362.123,686.4846.27%1.107.090.19%
Improved AmbushCombo Points22.4016.815.09%0.755.5924.96%
Seal FateCombo Points49.1042.8312.98%0.876.2712.77%
Serrated Bone SpikeCombo Points9.6718.335.56%1.900.000.00%
Shrouded SuffocationCombo Points3.867.712.34%2.000.000.01%
Venomous VimEnergy383.523,059.5138.40%7.988.650.28%
AmbushCombo Points22.4040.5412.29%1.814.269.51%
Fan of KnivesCombo Points5.7511.413.46%1.990.090.75%
GarroteCombo Points16.9116.915.13%1.000.000.00%
KingsbaneCombo Points5.164.871.48%0.940.305.71%
MutilateCombo Points82.76162.0549.12%1.963.472.10%
ShivCombo Points10.478.422.55%0.802.0519.55%
Thistle TeaEnergy3.26295.513.71%90.5230.949.48%
Thistle Tea (_auto)Energy3.95395.074.96%100.000.000.00%
Usage Type Count Total Tot% Avg RPE APR
Lycrow
AmbushEnergy22.4074.480.91%3.333.33202,816.67
EnvenomEnergy41.661,458.0617.79%35.0035.0033,404.92
EnvenomCombo Points41.66267.2681.75%6.426.42182,242.35
Fan of KnivesEnergy5.75201.192.45%35.0035.016,307.61
GarroteEnergy16.91761.019.28%45.0045.0023,545.05
KingsbaneEnergy5.16180.772.21%35.0034.9998,991.32
MutilateEnergy82.764,965.6960.58%60.0060.006,670.01
RuptureEnergy9.67241.682.95%25.0025.00117,015.83
RuptureCombo Points9.6759.6518.25%6.176.17474,132.06
ShivEnergy10.47314.053.83%30.0030.002,904.23
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Energy300.026.5627.3253.869.90.3300.0
Combo Points0.01.101.0922.03.00.07.0

Statistics & Data Analysis

Fight Length
Lycrow Fight Length
Count 9999
Mean 300.00
Minimum 240.01
Maximum 359.97
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Lycrow Damage Per Second
Count 9999
Mean 765448.55
Minimum 669621.59
Maximum 899215.88
Spread ( max - min ) 229594.29
Range [ ( max - min ) / 2 * 100% ] 15.00%
Standard Deviation 28437.4761
5th Percentile 720891.62
95th Percentile 814120.15
( 95th Percentile - 5th Percentile ) 93228.53
Mean Distribution
Standard Deviation 284.3890
95.00% Confidence Interval ( 764891.15 - 766005.94 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5303
0.1 Scale Factor Error with Delta=300 6903444
0.05 Scale Factor Error with Delta=300 27613774
0.01 Scale Factor Error with Delta=300 690344337
Priority Target DPS
Lycrow Priority Target Damage Per Second
Count 9999
Mean 765448.55
Minimum 669621.59
Maximum 899215.88
Spread ( max - min ) 229594.29
Range [ ( max - min ) / 2 * 100% ] 15.00%
Standard Deviation 28437.4761
5th Percentile 720891.62
95th Percentile 814120.15
( 95th Percentile - 5th Percentile ) 93228.53
Mean Distribution
Standard Deviation 284.3890
95.00% Confidence Interval ( 764891.15 - 766005.94 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5303
0.1 Scale Factor Error with Delta=300 6903444
0.05 Scale Factor Error with Delta=300 27613774
0.01 Scale Factor Error with Delta=300 690344337
DPS(e)
Lycrow Damage Per Second (Effective)
Count 9999
Mean 765448.55
Minimum 669621.59
Maximum 899215.88
Spread ( max - min ) 229594.29
Range [ ( max - min ) / 2 * 100% ] 15.00%
Damage
Lycrow Damage
Count 9999
Mean 229547273.08
Minimum 165762531.79
Maximum 291698443.94
Spread ( max - min ) 125935912.15
Range [ ( max - min ) / 2 * 100% ] 27.43%
DTPS
Lycrow Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Lycrow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Lycrow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Lycrow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Lycrow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 apply_poison
1 0.00 snapshot_stats
2 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_use_buff&(!trinket.2.has_use_buff|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)&!trinket.2.is.treacherous_transmitter|trinket.1.is.treacherous_transmitter|trinket.1.is.house_of_cards
3 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_use_buff&(!trinket.1.has_use_buff|trinket.2.cooldown.duration>trinket.1.cooldown.duration)&!trinket.1.is.treacherous_transmitter|trinket.2.is.treacherous_transmitter|trinket.2.is.house_of_cards
4 0.00 variable,name=effective_spend_cp,value=cp_max_spend-2<?5
5 0.00 stealth
6 0.00 slice_and_dice,precombat_seconds=1
Default action list Executed every time the actor is available.
# count action,conditions
0.00 stealth
0.00 kick
0.00 variable,name=single_target,value=spell_targets.fan_of_knives=1
0.00 variable,name=regen_saturated,value=energy.regen_combined>30+10*!talent.dashing_scoundrel
0.00 variable,name=in_cooldowns,value=dot.kingsbane.ticking|debuff.shiv.up
0.00 variable,name=upper_limit_energy,value=energy.pct>=(80-10*talent.vicious_venoms.rank-30*talent.amplifying_poison)
0.00 variable,name=cd_soon,value=talent.kingsbane&cooldown.kingsbane.remains<3&!cooldown.kingsbane.ready
0.00 variable,name=not_pooling,value=variable.in_cooldowns|buff.darkest_night.up|variable.upper_limit_energy|fight_remains<=20
0.00 variable,name=scent_effective_max_stacks,value=(spell_targets.fan_of_knives*talent.scent_of_blood.rank*2)>?20
0.00 variable,name=scent_saturation,value=buff.scent_of_blood.stack>=variable.scent_effective_max_stacks
7 0.00 call_action_list,name=stealthed,if=stealthed.rogue|buff.indiscriminate_carnage.up|stealthed.improved_garrote|master_assassin_remains>0
8 0.00 call_action_list,name=cds
9 0.00 call_action_list,name=core_dot
A 0.00 call_action_list,name=aoe_dot,if=!variable.single_target
B 0.00 call_action_list,name=direct
0.00 arcane_torrent,if=energy.deficit>=15+energy.regen_combined
0.00 arcane_pulse
0.00 lights_judgment
0.00 bag_of_tricks
actions.cds
# count action,conditions
0.00 variable,name=deathmark_kingsbane_condition,value=cooldown.kingsbane.remains<=2&buff.envenom.up
0.00 variable,name=deathmark_condition,value=dot.rupture.ticking&(variable.deathmark_kingsbane_condition|spell_targets.fan_of_knives>1&buff.slice_and_dice.remains>5|!talent.kingsbane&dot.crimson_tempest.ticking)&!debuff.deathmark.up
C 0.00 call_action_list,name=items
0.00 invoke_external_buff,name=power_infusion,if=dot.deathmark.ticking
D 0.00 call_action_list,name=shiv,if=!buff.darkest_night.up
E 2.91 deathmark,if=(variable.deathmark_condition&target.time_to_die>=10)|fight_remains<=20
F 5.17 kingsbane,if=(debuff.shiv.up|cooldown.shiv.remains<6)&(buff.envenom.up|spell_targets.fan_of_knives>1)&(cooldown.deathmark.remains>=50-15*(set_bonus.tww3_fatebound_4pc)|dot.deathmark.ticking)|fight_remains<=15
G 3.26 thistle_tea,if=hero_tree.deathstalker&(!buff.thistle_tea.up&debuff.shiv.remains>=6|!buff.thistle_tea.up&dot.kingsbane.ticking&dot.kingsbane.remains<=6|!buff.thistle_tea.up&fight_remains<=cooldown.thistle_tea.charges*6)
H 0.00 call_action_list,name=misc_cds
I 0.00 call_action_list,name=vanish,if=!stealthed.all&master_assassin_remains=0|talent.indiscriminate_carnage&!talent.improved_garrote&!variable.scent_saturation&active_dot.rupture<spell_targets.fan_of_knives&spell_targets.fan_of_knives>=3
J 5.00 cold_blood,use_off_gcd=1,if=(buff.fatebound_coin_tails.stack>0&buff.fatebound_coin_heads.stack>0)|debuff.shiv.up&(cooldown.deathmark.remains>50&(!set_bonus.tww3_fatebound_4pc)|dot.kingsbane.ticking&(set_bonus.tww3_fatebound_4pc)|!talent.inevitabile_end&effective_combo_points>=variable.effective_spend_cp)
actions.core_dot
# count action,conditions
K 13.06 garrote,if=combo_points.deficit>=1&(pmultiplier<=1)&refreshable&target.time_to_die-remains>12
L 9.67 rupture,if=combo_points>=variable.effective_spend_cp&(pmultiplier<=1)&refreshable&!buff.cold_blood.up&target.time_to_die-remains>(4+(talent.dashing_scoundrel*5)+(variable.regen_saturated*6))&(!buff.darkest_night.up|talent.caustic_spatter&!debuff.caustic_spatter.up)
0.00 crimson_tempest,if=combo_points>=variable.effective_spend_cp&refreshable&pmultiplier<=persistent_multiplier&!buff.darkest_night.up&!talent.amplifying_poison&spell_targets.fan_of_knives=1
actions.direct
# count action,conditions
0.00 variable,name=use_caustic_filler,value=talent.caustic_spatter&dot.rupture.ticking&(!debuff.caustic_spatter.up|debuff.caustic_spatter.remains<=2)&combo_points.deficit>=1&!variable.single_target
0.00 mutilate,if=variable.use_caustic_filler
0.00 ambush,if=variable.use_caustic_filler
M 27.81 envenom,if=!buff.darkest_night.up&combo_points>=variable.effective_spend_cp&(variable.not_pooling|debuff.amplifying_poison.stack>=20|!variable.single_target)
N 11.23 envenom,if=buff.darkest_night.up&effective_combo_points>=cp_max_spend
0.00 variable,name=use_filler,value=combo_points<=variable.effective_spend_cp&!variable.cd_soon|variable.not_pooling|!variable.single_target
O 5.75 fan_of_knives,if=buff.clear_the_witnesses.up&(spell_targets.fan_of_knives>=2-(buff.lingering_darkness.up|!talent.vicious_venoms))
0.00 variable,name=fok_target_count,value=spell_targets.fan_of_knives>=3-(talent.momentum_of_despair&talent.thrown_precision)+talent.vicious_venoms+talent.blindside
0.00 fan_of_knives,if=buff.darkest_night.up&combo_points=6&(!talent.vicious_venoms|spell_targets.fan_of_knives>=2)
0.00 fan_of_knives,if=variable.use_filler&!priority_rotation&variable.fok_target_count
P 20.96 ambush,if=variable.use_filler&(buff.blindside.up|stealthed.rogue)&(!dot.kingsbane.ticking|debuff.deathmark.down|buff.blindside.up)
0.00 mutilate,target_if=!dot.deadly_poison_dot.ticking&!debuff.amplifying_poison.up,if=variable.use_filler&spell_targets.fan_of_knives=2
Q 82.76 mutilate,if=variable.use_filler
actions.items
# count action,conditions
0.00 variable,name=base_trinket_condition,value=dot.rupture.ticking&cooldown.deathmark.remains<2&!cooldown.deathmark.ready|dot.deathmark.ticking|fight_remains<=22
0.00 use_item,name=astral_gladiators_badge_of_ferocity,use_off_gcd=1,if=dot.kingsbane.ticking|dot.deathmkark.ticking|(cooldown.kingsbane.remains>60|cooldown.deathmark.remains>60)
0.00 use_item,name=treacherous_transmitter,use_off_gcd=1,if=variable.base_trinket_condition
0.00 use_item,name=unyielding_netherprism,use_off_gcd=1,if=dot.deathmark.ticking&(buff.latent_energy.stack>=16|fight_remains<=90|time<=15)|fight_remains<=20
0.00 use_item,name=mad_queens_mandate,if=cooldown.deathmark.remains>=30&!dot.deathmark.ticking|fight_remains<=3
0.00 use_item,name=junkmaestros_mega_magnet,if=cooldown.deathmark.remains>=30&!dot.deathmark.ticking&!debuff.shiv.up&(!hero_tree.deathstalker|buff.lingering_darkness.up&buff.junkmaestros_mega_magnet.stack>5)|fight_remains<=10
0.00 do_treacherous_transmitter_task,use_off_gcd=1,if=dot.deathmark.ticking&variable.single_target|buff.realigning_nexus_convergence_divergence.up&buff.realigning_nexus_convergence_divergence.remains<=2|buff.cryptic_instructions.up&buff.cryptic_instructions.remains<=2|buff.errant_manaforge_emission.up&buff.errant_manaforge_emission.remains<=2|fight_remains<=15
0.00 use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=variable.base_trinket_condition
R 5.16 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(debuff.deathmark.up|dot.kingsbane.ticking)|(variable.trinket_sync_slot=2&!trinket.2.cooldown.ready&cooldown.deathmark.remains>20))|!variable.trinket_sync_slot|fight_remains<=20
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(debuff.deathmark.up|dot.kingsbane.ticking)|(variable.trinket_sync_slot=1&!trinket.1.cooldown.ready&cooldown.deathmark.remains>20))|!variable.trinket_sync_slot|fight_remains<=20
actions.misc_cds
# count action,conditions
S 1.48 potion,if=buff.bloodlust.react|fight_remains<30|debuff.deathmark.up
0.00 blood_fury,if=debuff.deathmark.up
0.00 berserking,if=debuff.deathmark.up
0.00 fireblood,if=debuff.deathmark.up
0.00 ancestral_call,if=debuff.deathmark.up
actions.shiv
# count action,conditions
0.00 variable,name=shiv_condition,value=!debuff.shiv.up&dot.garrote.ticking&dot.rupture.ticking&spell_targets.fan_of_knives<=5
0.00 variable,name=shiv_kingsbane_condition,value=talent.kingsbane&buff.envenom.up&variable.shiv_condition
0.00 shiv,if=talent.lightweight_shiv&variable.shiv_kingsbane_condition&(cooldown.deathmark.ready|cooldown.deathmark.remains<=1)&(cooldown.kingsbane.ready|cooldown.kingsbane.remains<=2)&set_bonus.tww3_fatebound_2pc
0.00 shiv,if=talent.arterial_precision&!debuff.shiv.up&dot.garrote.ticking&dot.rupture.ticking&spell_targets.fan_of_knives>=4&dot.crimson_tempest.ticking&(target.health.pct<=35&talent.zoldyck_recipe|cooldown.shiv.charges_fractional>=1.9)
0.00 shiv,if=!talent.lightweight_shiv.enabled&variable.shiv_kingsbane_condition&(dot.kingsbane.ticking&dot.kingsbane.remains<(8+3*(set_bonus.tww3_deathstalker_4pc))|!dot.kingsbane.ticking&cooldown.kingsbane.remains>=20)&(!talent.crimson_tempest.enabled|variable.single_target|dot.crimson_tempest.ticking)
T 2.33 shiv,if=debuff.deathstalkers_mark.stack<=2&combo_points>=variable.effective_spend_cp&buff.lingering_darkness.up
U 4.74 shiv,if=talent.lightweight_shiv.enabled&variable.shiv_kingsbane_condition&(dot.kingsbane.ticking&dot.kingsbane.remains<(8+3*(set_bonus.tww3_deathstalker_4pc))&dot.kingsbane.remains>4|cooldown.kingsbane.remains<=1&cooldown.shiv.charges_fractional>=1.7)
V 0.99 shiv,if=debuff.deathmark.up&talent.arterial_precision&!debuff.shiv.up&dot.garrote.ticking&dot.rupture.ticking
0.00 shiv,if=!debuff.deathmark.up&!talent.kingsbane&variable.shiv_condition&(dot.crimson_tempest.ticking|talent.amplifying_poison)&(((talent.lightweight_shiv+1)-cooldown.shiv.charges_fractional)*30<cooldown.deathmark.remains)&raid_event.adds.in>20
0.00 shiv,if=!talent.kingsbane&!talent.arterial_precision&variable.shiv_condition&(!talent.crimson_tempest.enabled|variable.single_target|dot.crimson_tempest.ticking)
W 0.67 shiv,if=fight_remains<=cooldown.shiv.charges*(8+3*(set_bonus.tww3_deathstalker_4pc))
actions.stealthed
# count action,conditions
0.00 pool_resource,for_next=1
X 1.44 ambush,if=!debuff.deathstalkers_mark.up&hero_tree.deathstalker&combo_points<variable.effective_spend_cp&(dot.rupture.ticking|variable.single_target|!talent.subterfuge)
Y 1.73 shiv,if=talent.kingsbane&dot.kingsbane.ticking&dot.kingsbane.remains<8&(!debuff.shiv.up&debuff.shiv.remains<1)&buff.envenom.up
Z 2.62 envenom,if=effective_combo_points>=variable.effective_spend_cp&dot.kingsbane.ticking&buff.envenom.remains<=3&(debuff.deathstalkers_mark.up|buff.cold_blood.up|buff.darkest_night.up&combo_points=7)
0.00 envenom,if=effective_combo_points>=variable.effective_spend_cp&buff.master_assassin_aura.up&variable.single_target&(debuff.deathstalkers_mark.up|buff.cold_blood.up|buff.darkest_night.up&combo_points=7)
0.00 rupture,target_if=effective_combo_points>=variable.effective_spend_cp&buff.indiscriminate_carnage.up&refreshable&((talent.caustic_spatter&!debuff.caustic_spatter.up&!dot.rupture.ticking)|!buff.darkest_night.up)&(!variable.regen_saturated|!variable.scent_saturation|((!talent.dashing_scoundrel|!talent.poison_bomb)&buff.indiscriminate_carnage.up&!dot.rupture.ticking))&target.time_to_die>15
0.00 garrote,target_if=min:remains,if=stealthed.improved_garrote&(remains<12|pmultiplier<=1|(buff.indiscriminate_carnage.up&active_dot.garrote<spell_targets.fan_of_knives))&!variable.single_target&target.time_to_die-remains>2&combo_points.deficit>2-buff.darkest_night.up*2
a 3.85 garrote,if=stealthed.improved_garrote&(pmultiplier<=1|refreshable)&combo_points.deficit>=1+2*talent.shrouded_suffocation
actions.vanish
# count action,conditions
0.00 pool_resource,for_next=1,extra_amount=45
0.00 vanish,if=dot.deathmark.ticking&buff.cold_blood.up&buff.fatebound_coin_tails.stack>=1&buff.fatebound_coin_heads.stack>=1
b 1.93 vanish,if=!talent.master_assassin&!talent.indiscriminate_carnage&talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up|cooldown.deathmark.remains<4)&combo_points.deficit>=(spell_targets.fan_of_knives>?4)
0.00 pool_resource,for_next=1,extra_amount=45
0.00 vanish,if=talent.indiscriminate_carnage&talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&spell_targets.fan_of_knives>2&(target.time_to_die-remains>15|raid_event.adds.in>20)
0.00 vanish,if=talent.indiscriminate_carnage&!talent.improved_garrote&!variable.scent_saturation&spell_targets.fan_of_knives>2&(target.time_to_die-remains>15|raid_event.adds.in>20)
0.00 vanish,if=talent.master_assassin&debuff.deathmark.up&dot.kingsbane.remains<=6+3*talent.subterfuge.rank
c 0.94 vanish,if=talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up)&raid_event.adds.in>30

Sample Sequence

0245XaSLQPMUEJRFQMQQNUGbaQMQQPGMQOMQQQQNOQLQMQPTMKQQPNOQMQQKLQQMQPQFRNKQUJGMQQMQQQLKQQNQQQMKQPMQQLQQKNERUJFQMbaQMYQQMQPNOPLQQMQKQTMQQKQNQQQLKPMFRQQMQQQPNPKQLQQMQQKMQPQNQQPLKQQMUEJRFbaZQQPYNQPMPQMPOMQQQQNOKQLQWMQQJ

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0apply_poison
[precombat]
Lycrow 300.0/300 100% energy
0.0/7 0% CP
serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
Pre2trinket_sync_slot
[precombat]
Lycrow 300.0/300 100% energy
0.0/7 0% CP
serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
Pre4effective_spend_cp
[precombat]
Lycrow 300.0/300 100% energy
0.0/7 0% CP
serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
Pre5stealth
[precombat]
Lycrow 300.0/300 100% energy
0.0/7 0% CP
serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
0:00.000Xambush
[stealthed]
Fluffy_Pillow 300.0/300 100% energy
0.0/7 0% CP
stealth, improved_garrote_aura, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
0:01.004agarrote
[stealthed]
Fluffy_Pillow 254.6/300 85% energy
3.0/7 43% CP
bloodlust, acrobatic_strikes(2), clear_the_witnesses, improved_garrote, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
0:02.009Spotion
[misc_cds]
Fluffy_Pillow 224.2/300 75% energy
6.0/7 86% CP
bloodlust, acrobatic_strikes(4), clear_the_witnesses, improved_garrote, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
0:02.009Lrupture
[core_dot]
Fluffy_Pillow 224.2/300 75% energy
6.0/7 86% CP
bloodlust, acrobatic_strikes(4), clear_the_witnesses, improved_garrote, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion
0:03.014Qmutilate
[direct]
Fluffy_Pillow 222.4/300 74% energy
1.0/7 14% CP
bloodlust, acrobatic_strikes(7), clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit, tempered_potion
0:04.020Pambush
[direct]
Fluffy_Pillow 193.7/300 65% energy
3.0/7 43% CP
bloodlust, acrobatic_strikes(10), clear_the_witnesses, improved_garrote, blindside, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit, tempered_potion
0:05.025Menvenom
[direct]
Fluffy_Pillow 216.9/300 72% energy
6.0/7 86% CP
bloodlust, acrobatic_strikes(10), clear_the_witnesses, improved_garrote, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit, tempered_potion
0:06.031Ushiv
[shiv]
Fluffy_Pillow 205.1/300 68% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit, tempered_potion
0:07.036Edeathmark
[cds]
Fluffy_Pillow 206.3/300 69% energy
1.0/7 14% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit, tempered_potion
0:07.036Jcold_blood
[cds]
Lycrow 206.3/300 69% energy
1.0/7 14% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit, tempered_potion
0:08.041Ruse_items
[items]
Fluffy_Pillow 237.5/300 79% energy
1.0/7 14% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), cold_blood, clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit, tempered_potion
0:08.041Fkingsbane
[cds]
Fluffy_Pillow 237.5/300 79% energy
1.0/7 14% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), cold_blood, clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:09.046Qmutilate
[direct]
Fluffy_Pillow 233.7/300 78% energy
3.0/7 43% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:10.051Menvenom
[direct]
Fluffy_Pillow 220.9/300 74% energy
6.0/7 86% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:11.056Qmutilate
[direct]
Fluffy_Pillow 257.1/300 86% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), clear_the_witnesses, darkest_night, deathstalkers_mark_buff, kingsbane(8), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:12.059Qmutilate
[direct]
Fluffy_Pillow 228.3/300 76% energy
3.0/7 43% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), darkest_night, kingsbane(12), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:13.064Nenvenom
[direct]
Fluffy_Pillow 215.5/300 72% energy
7.0/7 100% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), darkest_night, kingsbane(20), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:14.067Ushiv
[shiv]
Fluffy_Pillow 211.7/300 71% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), clear_the_witnesses, kingsbane(28), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:15.072Gthistle_tea
[cds]
Lycrow 212.9/300 71% energy
1.0/7 14% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), clear_the_witnesses, kingsbane(30), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:15.072bvanish
[vanish]
Lycrow 300.0/300 100% energy
1.0/7 14% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, kingsbane(30), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:15.072agarrote
[stealthed]
Fluffy_Pillow 300.0/300 100% energy
1.0/7 14% CP
bloodlust, slice_and_dice, vanish, envenom, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, improved_garrote_aura, kingsbane(30), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:16.078Qmutilate
[direct]
Fluffy_Pillow 300.0/300 100% energy
4.0/7 57% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, improved_garrote, kingsbane(36), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:17.082Menvenom
[direct]
Fluffy_Pillow 287.2/300 96% energy
6.0/7 86% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), thistle_tea, clear_the_witnesses, improved_garrote, kingsbane(48), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:18.087Qmutilate
[direct]
Fluffy_Pillow 283.5/300 95% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, kingsbane(50), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:19.091Qmutilate
[direct]
Fluffy_Pillow 254.9/300 85% energy
2.0/7 29% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, clear_the_witnesses, improved_garrote, kingsbane(50), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, tempered_potion, gladiators_badge
0:20.096Pambush
[direct]
Fluffy_Pillow 242.4/300 81% energy
4.0/7 57% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, clear_the_witnesses, improved_garrote, blindside, kingsbane(50), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion, gladiators_badge
0:21.101Gthistle_tea
[cds]
Lycrow 274.6/300 92% energy
7.0/7 100% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, clear_the_witnesses, kingsbane(50), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion, gladiators_badge
0:21.101Menvenom
[direct]
Fluffy_Pillow 300.0/300 100% energy
7.0/7 100% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, clear_the_witnesses, kingsbane(50), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion, gladiators_badge
0:22.105Qmutilate
[direct]
Fluffy_Pillow 297.2/300 99% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion, gladiators_badge
0:23.111Ofan_of_knives
[direct]
Fluffy_Pillow 285.4/300 95% energy
2.0/7 29% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, clear_the_witnesses, lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion
0:24.116Menvenom
[direct]
Fluffy_Pillow 282.6/300 94% energy
5.0/7 71% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion
0:25.121Qmutilate
[direct]
Fluffy_Pillow 289.2/300 96% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, darkest_night, deathstalkers_mark_buff, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion
0:26.125Qmutilate
[direct]
Fluffy_Pillow 253.4/300 84% energy
2.0/7 29% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, darkest_night, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion
0:27.128Qmutilate
[direct]
Fluffy_Pillow 225.6/300 75% energy
4.0/7 57% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, darkest_night, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion
0:28.132Qmutilate
[direct]
Fluffy_Pillow 189.7/300 63% energy
6.0/7 86% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, darkest_night, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion
0:29.138Nenvenom
[direct]
Fluffy_Pillow 162.0/300 54% energy
7.0/7 100% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity, darkest_night, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion
0:30.142Ofan_of_knives
[direct]
Fluffy_Pillow 151.3/300 50% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), clear_the_witnesses, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion
0:31.148Qmutilate
[direct]
Fluffy_Pillow 148.7/300 50% energy
2.0/7 29% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, tempered_potion
0:32.151Lrupture
[core_dot]
Fluffy_Pillow 112.9/300 38% energy
6.0/7 86% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:33.156Qmutilate
[direct]
Fluffy_Pillow 119.8/300 40% energy
2.0/7 29% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), deathstalkers_mark_buff, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
0:34.629Menvenom
[direct]
Fluffy_Pillow 99.2/300 33% energy
6.0/7 86% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
0:35.634Qmutilate
[direct]
Fluffy_Pillow 88.1/300 29% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
0:36.639Pambush
[direct]
Fluffy_Pillow 160.0/300 53% energy
3.0/7 43% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, lingering_darkness, blindside, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
0:37.643Tshiv
[shiv]
Fluffy_Pillow 191.9/300 64% energy
6.0/7 86% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
0:38.647Menvenom
[direct]
Fluffy_Pillow 177.8/300 59% energy
7.0/7 100% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), thistle_tea, lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
0:39.651Kgarrote
[core_dot]
Fluffy_Pillow 206.9/300 69% energy
0.0/7 0% CP
bloodlust, slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), thistle_tea, darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
0:40.655Qmutilate
[direct]
Fluffy_Pillow 183.5/300 61% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), thistle_tea, darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:41.658Qmutilate
[direct]
Fluffy_Pillow 143.9/300 48% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), darkest_night, lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:42.662Pambush
[direct]
Fluffy_Pillow 104.2/300 35% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), darkest_night, lingering_darkness, blindside, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:43.666Nenvenom
[direct]
Fluffy_Pillow 132.6/300 44% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(4), darkest_night, lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:44.671Ofan_of_knives
[direct]
Fluffy_Pillow 118.1/300 39% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:45.673Qmutilate
[direct]
Fluffy_Pillow 103.5/300 35% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:48.139Menvenom
[direct]
Fluffy_Pillow 90.2/300 30% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:49.144Qmutilate
[direct]
Fluffy_Pillow 83.7/300 28% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:50.848Qmutilate
[direct]
Fluffy_Pillow 60.8/300 20% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:53.215Kgarrote
[core_dot]
Fluffy_Pillow 46.2/300 15% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:55.209Lrupture
[core_dot]
Fluffy_Pillow 42.0/300 14% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
0:57.079Qmutilate
[direct]
Fluffy_Pillow 64.2/300 21% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
0:59.703Qmutilate
[direct]
Fluffy_Pillow 60.8/300 20% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
1:04.178Menvenom
[direct]
Fluffy_Pillow 96.4/300 32% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
1:05.182Qmutilate
[direct]
Fluffy_Pillow 121.9/300 41% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
1:06.187Pambush
[direct]
Fluffy_Pillow 82.4/300 27% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, blindside, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
1:07.191Qmutilate
[direct]
Fluffy_Pillow 102.9/300 34% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
1:08.196Fkingsbane
[cds]
Fluffy_Pillow 63.4/300 21% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
1:09.201Ruse_items
[items]
Fluffy_Pillow 48.9/300 16% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, kingsbane(3), serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
1:09.201Nenvenom
[direct]
Fluffy_Pillow 48.9/300 16% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, kingsbane(3), serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste, gladiators_badge
1:10.520Kgarrote
[core_dot]
Fluffy_Pillow 46.2/300 15% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(7), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, gladiators_badge
1:13.417Qmutilate
[direct]
Fluffy_Pillow 61.2/300 20% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(8), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, gladiators_badge
1:14.951Ushiv
[shiv]
Fluffy_Pillow 36.3/300 12% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(9), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, gladiators_badge
1:14.951Jcold_blood
[cds]
Lycrow 6.3/300 2% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(10), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste, gladiators_badge
1:15.957Gthistle_tea
[cds]
Lycrow 26.8/300 9% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), cold_blood, clear_the_witnesses, kingsbane(13), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste, gladiators_badge
1:15.957Menvenom
[direct]
Fluffy_Pillow 126.8/300 42% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), cold_blood, thistle_tea, clear_the_witnesses, kingsbane(13), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste, gladiators_badge
1:16.961Qmutilate
[direct]
Fluffy_Pillow 112.3/300 37% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, kingsbane(16), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste, gladiators_badge
1:17.967Qmutilate
[direct]
Fluffy_Pillow 72.8/300 24% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, kingsbane(19), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste, gladiators_badge
1:19.103Menvenom
[direct]
Fluffy_Pillow 42.9/300 14% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, kingsbane(21), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste, gladiators_badge
1:21.888Qmutilate
[direct]
Fluffy_Pillow 66.5/300 22% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, deathstalkers_mark_buff, kingsbane(26), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste, gladiators_badge
1:24.413Qmutilate
[direct]
Fluffy_Pillow 61.8/300 21% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:27.201Qmutilate
[direct]
Fluffy_Pillow 60.5/300 20% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:28.854Lrupture
[core_dot]
Fluffy_Pillow 29.0/300 10% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:29.859Kgarrote
[core_dot]
Fluffy_Pillow 72.5/300 24% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:31.581Qmutilate
[direct]
Fluffy_Pillow 64.9/300 22% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:34.264Qmutilate
[direct]
Fluffy_Pillow 62.2/300 21% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(2), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:36.056Nenvenom
[direct]
Fluffy_Pillow 40.5/300 14% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
1:38.665Qmutilate
[direct]
Fluffy_Pillow 61.9/300 21% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
1:41.508Qmutilate
[direct]
Fluffy_Pillow 61.2/300 20% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_haste
1:44.406Qmutilate
[direct]
Fluffy_Pillow 61.2/300 20% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:47.777Menvenom
[direct]
Fluffy_Pillow 75.1/300 25% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:48.780Kgarrote
[core_dot]
Fluffy_Pillow 60.6/300 20% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_haste
1:51.062Qmutilate
[direct]
Fluffy_Pillow 67.2/300 22% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
1:52.067Pambush
[direct]
Fluffy_Pillow 27.0/300 9% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), blindside, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
1:55.505Menvenom
[direct]
Fluffy_Pillow 91.4/300 30% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
1:56.509Qmutilate
[direct]
Fluffy_Pillow 76.2/300 25% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
1:58.550Qmutilate
[direct]
Fluffy_Pillow 64.2/300 21% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
1:59.739Lrupture
[core_dot]
Fluffy_Pillow 26.2/300 9% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:00.742Qmutilate
[direct]
Fluffy_Pillow 61.0/300 20% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(2), nascent_empowerment_Mastery, flask_of_alchemical_chaos_mastery
2:03.823Qmutilate
[direct]
Fluffy_Pillow 61.2/300 20% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_mastery
2:06.038Kgarrote
[core_dot]
Fluffy_Pillow 51.2/300 17% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_mastery
2:07.858Nenvenom
[direct]
Fluffy_Pillow 43.6/300 15% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_mastery
2:08.863Edeathmark
[cds]
Fluffy_Pillow 28.4/300 9% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_mastery
2:09.865Ruse_items
[items]
Fluffy_Pillow 56.2/300 19% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery
2:09.865Ushiv
[shiv]
Fluffy_Pillow 56.2/300 19% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery, gladiators_badge
2:09.865Jcold_blood
[cds]
Lycrow 26.2/300 9% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery, gladiators_badge
2:10.869Fkingsbane
[cds]
Fluffy_Pillow 54.0/300 18% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), cold_blood, clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery, gladiators_badge
2:12.688Qmutilate
[direct]
Fluffy_Pillow 72.4/300 24% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(4), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery, gladiators_badge
2:13.692Menvenom
[direct]
Fluffy_Pillow 40.2/300 13% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(10), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery, gladiators_badge
2:14.969bvanish
[vanish]
Lycrow 36.2/300 12% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, kingsbane(10), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery, gladiators_badge
2:15.398agarrote
[stealthed]
Fluffy_Pillow 57.2/300 19% energy
0.0/7 0% CP
slice_and_dice, vanish, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, improved_garrote_aura, kingsbane(10), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery, gladiators_badge
2:16.403Qmutilate
[direct]
Fluffy_Pillow 140.0/300 47% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, kingsbane(10), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery, gladiators_badge
2:17.408Menvenom
[direct]
Fluffy_Pillow 107.8/300 36% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, improved_garrote, kingsbane(16), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery, gladiators_badge
2:18.413Yshiv
[stealthed]
Fluffy_Pillow 100.6/300 34% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, kingsbane(18), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery, gladiators_badge
2:19.417Qmutilate
[direct]
Fluffy_Pillow 98.4/300 33% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, deathstalkers_mark_buff, improved_garrote, kingsbane(20), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_mastery, gladiators_badge
2:20.423Qmutilate
[direct]
Fluffy_Pillow 66.3/300 22% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, improved_garrote, kingsbane(20), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
2:21.605Menvenom
[direct]
Fluffy_Pillow 36.2/300 12% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), kingsbane(26), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
2:22.609Qmutilate
[direct]
Fluffy_Pillow 69.0/300 23% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, kingsbane(30), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
2:23.613Pambush
[direct]
Fluffy_Pillow 36.8/300 12% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, blindside, kingsbane(32), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
2:24.616Nenvenom
[direct]
Fluffy_Pillow 64.6/300 22% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, blindside, kingsbane(42), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
2:25.622Ofan_of_knives
[direct]
Fluffy_Pillow 57.4/300 19% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, lingering_darkness, blindside, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
2:26.627Pambush
[direct]
Fluffy_Pillow 50.2/300 17% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, blindside, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
2:27.633Lrupture
[core_dot]
Fluffy_Pillow 70.0/300 23% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
2:28.637Qmutilate
[direct]
Fluffy_Pillow 64.8/300 22% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit
2:31.388Qmutilate
[direct]
Fluffy_Pillow 61.1/300 20% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit
2:35.990Menvenom
[direct]
Fluffy_Pillow 95.2/300 32% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit
2:36.994Qmutilate
[direct]
Fluffy_Pillow 80.0/300 27% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:38.896Kgarrote
[core_dot]
Fluffy_Pillow 58.4/300 19% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(2), nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:41.548Qmutilate
[direct]
Fluffy_Pillow 68.6/300 23% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(3), nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:42.965Tshiv
[shiv]
Fluffy_Pillow 33.2/300 11% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(3), nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:44.612Menvenom
[direct]
Fluffy_Pillow 38.6/300 13% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(3), nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:45.617Qmutilate
[direct]
Fluffy_Pillow 63.4/300 21% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(3), nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:48.492Qmutilate
[direct]
Fluffy_Pillow 61.2/300 20% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, lingering_darkness, serrated_bone_spike_charges(3), nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:51.555Kgarrote
[core_dot]
Fluffy_Pillow 61.2/300 20% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, lingering_darkness, serrated_bone_spike_charges(3), nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:53.972Qmutilate
[direct]
Fluffy_Pillow 68.6/300 23% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), darkest_night, lingering_darkness, serrated_bone_spike_charges(3), nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:55.586Nenvenom
[direct]
Fluffy_Pillow 35.5/300 12% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(3), nascent_empowerment_Vers, flask_of_alchemical_chaos_crit
2:58.393Qmutilate
[direct]
Fluffy_Pillow 65.5/300 22% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
3:01.360Qmutilate
[direct]
Fluffy_Pillow 64.4/300 21% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
3:05.204Qmutilate
[direct]
Fluffy_Pillow 65.6/300 22% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
3:06.901Lrupture
[core_dot]
Fluffy_Pillow 25.5/300 9% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, blindside, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
3:09.623Kgarrote
[core_dot]
Fluffy_Pillow 56.5/300 19% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit
3:10.969Pambush
[direct]
Fluffy_Pillow 43.1/300 14% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
3:11.973Menvenom
[direct]
Fluffy_Pillow 54.4/300 18% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
3:12.977Fkingsbane
[cds]
Fluffy_Pillow 46.7/300 16% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, deathstalkers_mark_buff, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
3:13.981Ruse_items
[items]
Fluffy_Pillow 23.1/300 8% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, deathstalkers_mark_buff, kingsbane, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
3:15.932Qmutilate
[direct]
Fluffy_Pillow 61.1/300 20% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, deathstalkers_mark_buff, kingsbane(6), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
3:16.937Qmutilate
[direct]
Fluffy_Pillow 128.5/300 43% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, kingsbane(8), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
3:17.942Menvenom
[direct]
Fluffy_Pillow 79.9/300 27% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity, thistle_tea, kingsbane(12), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
3:18.946Qmutilate
[direct]
Fluffy_Pillow 112.3/300 37% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), thistle_tea, darkest_night, deathstalkers_mark_buff, kingsbane(13), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
3:19.951Qmutilate
[direct]
Fluffy_Pillow 63.8/300 21% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), thistle_tea, darkest_night, kingsbane(15), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
3:22.477Qmutilate
[direct]
Fluffy_Pillow 64.6/300 22% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), darkest_night, kingsbane(18), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
3:23.482Pambush
[direct]
Fluffy_Pillow 16.1/300 5% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(2), darkest_night, blindside, kingsbane(21), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
3:24.486Nenvenom
[direct]
Fluffy_Pillow 43.6/300 15% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(2), darkest_night, blindside, kingsbane(23), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
3:25.490Pambush
[direct]
Fluffy_Pillow 20.1/300 7% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, blindside, kingsbane(24), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
3:27.565Kgarrote
[core_dot]
Fluffy_Pillow 60.1/300 20% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit, gladiators_badge
3:30.047Qmutilate
[direct]
Fluffy_Pillow 75.7/300 25% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
3:31.051Lrupture
[core_dot]
Fluffy_Pillow 27.3/300 9% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(3), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
3:33.935Qmutilate
[direct]
Fluffy_Pillow 67.8/300 23% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(4), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit
3:37.053Qmutilate
[direct]
Fluffy_Pillow 60.1/300 20% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(4), serrated_bone_spike_charges(2), flask_of_alchemical_chaos_crit
3:41.405Menvenom
[direct]
Fluffy_Pillow 98.8/300 33% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(4), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_crit
3:42.408Qmutilate
[direct]
Fluffy_Pillow 75.6/300 25% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:44.925Qmutilate
[direct]
Fluffy_Pillow 61.2/300 20% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:47.039Kgarrote
[core_dot]
Fluffy_Pillow 58.0/300 19% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_crit
3:50.883Menvenom
[direct]
Fluffy_Pillow 90.2/300 30% energy
6.0/7 86% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:51.887Qmutilate
[direct]
Fluffy_Pillow 107.0/300 36% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:52.891Pambush
[direct]
Fluffy_Pillow 74.8/300 25% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, blindside, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:53.895Qmutilate
[direct]
Fluffy_Pillow 86.6/300 29% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:54.899Nenvenom
[direct]
Fluffy_Pillow 54.4/300 18% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
3:57.092Qmutilate
[direct]
Fluffy_Pillow 61.2/300 20% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:00.143Qmutilate
[direct]
Fluffy_Pillow 69.0/300 23% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:01.147Pambush
[direct]
Fluffy_Pillow 20.8/300 7% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, blindside, serrated_bone_spike_charges(3), nascent_empowerment_Mastery, flask_of_alchemical_chaos_vers
4:03.107Lrupture
[core_dot]
Fluffy_Pillow 59.9/300 20% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:04.111Kgarrote
[core_dot]
Fluffy_Pillow 62.7/300 21% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_vers
4:06.452Qmutilate
[direct]
Fluffy_Pillow 61.2/300 20% energy
3.0/7 43% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_vers
4:09.503Qmutilate
[direct]
Fluffy_Pillow 69.0/300 23% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(2), flask_of_alchemical_chaos_vers
4:13.214Menvenom
[direct]
Fluffy_Pillow 76.6/300 26% energy
7.0/7 100% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:14.217Ushiv
[shiv]
Fluffy_Pillow 61.4/300 20% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:15.222Edeathmark
[cds]
Fluffy_Pillow 59.2/300 20% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:15.222Jcold_blood
[cds]
Lycrow 59.2/300 20% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:16.226Ruse_items
[items]
Fluffy_Pillow 71.1/300 24% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), cold_blood, deathstalkers_mark_buff, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:16.226Fkingsbane
[cds]
Fluffy_Pillow 71.1/300 24% energy
1.0/7 14% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), cold_blood, deathstalkers_mark_buff, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:17.233bvanish
[vanish]
Lycrow 79.9/300 27% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, kingsbane(2), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:17.233agarrote
[stealthed]
Fluffy_Pillow 79.9/300 27% energy
3.0/7 43% CP
slice_and_dice, vanish, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, improved_garrote_aura, kingsbane(2), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:18.238Zenvenom
[stealthed]
Fluffy_Pillow 46.7/300 16% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, improved_garrote, kingsbane(6), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:19.243Qmutilate
[direct]
Fluffy_Pillow 95.5/300 32% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, improved_garrote, kingsbane(8), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:20.735Qmutilate
[direct]
Fluffy_Pillow 85.0/300 28% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, improved_garrote, kingsbane(14), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:21.739Pambush
[direct]
Fluffy_Pillow 136.8/300 46% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, darkest_night, improved_garrote, blindside, kingsbane(20), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:22.743Yshiv
[stealthed]
Fluffy_Pillow 180.6/300 60% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, darkest_night, improved_garrote, kingsbane(26), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:23.747Nenvenom
[direct]
Fluffy_Pillow 162.4/300 54% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, darkest_night, kingsbane(28), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:24.751Qmutilate
[direct]
Fluffy_Pillow 171.2/300 57% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, kingsbane(32), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:25.755Pambush
[direct]
Fluffy_Pillow 123.0/300 41% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), thistle_tea, clear_the_witnesses, blindside, kingsbane(44), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:26.759Menvenom
[direct]
Fluffy_Pillow 166.8/300 56% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, blindside, kingsbane(50), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:27.764Pambush
[direct]
Fluffy_Pillow 143.7/300 48% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, blindside, kingsbane(50), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:28.768Qmutilate
[direct]
Fluffy_Pillow 187.5/300 62% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, kingsbane(50), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:29.772Menvenom
[direct]
Fluffy_Pillow 139.3/300 46% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, blindside, kingsbane(50), serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:30.776Pambush
[direct]
Fluffy_Pillow 148.1/300 49% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, deathstalkers_mark_buff, blindside, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers, gladiators_badge
4:31.782Ofan_of_knives
[direct]
Fluffy_Pillow 159.9/300 53% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:32.788Menvenom
[direct]
Fluffy_Pillow 152.7/300 51% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:33.794Qmutilate
[direct]
Fluffy_Pillow 177.5/300 59% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, deathstalkers_mark_buff, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:34.800Qmutilate
[direct]
Fluffy_Pillow 137.4/300 46% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:35.805Qmutilate
[direct]
Fluffy_Pillow 105.2/300 35% energy
4.0/7 57% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:37.167Qmutilate
[direct]
Fluffy_Pillow 61.2/300 20% energy
6.0/7 86% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:38.783Nenvenom
[direct]
Fluffy_Pillow 36.2/300 12% energy
7.0/7 100% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), darkest_night, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:40.374Ofan_of_knives
[direct]
Fluffy_Pillow 35.9/300 12% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), clear_the_witnesses, lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:42.867Kgarrote
[core_dot]
Fluffy_Pillow 46.2/300 15% energy
2.0/7 29% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, momentum_of_despair, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:45.930Qmutilate
[direct]
Fluffy_Pillow 61.2/300 20% energy
3.0/7 43% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:46.935Lrupture
[core_dot]
Fluffy_Pillow 29.0/300 10% energy
5.0/7 71% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(3), flask_of_alchemical_chaos_vers
4:50.418Qmutilate
[direct]
Fluffy_Pillow 69.2/300 23% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
4:52.382Wshiv
[shiv]
Fluffy_Pillow 49.6/300 17% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
4:53.389Menvenom
[direct]
Fluffy_Pillow 40.1/300 13% energy
5.0/7 71% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
4:55.972Qmutilate
[direct]
Fluffy_Pillow 69.2/300 23% energy
0.0/7 0% CP
slice_and_dice, envenom, acrobatic_strikes(10), alacrity(5), deathstalkers_mark_buff, lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
4:58.870Qmutilate
[direct]
Fluffy_Pillow 61.2/300 20% energy
2.0/7 29% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste
4:59.996Jcold_blood
[cds]
Lycrow 31.2/300 10% energy
4.0/7 57% CP
slice_and_dice, acrobatic_strikes(10), alacrity(5), lingering_darkness, serrated_bone_spike_charges(2), flask_of_alchemical_chaos_haste

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength14647014647146470
Agility176470379723673517339 (15149)
Stamina86452017891417039583943
Intellect12000012360120000
Spirit00000
Health357828034079000
Energy3003000
Combo Points770
Spell Power12360120000
Crit19.87%20.29%5806
Haste7.57%2.21%1456
Versatility18.38%15.76%12290
Attack Power39870367350
Mastery24.89%21.49%3247
Armor154901549015490
Run Speed800
Leech3.00%3.00%0

Gear

Source Slot Average Item Level: 563.00
Local Head Forged Aspirant's Leather Helm
ilevel: 558, stats: { 1,948 Armor, +8,364 Sta, +703 Vers, +645 Mastery, +1,784 AgiInt }
Local Neck Forged Aspirant's Choker
ilevel: 558, stats: { +4,705 Sta, +1,160 Crit, +1,964 Vers }
Local Shoulders Forged Aspirant's Leather Mantle
ilevel: 558, stats: { 1,786 Armor, +6,273 Sta, +462 Crit, +549 Vers, +1,338 AgiInt }
Local Shirt Lucky Shirt
ilevel: 1
Local Chest Forged Aspirant's Leather Tunic
ilevel: 558, stats: { 2,598 Armor, +8,364 Sta, +616 Crit, +732 Vers, +1,784 AgiInt }
Local Waist Forged Aspirant's Leather Belt
ilevel: 558, stats: { 1,461 Armor, +6,273 Sta, +614 Vers, +397 Mastery, +1,338 AgiInt }
Local Legs Forged Aspirant's Leather Leggings
ilevel: 558, stats: { 2,273 Armor, +8,364 Sta, +703 Vers, +645 Mastery, +1,784 AgiInt }
Local Feet Forged Aspirant's Leather Boots
ilevel: 558, stats: { 1,624 Armor, +6,273 Sta, +448 Crit, +563 Vers, +1,338 AgiInt }
Local Wrists Forged Aspirant's Leather Armguards
ilevel: 558, stats: { 1,299 Armor, +4,705 Sta, +423 Vers, +336 Mastery, +1,003 AgiInt }
Local Hands Forged Aspirant's Leather Grips
ilevel: 558, stats: { 1,461 Armor, +6,273 Sta, +405 Crit, +607 Vers, +1,338 AgiInt }
Local Finger1 Forged Aspirant's Band
ilevel: 558, stats: { +4,705 Sta, +1,160 Crit, +1,964 Vers }
Local Finger2 Forged Aspirant's Signet
ilevel: 558, stats: { +4,705 Sta, +1,964 Vers, +1,160 Mastery }
Local Trinket1 Forged Aspirant's Badge of Ferocity
ilevel: 558, stats: { +963 Haste }
item effects: { use: Gladiator's Badge }
Local Trinket2 Empowering Crystal of Anub'ikkaj
ilevel: 597, stats: { +2,439 AgiInt }
item effects: { equip: Empowering Crystal of Anub'ikkaj }
Local Back Forged Aspirant's Drape
ilevel: 558, stats: { 1,040 Armor, +4,705 Sta, +363 Crit, +395 Vers, +1,003 StrAgiInt }
Local Main Hand Forged Aspirant's Dagger
ilevel: 580, weapon: { 1,680 - 2,801, 1.8 }, stats: { +1,095 Agi, +5,117 Sta, +307 Crit, +434 Vers }, temporary_enchant: Algari Mana Oil
Local Off Hand Forged Aspirant's Dagger
ilevel: 580, weapon: { 1,680 - 2,801, 1.8 }, stats: { +1,095 Agi, +5,117 Sta, +307 Crit, +434 Vers }, temporary_enchant: Algari Mana Oil

Profile

rogue="Lycrow"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/lycrow"
spec=assassination
level=80
race=human
role=attack
position=back
talents=CMQAA0tw2gAD7pPTLoW5IGZDeMjZmhxMYAAAAAAYWGsMDAAAAAAttNzMmZmBzMz2sNGjZYGzMzMmZz2YGgtZWGLMmxs0Y2WGmsNMsA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:algari_mana_oil_3/off_hand:algari_mana_oil_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=apply_poison
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=trinket_sync_slot,value=1,if=trinket.1.has_use_buff&(!trinket.2.has_use_buff|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)&!trinket.2.is.treacherous_transmitter|trinket.1.is.treacherous_transmitter|trinket.1.is.house_of_cards
actions.precombat+=/variable,name=trinket_sync_slot,value=2,if=trinket.2.has_use_buff&(!trinket.1.has_use_buff|trinket.2.cooldown.duration>trinket.1.cooldown.duration)&!trinket.1.is.treacherous_transmitter|trinket.2.is.treacherous_transmitter|trinket.2.is.house_of_cards
actions.precombat+=/variable,name=effective_spend_cp,value=cp_max_spend-2<?5
actions.precombat+=/stealth
actions.precombat+=/slice_and_dice,precombat_seconds=1

# Executed every time the actor is available.
actions=stealth
actions+=/kick
actions+=/variable,name=single_target,value=spell_targets.fan_of_knives=1
actions+=/variable,name=regen_saturated,value=energy.regen_combined>30+10*!talent.dashing_scoundrel
actions+=/variable,name=in_cooldowns,value=dot.kingsbane.ticking|debuff.shiv.up
actions+=/variable,name=upper_limit_energy,value=energy.pct>=(80-10*talent.vicious_venoms.rank-30*talent.amplifying_poison)
actions+=/variable,name=cd_soon,value=talent.kingsbane&cooldown.kingsbane.remains<3&!cooldown.kingsbane.ready
actions+=/variable,name=not_pooling,value=variable.in_cooldowns|buff.darkest_night.up|variable.upper_limit_energy|fight_remains<=20
actions+=/variable,name=scent_effective_max_stacks,value=(spell_targets.fan_of_knives*talent.scent_of_blood.rank*2)>?20
actions+=/variable,name=scent_saturation,value=buff.scent_of_blood.stack>=variable.scent_effective_max_stacks
actions+=/call_action_list,name=stealthed,if=stealthed.rogue|buff.indiscriminate_carnage.up|stealthed.improved_garrote|master_assassin_remains>0
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=core_dot
actions+=/call_action_list,name=aoe_dot,if=!variable.single_target
actions+=/call_action_list,name=direct
actions+=/arcane_torrent,if=energy.deficit>=15+energy.regen_combined
actions+=/arcane_pulse
actions+=/lights_judgment
actions+=/bag_of_tricks

actions.aoe_dot=variable,name=dot_finisher_condition,value=combo_points>=variable.effective_spend_cp
actions.aoe_dot+=/crimson_tempest,target_if=min:remains,if=spell_targets>=2&variable.dot_finisher_condition&refreshable&target.time_to_die-remains>6&!buff.darkest_night.up
actions.aoe_dot+=/garrote,cycle_targets=1,if=combo_points.deficit>=1&pmultiplier<=1&refreshable&!variable.regen_saturated&spell_targets.fan_of_knives<=3&!talent.dashing_scoundrel&target.time_to_die-remains>12
actions.aoe_dot+=/rupture,cycle_targets=1,if=variable.dot_finisher_condition&refreshable&(!dot.kingsbane.ticking|buff.cold_blood.up)&(!variable.regen_saturated|!variable.scent_saturation)&target.time_to_die>(7+(talent.dashing_scoundrel*5)+(variable.regen_saturated*6))&!buff.darkest_night.up
actions.aoe_dot+=/garrote,if=refreshable&combo_points.deficit=1&(pmultiplier<=1|remains<=tick_time&spell_targets.fan_of_knives>=3)&(remains<=tick_time*2&spell_targets.fan_of_knives>=3)&(target.time_to_die-remains)>4&master_assassin_remains=0

actions.cds=variable,name=deathmark_kingsbane_condition,value=cooldown.kingsbane.remains<=2&buff.envenom.up
actions.cds+=/variable,name=deathmark_condition,value=dot.rupture.ticking&(variable.deathmark_kingsbane_condition|spell_targets.fan_of_knives>1&buff.slice_and_dice.remains>5|!talent.kingsbane&dot.crimson_tempest.ticking)&!debuff.deathmark.up
actions.cds+=/call_action_list,name=items
actions.cds+=/invoke_external_buff,name=power_infusion,if=dot.deathmark.ticking
actions.cds+=/call_action_list,name=shiv,if=!buff.darkest_night.up
actions.cds+=/deathmark,if=(variable.deathmark_condition&target.time_to_die>=10)|fight_remains<=20
actions.cds+=/kingsbane,if=(debuff.shiv.up|cooldown.shiv.remains<6)&(buff.envenom.up|spell_targets.fan_of_knives>1)&(cooldown.deathmark.remains>=50-15*(set_bonus.tww3_fatebound_4pc)|dot.deathmark.ticking)|fight_remains<=15
actions.cds+=/thistle_tea,if=hero_tree.deathstalker&(!buff.thistle_tea.up&debuff.shiv.remains>=6|!buff.thistle_tea.up&dot.kingsbane.ticking&dot.kingsbane.remains<=6|!buff.thistle_tea.up&fight_remains<=cooldown.thistle_tea.charges*6)
actions.cds+=/call_action_list,name=misc_cds
actions.cds+=/call_action_list,name=vanish,if=!stealthed.all&master_assassin_remains=0|talent.indiscriminate_carnage&!talent.improved_garrote&!variable.scent_saturation&active_dot.rupture<spell_targets.fan_of_knives&spell_targets.fan_of_knives>=3
actions.cds+=/cold_blood,use_off_gcd=1,if=(buff.fatebound_coin_tails.stack>0&buff.fatebound_coin_heads.stack>0)|debuff.shiv.up&(cooldown.deathmark.remains>50&(!set_bonus.tww3_fatebound_4pc)|dot.kingsbane.ticking&(set_bonus.tww3_fatebound_4pc)|!talent.inevitabile_end&effective_combo_points>=variable.effective_spend_cp)

actions.core_dot=garrote,if=combo_points.deficit>=1&(pmultiplier<=1)&refreshable&target.time_to_die-remains>12
actions.core_dot+=/rupture,if=combo_points>=variable.effective_spend_cp&(pmultiplier<=1)&refreshable&!buff.cold_blood.up&target.time_to_die-remains>(4+(talent.dashing_scoundrel*5)+(variable.regen_saturated*6))&(!buff.darkest_night.up|talent.caustic_spatter&!debuff.caustic_spatter.up)
actions.core_dot+=/crimson_tempest,if=combo_points>=variable.effective_spend_cp&refreshable&pmultiplier<=persistent_multiplier&!buff.darkest_night.up&!talent.amplifying_poison&spell_targets.fan_of_knives=1

actions.direct=variable,name=use_caustic_filler,value=talent.caustic_spatter&dot.rupture.ticking&(!debuff.caustic_spatter.up|debuff.caustic_spatter.remains<=2)&combo_points.deficit>=1&!variable.single_target
actions.direct+=/mutilate,if=variable.use_caustic_filler
actions.direct+=/ambush,if=variable.use_caustic_filler
actions.direct+=/envenom,if=!buff.darkest_night.up&combo_points>=variable.effective_spend_cp&(variable.not_pooling|debuff.amplifying_poison.stack>=20|!variable.single_target)
actions.direct+=/envenom,if=buff.darkest_night.up&effective_combo_points>=cp_max_spend
actions.direct+=/variable,name=use_filler,value=combo_points<=variable.effective_spend_cp&!variable.cd_soon|variable.not_pooling|!variable.single_target
actions.direct+=/fan_of_knives,if=buff.clear_the_witnesses.up&(spell_targets.fan_of_knives>=2-(buff.lingering_darkness.up|!talent.vicious_venoms))
actions.direct+=/variable,name=fok_target_count,value=spell_targets.fan_of_knives>=3-(talent.momentum_of_despair&talent.thrown_precision)+talent.vicious_venoms+talent.blindside
actions.direct+=/fan_of_knives,if=buff.darkest_night.up&combo_points=6&(!talent.vicious_venoms|spell_targets.fan_of_knives>=2)
actions.direct+=/fan_of_knives,if=variable.use_filler&!priority_rotation&variable.fok_target_count
actions.direct+=/ambush,if=variable.use_filler&(buff.blindside.up|stealthed.rogue)&(!dot.kingsbane.ticking|debuff.deathmark.down|buff.blindside.up)
actions.direct+=/mutilate,target_if=!dot.deadly_poison_dot.ticking&!debuff.amplifying_poison.up,if=variable.use_filler&spell_targets.fan_of_knives=2
actions.direct+=/mutilate,if=variable.use_filler

actions.items=variable,name=base_trinket_condition,value=dot.rupture.ticking&cooldown.deathmark.remains<2&!cooldown.deathmark.ready|dot.deathmark.ticking|fight_remains<=22
actions.items+=/use_item,name=astral_gladiators_badge_of_ferocity,use_off_gcd=1,if=dot.kingsbane.ticking|dot.deathmkark.ticking|(cooldown.kingsbane.remains>60|cooldown.deathmark.remains>60)
actions.items+=/use_item,name=treacherous_transmitter,use_off_gcd=1,if=variable.base_trinket_condition
actions.items+=/use_item,name=unyielding_netherprism,use_off_gcd=1,if=dot.deathmark.ticking&(buff.latent_energy.stack>=16|fight_remains<=90|time<=15)|fight_remains<=20
actions.items+=/use_item,name=mad_queens_mandate,if=cooldown.deathmark.remains>=30&!dot.deathmark.ticking|fight_remains<=3
actions.items+=/use_item,name=junkmaestros_mega_magnet,if=cooldown.deathmark.remains>=30&!dot.deathmark.ticking&!debuff.shiv.up&(!hero_tree.deathstalker|buff.lingering_darkness.up&buff.junkmaestros_mega_magnet.stack>5)|fight_remains<=10
actions.items+=/do_treacherous_transmitter_task,use_off_gcd=1,if=dot.deathmark.ticking&variable.single_target|buff.realigning_nexus_convergence_divergence.up&buff.realigning_nexus_convergence_divergence.remains<=2|buff.cryptic_instructions.up&buff.cryptic_instructions.remains<=2|buff.errant_manaforge_emission.up&buff.errant_manaforge_emission.remains<=2|fight_remains<=15
actions.items+=/use_item,name=imperfect_ascendancy_serum,use_off_gcd=1,if=variable.base_trinket_condition
actions.items+=/use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(debuff.deathmark.up|dot.kingsbane.ticking)|(variable.trinket_sync_slot=2&!trinket.2.cooldown.ready&cooldown.deathmark.remains>20))|!variable.trinket_sync_slot|fight_remains<=20
actions.items+=/use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(debuff.deathmark.up|dot.kingsbane.ticking)|(variable.trinket_sync_slot=1&!trinket.1.cooldown.ready&cooldown.deathmark.remains>20))|!variable.trinket_sync_slot|fight_remains<=20

actions.misc_cds=potion,if=buff.bloodlust.react|fight_remains<30|debuff.deathmark.up
actions.misc_cds+=/blood_fury,if=debuff.deathmark.up
actions.misc_cds+=/berserking,if=debuff.deathmark.up
actions.misc_cds+=/fireblood,if=debuff.deathmark.up
actions.misc_cds+=/ancestral_call,if=debuff.deathmark.up

actions.shiv=variable,name=shiv_condition,value=!debuff.shiv.up&dot.garrote.ticking&dot.rupture.ticking&spell_targets.fan_of_knives<=5
actions.shiv+=/variable,name=shiv_kingsbane_condition,value=talent.kingsbane&buff.envenom.up&variable.shiv_condition
actions.shiv+=/shiv,if=talent.lightweight_shiv&variable.shiv_kingsbane_condition&(cooldown.deathmark.ready|cooldown.deathmark.remains<=1)&(cooldown.kingsbane.ready|cooldown.kingsbane.remains<=2)&set_bonus.tww3_fatebound_2pc
actions.shiv+=/shiv,if=talent.arterial_precision&!debuff.shiv.up&dot.garrote.ticking&dot.rupture.ticking&spell_targets.fan_of_knives>=4&dot.crimson_tempest.ticking&(target.health.pct<=35&talent.zoldyck_recipe|cooldown.shiv.charges_fractional>=1.9)
actions.shiv+=/shiv,if=!talent.lightweight_shiv.enabled&variable.shiv_kingsbane_condition&(dot.kingsbane.ticking&dot.kingsbane.remains<(8+3*(set_bonus.tww3_deathstalker_4pc))|!dot.kingsbane.ticking&cooldown.kingsbane.remains>=20)&(!talent.crimson_tempest.enabled|variable.single_target|dot.crimson_tempest.ticking)
actions.shiv+=/shiv,if=debuff.deathstalkers_mark.stack<=2&combo_points>=variable.effective_spend_cp&buff.lingering_darkness.up
actions.shiv+=/shiv,if=talent.lightweight_shiv.enabled&variable.shiv_kingsbane_condition&(dot.kingsbane.ticking&dot.kingsbane.remains<(8+3*(set_bonus.tww3_deathstalker_4pc))&dot.kingsbane.remains>4|cooldown.kingsbane.remains<=1&cooldown.shiv.charges_fractional>=1.7)
actions.shiv+=/shiv,if=debuff.deathmark.up&talent.arterial_precision&!debuff.shiv.up&dot.garrote.ticking&dot.rupture.ticking
actions.shiv+=/shiv,if=!debuff.deathmark.up&!talent.kingsbane&variable.shiv_condition&(dot.crimson_tempest.ticking|talent.amplifying_poison)&(((talent.lightweight_shiv+1)-cooldown.shiv.charges_fractional)*30<cooldown.deathmark.remains)&raid_event.adds.in>20
actions.shiv+=/shiv,if=!talent.kingsbane&!talent.arterial_precision&variable.shiv_condition&(!talent.crimson_tempest.enabled|variable.single_target|dot.crimson_tempest.ticking)
actions.shiv+=/shiv,if=fight_remains<=cooldown.shiv.charges*(8+3*(set_bonus.tww3_deathstalker_4pc))

actions.stealthed=pool_resource,for_next=1
actions.stealthed+=/ambush,if=!debuff.deathstalkers_mark.up&hero_tree.deathstalker&combo_points<variable.effective_spend_cp&(dot.rupture.ticking|variable.single_target|!talent.subterfuge)
actions.stealthed+=/shiv,if=talent.kingsbane&dot.kingsbane.ticking&dot.kingsbane.remains<8&(!debuff.shiv.up&debuff.shiv.remains<1)&buff.envenom.up
actions.stealthed+=/envenom,if=effective_combo_points>=variable.effective_spend_cp&dot.kingsbane.ticking&buff.envenom.remains<=3&(debuff.deathstalkers_mark.up|buff.cold_blood.up|buff.darkest_night.up&combo_points=7)
actions.stealthed+=/envenom,if=effective_combo_points>=variable.effective_spend_cp&buff.master_assassin_aura.up&variable.single_target&(debuff.deathstalkers_mark.up|buff.cold_blood.up|buff.darkest_night.up&combo_points=7)
actions.stealthed+=/rupture,target_if=effective_combo_points>=variable.effective_spend_cp&buff.indiscriminate_carnage.up&refreshable&((talent.caustic_spatter&!debuff.caustic_spatter.up&!dot.rupture.ticking)|!buff.darkest_night.up)&(!variable.regen_saturated|!variable.scent_saturation|((!talent.dashing_scoundrel|!talent.poison_bomb)&buff.indiscriminate_carnage.up&!dot.rupture.ticking))&target.time_to_die>15
actions.stealthed+=/garrote,target_if=min:remains,if=stealthed.improved_garrote&(remains<12|pmultiplier<=1|(buff.indiscriminate_carnage.up&active_dot.garrote<spell_targets.fan_of_knives))&!variable.single_target&target.time_to_die-remains>2&combo_points.deficit>2-buff.darkest_night.up*2
actions.stealthed+=/garrote,if=stealthed.improved_garrote&(pmultiplier<=1|refreshable)&combo_points.deficit>=1+2*talent.shrouded_suffocation

actions.vanish=pool_resource,for_next=1,extra_amount=45
actions.vanish+=/vanish,if=dot.deathmark.ticking&buff.cold_blood.up&buff.fatebound_coin_tails.stack>=1&buff.fatebound_coin_heads.stack>=1
actions.vanish+=/vanish,if=!talent.master_assassin&!talent.indiscriminate_carnage&talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up|cooldown.deathmark.remains<4)&combo_points.deficit>=(spell_targets.fan_of_knives>?4)
actions.vanish+=/pool_resource,for_next=1,extra_amount=45
actions.vanish+=/vanish,if=talent.indiscriminate_carnage&talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&spell_targets.fan_of_knives>2&(target.time_to_die-remains>15|raid_event.adds.in>20)
actions.vanish+=/vanish,if=talent.indiscriminate_carnage&!talent.improved_garrote&!variable.scent_saturation&spell_targets.fan_of_knives>2&(target.time_to_die-remains>15|raid_event.adds.in>20)
actions.vanish+=/vanish,if=talent.master_assassin&debuff.deathmark.up&dot.kingsbane.remains<=6+3*talent.subterfuge.rank
actions.vanish+=/vanish,if=talent.improved_garrote&cooldown.garrote.up&(dot.garrote.pmultiplier<=1|dot.garrote.refreshable)&(debuff.deathmark.up)&raid_event.adds.in>30

head=forged_aspirants_leather_helm,id=218372,bonus_id=10289/11084/10837/10832/1485
neck=forged_aspirants_choker,id=218430,bonus_id=10289/11084/10837/10832/1485
shoulders=forged_aspirants_leather_mantle,id=218409,bonus_id=10289/11084/1485
back=forged_aspirants_drape,id=218432,bonus_id=10289/11084/1485
chest=forged_aspirants_leather_tunic,id=218393,bonus_id=10289/11084/1485
shirt=lucky_shirt,id=138385
wrists=forged_aspirants_leather_armguards,id=218420,bonus_id=10289/11084/10837/10832/1485
hands=forged_aspirants_leather_grips,id=218398,bonus_id=10289/11084/1485
waist=forged_aspirants_leather_belt,id=218384,bonus_id=10289/11084/10837/10832/1485
legs=forged_aspirants_leather_leggings,id=218408,bonus_id=10289/11084/1485
feet=forged_aspirants_leather_boots,id=218365,bonus_id=10289/11084/1485
finger1=forged_aspirants_band,id=218427,bonus_id=10289/11084/10837/10832/1485
finger2=forged_aspirants_signet,id=218428,bonus_id=10289/11084/10837/10832/1485
trinket1=forged_aspirants_badge_of_ferocity,id=218421,bonus_id=10289/11084/1485
trinket2=empowering_crystal_of_anubikkaj,id=219312,bonus_id=10273/10390/6652/10383/1632/10255
main_hand=forged_aspirants_dagger,id=218437,bonus_id=11084/10282/1507/10254
off_hand=forged_aspirants_dagger,id=218437,bonus_id=11084/10282/1507/10254

# Gear Summary
# gear_ilvl=563.19
# gear_agility=17339
# gear_stamina=83943
# gear_crit_rating=5692
# gear_haste_rating=1427
# gear_mastery_rating=3183
# gear_versatility_rating=12049
# gear_armor=15490

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 102010812
Max Event Queue: 124
Sim Seconds: 3006896
CPU Seconds: 193.1964
Physical Seconds: 45.1151
Speed Up: 15564

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Lycrow Lycrow ambush 8676 6191243 20638 4.48 216448 476102 22.4 22.4 23.1% 0.0% 0.0% 0.0% 13.40sec 8844624 300.00sec
Lycrow Lycrow ambush_vicious_venoms 385794 8914683 29716 4.48 398056 0 0.0 22.4 0.0% 0.0% 0.0% 0.0% 0.00sec 8914683 300.00sec
Lycrow Lycrow amplifying_poison 383414 5621390 18738 62.25 14736 29563 0.0 311.2 22.4% 0.0% 0.0% 0.0% 0.00sec 5621390 300.00sec
Lycrow Lycrow augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Lycrow Lycrow auto_attack 0 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 121.03sec 0 300.00sec
Lycrow Lycrow auto_attack_mh 0 6855486 22852 64.71 19981 40026 323.6 323.6 22.3% 16.4% 0.0% 0.0% 1.08sec 9793541 300.00sec
Lycrow Lycrow auto_attack_oh 1 3420124 11400 64.52 9993 20021 322.6 322.6 22.4% 16.4% 0.0% 0.0% 1.08sec 4885886 300.00sec
Lycrow Lycrow hunt_them_down 457193 14459194 48197 83.96 28117 56412 419.8 419.8 22.4% 0.0% 0.0% 0.0% 0.87sec 14459194 300.00sec
Lycrow Lycrow cold_blood 382245 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 67.79sec 0 300.00sec
Lycrow Lycrow deadly_poison_driver 2823 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Lycrow Lycrow deadly_poison_instant 113780 5611269 18704 62.06 14754 29596 0.0 310.3 22.4% 0.0% 0.0% 0.0% 0.00sec 5611269 300.00sec
Lycrow Lycrow deadly_poison_dot ticks -2818 4081619 13605 33.34 19986 40129 0.0 166.7 22.3% 0.0% 0.0% 0.0% 0.00sec 4081619 300.00sec
Lycrow Lycrow deathmark ticks -360194 2526784 8423 5.73 71549 142988 2.9 28.7 23.3% 0.0% 0.0% 0.0% 122.91sec 2526784 300.00sec
Lycrow Lycrow garrote_deathmark ticks -360830 4896882 16323 5.37 142385 314920 0.0 26.8 23.3% 0.0% 0.0% 0.0% 0.00sec 4896882 300.00sec
Lycrow Lycrow rupture_deathmark ticks -360826 3714315 12381 5.39 111808 223414 0.0 27.0 23.2% 0.0% 0.0% 0.0% 0.00sec 3714315 300.00sec
Lycrow Lycrow amplifying_poison_deathmark 394328 1376472 4588 12.18 18336 36606 0.0 60.9 23.4% 0.0% 0.0% 0.0% 0.00sec 1376472 300.00sec
Lycrow Lycrow deadly_poison_dot_deathmark ticks -394324 851687 2839 5.45 25347 50722 0.0 27.2 23.4% 0.0% 0.0% 0.0% 0.00sec 851687 300.00sec
Lycrow Lycrow deadly_poison_instant_deathmark 394325 1374945 4583 12.18 18335 36600 0.0 60.9 23.3% 0.0% 0.0% 0.0% 0.00sec 1374945 300.00sec
Lycrow Lycrow deathstalkers_mark 457157 6744009 22480 7.76 141649 284161 38.8 38.8 22.6% 0.0% 0.0% 0.0% 7.73sec 6744009 300.00sec
Lycrow Lycrow envenom 32645 42575638 141919 8.33 528055 1558326 41.7 41.7 47.9% 0.0% 0.0% 0.0% 7.15sec 42575638 300.00sec
Lycrow Lycrow poison_bomb 255546 6130889 20436 17.04 58686 117517 85.2 85.2 22.5% 0.0% 0.0% 0.0% 3.33sec 6130889 300.00sec
Lycrow Lycrow fan_of_knives 51723 303769 1013 1.15 40670 91233 5.7 5.7 24.1% 0.0% 0.0% 0.0% 48.36sec 433955 300.00sec
Lycrow Lycrow clear_the_witnesses 457179 965279 3218 1.15 136655 272019 5.7 5.7 23.1% 0.0% 0.0% 0.0% 48.36sec 965279 300.00sec
Lycrow Lycrow fatal_intent 461984 784111 2614 0.20 647652 1282857 1.0 1.0 21.4% 0.0% 0.0% 0.0% 0.00sec 784111 300.00sec
Lycrow Lycrow flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Lycrow Lycrow food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Lycrow Lycrow garrote ticks -703 17918092 59727 32.98 85316 189810 16.9 164.9 22.3% 0.0% 0.0% 0.0% 17.39sec 17918092 300.00sec
Lycrow Lycrow internal_bleeding ticks -381628 4021229 13404 14.66 44752 89626 0.0 73.3 22.5% 0.0% 0.0% 0.0% 0.00sec 4021229 300.00sec
Lycrow Lycrow kingsbane 385627 2319120 7730 1.03 219852 633022 5.2 5.2 55.5% 0.0% 0.0% 0.0% 63.06sec 17894880 300.00sec
Lycrow Lycrow kingsbane ticks -385627 15575760 51919 7.05 342174 741065 5.2 35.3 25.0% 0.0% 0.0% 0.0% 63.06sec 17894880 300.00sec
Lycrow Lycrow mutilate 1329 0 0 0.00 0 0 82.8 0.0 0.0% 0.0% 0.0% 0.0% 3.60sec 0 300.00sec
Lycrow Lycrow mutilate_mh 5374 9186225 30621 16.55 87280 192606 82.8 82.8 22.5% 0.0% 0.0% 0.0% 3.60sec 13123165 300.00sec
Lycrow Lycrow mutilate_oh 27576 4592444 15308 16.55 43645 96264 82.8 82.8 22.5% 0.0% 0.0% 0.0% 3.60sec 6560628 300.00sec
Lycrow Lycrow mutilate_mh_vicious_venoms 385806 11094221 36981 16.55 134049 0 0.0 82.8 0.0% 0.0% 0.0% 0.0% 0.00sec 11094221 300.00sec
Lycrow Lycrow mutilate_oh_vicious_venoms 385802 5546107 18487 16.55 67013 0 0.0 82.8 0.0% 0.0% 0.0% 0.0% 0.00sec 5546107 300.00sec
Lycrow Lycrow mutilated_flesh ticks -394021 2702223 9007 19.11 28278 0 0.0 95.6 0.0% 0.0% 0.0% 0.0% 0.00sec 2702223 300.00sec
Lycrow Lycrow potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.11sec 0 300.00sec
Lycrow Lycrow recuperator 426605 0 0 0.00 0 0 97.9 0.0 0.0% 0.0% 0.0% 0.0% 3.00sec 0 300.00sec
Lycrow Lycrow rupture ticks -1943 16561935 55206 32.97 82002 164617 9.7 164.8 22.4% 0.0% 0.0% 0.0% 31.26sec 16561935 300.00sec
Lycrow Lycrow serrated_bone_spike 385424 1161089 3870 1.93 94545 208025 19.3 9.7 22.5% 0.0% 0.0% 0.0% 14.79sec 5085040 300.00sec
Lycrow Lycrow serrated_bone_spike ticks -385424 3426343 11421 22.12 23899 53820 19.3 110.6 23.7% 0.0% 0.0% 0.0% 14.79sec 5085040 300.00sec
Lycrow Lycrow corrupt_the_blood ticks -457133 7130626 23769 0.00 33273 66396 175.2 0.0 22.4% 0.0% 0.0% 0.0% 1.71sec 7130626 300.00sec
Lycrow Lycrow shiv 5938 912071 3040 2.09 68148 150709 10.5 10.5 23.0% 0.0% 0.0% 0.0% 30.05sec 1302958 300.00sec
Lycrow Lycrow stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Lycrow Lycrow thistle_tea 381623 0 0 0.00 0 0 3.3 0.0 0.0% 0.0% 0.0% 0.0% 65.42sec 0 300.00sec
Lycrow Lycrow thistle_tea_auto 381623 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 65.79sec 0 300.00sec
Lycrow Lycrow vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.97sec 0 300.00sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health754,621.20.00.00%0.0100.0%

Scale Factors for other metrics

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Amplifying Poison4.0307.268.4s1.0s74.1s99.08%99.91%3.8 (3.8)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_amplifying_poison
  • max_stacks:20
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 353.1s
  • trigger_min/max:0.0s / 16.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.3s
  • uptime_min/max:94.55% / 100.00%

Stack Uptimes

  • amplifying_poison_1:1.88%
  • amplifying_poison_2:2.68%
  • amplifying_poison_3:3.52%
  • amplifying_poison_4:4.35%
  • amplifying_poison_5:5.19%
  • amplifying_poison_6:5.99%
  • amplifying_poison_7:6.68%
  • amplifying_poison_8:7.31%
  • amplifying_poison_9:7.83%
  • amplifying_poison_10:8.25%
  • amplifying_poison_11:7.90%
  • amplifying_poison_12:7.12%
  • amplifying_poison_13:6.30%
  • amplifying_poison_14:5.48%
  • amplifying_poison_15:4.70%
  • amplifying_poison_16:3.93%
  • amplifying_poison_17:3.20%
  • amplifying_poison_18:2.55%
  • amplifying_poison_19:1.94%
  • amplifying_poison_20:2.29%

Spelldata

  • id:383414
  • name:Amplifying Poison
  • tooltip:Envenom consumes stacks to amplify its damage.
  • description:{$@spelldesc381664=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy, dealing {$383414s1=0} Nature damage and applying Amplifying Poison for {$383414d=12 seconds}. Envenom can consume {$s2=10} stacks of Amplifying Poison to deal {$s1=35}% increased damage. Max {$383414u=20} stacks.}
  • max_stacks:20
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Amplifying Poison (_deathmark)3.860.083.8s4.0s11.8s15.08%23.97%0.2 (0.2)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_amplifying_poison_deathmark
  • max_stacks:20
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.3s / 139.2s
  • trigger_min/max:0.0s / 125.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:10.89% / 18.27%

Stack Uptimes

  • amplifying_poison_deathmark_1:0.38%
  • amplifying_poison_deathmark_2:0.58%
  • amplifying_poison_deathmark_3:0.78%
  • amplifying_poison_deathmark_4:0.97%
  • amplifying_poison_deathmark_5:1.14%
  • amplifying_poison_deathmark_6:1.28%
  • amplifying_poison_deathmark_7:1.37%
  • amplifying_poison_deathmark_8:1.43%
  • amplifying_poison_deathmark_9:1.45%
  • amplifying_poison_deathmark_10:1.35%
  • amplifying_poison_deathmark_11:1.13%
  • amplifying_poison_deathmark_12:0.92%
  • amplifying_poison_deathmark_13:0.71%
  • amplifying_poison_deathmark_14:0.53%
  • amplifying_poison_deathmark_15:0.38%
  • amplifying_poison_deathmark_16:0.26%
  • amplifying_poison_deathmark_17:0.17%
  • amplifying_poison_deathmark_18:0.11%
  • amplifying_poison_deathmark_19:0.06%
  • amplifying_poison_deathmark_20:0.08%

Spelldata

  • id:394328
  • name:Amplifying Poison
  • tooltip:Envenom consumes stacks to amplify its damage.
  • description:{$@spelldesc381664=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance to poison the enemy, dealing {$383414s1=0} Nature damage and applying Amplifying Poison for {$383414d=12 seconds}. Envenom can consume {$s2=10} stacks of Amplifying Poison to deal {$s1=35}% increased damage. Max {$383414u=20} stacks.}
  • max_stacks:20
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Atrophic Poison1.0310.1145.9s1.0s287.9s99.58%0.00%310.1 (310.1)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_atrophic_poison
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 317.5s
  • trigger_min/max:0.0s / 16.3s
  • trigger_pct:100.00%
  • duration_min/max:6.8s / 360.0s
  • uptime_min/max:96.48% / 100.00%

Stack Uptimes

  • atrophic_poison_1:99.58%

Spelldata

  • id:392388
  • name:Atrophic Poison
  • tooltip:Damage reduced by {$=}{{$=}W1*-1}.1%.
  • description:{$@spelldesc381637=Coats your weapons with a Non-Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy, reducing their damage by {$=}{{$392388s1=3}*-1}.1% for {$392388d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Corrupt the Blood1.0174.22.0s1.7s298.0s99.32%0.00%165.2 (165.2)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_corrupt_the_blood
  • max_stacks:10
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 2.0s
  • trigger_min/max:0.0s / 34.5s
  • trigger_pct:100.00%
  • duration_min/max:238.0s / 358.0s
  • uptime_min/max:99.16% / 99.44%

Stack Uptimes

  • corrupt_the_blood_1:0.48%
  • corrupt_the_blood_2:0.48%
  • corrupt_the_blood_3:0.48%
  • corrupt_the_blood_4:0.48%
  • corrupt_the_blood_5:0.48%
  • corrupt_the_blood_6:0.48%
  • corrupt_the_blood_7:0.47%
  • corrupt_the_blood_8:0.47%
  • corrupt_the_blood_9:0.47%
  • corrupt_the_blood_10:95.02%

Spelldata

  • id:457133
  • name:Corrupt the Blood
  • tooltip:{$@=}auracaster's Rupture corrupts your blood, dealing {$s2=0} Plague damage.
  • description:{$@spelldesc457066=Rupture deals an additional {$457133s2=0} Plague damage each time it deals damage, stacking up to {$457133u=10} times. Rupture duration increased by {$=}{{$s1=3000}/1000} sec.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Deathmark2.90.0122.9s123.1s15.6s15.22%0.00%0.0 (0.0)2.8

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_deathmark
  • max_stacks:1
  • base duration:16.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:6.0s / 140.5s
  • trigger_min/max:120.0s / 140.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:12.12% / 18.27%

Stack Uptimes

  • deathmark_1:15.22%

Spelldata

  • id:394331
  • name:Deathmark
  • tooltip:
  • description:{$@spelldesc360194=Carve a deathmark into an enemy, dealing {$=}o1 Bleed damage over {$d=16 seconds}. While marked your Garrote, Rupture, and Lethal poisons applied to the target are duplicated, dealing {$?a134735=false}[{$=}{100+{$394331s1=0}+{$394331s3=50}}%][{$=}{100+{$394331s1=0}}%] of normal damage.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:0.00%
Deathstalker's Mark13.40.023.1s23.9s17.4s77.85%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_deathstalkers_mark
  • max_stacks:3
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 50.1s
  • trigger_min/max:10.0s / 50.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.1s
  • uptime_min/max:69.71% / 85.10%

Stack Uptimes

  • deathstalkers_mark_1:26.26%
  • deathstalkers_mark_2:23.86%
  • deathstalkers_mark_3:27.73%

Spelldata

  • id:457129
  • name:Deathstalker's Mark
  • tooltip:Marked by {$@=}auracaster, suffering additional Plague damage from their abilities.
  • description:{$@spelldesc457052={$?=}c1[Ambush][Shadowstrike] from Stealth{$?=}c3[ or Shadow Dance][] applies {$s1=3} stacks of Deathstalker's Mark to your target. When you spend {$s2=5} or more combo points on attacks against a Marked target you consume an application of Deathstalker's Mark, dealing {$457157s1=0} Plague damage and increasing the damage of your next {$?=}c1[Ambush or Mutilate]?s200758[Gloomblade or Shadowstrike][Backstab or Shadowstrike] by {$457160s1=50}%. You may only have one target Marked at a time.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Fatal Intent1.031.84.1s7.2s240.9s80.30%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_fatal_intent
  • max_stacks:999
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 8.0s
  • trigger_min/max:1.0s / 48.8s
  • trigger_pct:100.00%
  • duration_min/max:182.7s / 305.8s
  • uptime_min/max:74.80% / 93.96%

Stack Uptimes

  • fatal_intent_1:1.52%
  • fatal_intent_2:1.61%
  • fatal_intent_3:1.66%
  • fatal_intent_4:1.60%
  • fatal_intent_5:1.62%
  • fatal_intent_6:1.70%
  • fatal_intent_7:1.86%
  • fatal_intent_8:2.10%
  • fatal_intent_9:2.38%
  • fatal_intent_10:2.59%
  • fatal_intent_11:2.74%
  • fatal_intent_12:2.88%
  • fatal_intent_13:2.95%
  • fatal_intent_14:3.01%
  • fatal_intent_15:3.01%
  • fatal_intent_16:2.94%
  • fatal_intent_17:2.83%
  • fatal_intent_18:2.76%
  • fatal_intent_19:2.68%
  • fatal_intent_20:2.65%
  • fatal_intent_21:2.62%
  • fatal_intent_22:2.63%
  • fatal_intent_23:2.67%
  • fatal_intent_24:2.66%
  • fatal_intent_25:2.61%
  • fatal_intent_26:2.54%
  • fatal_intent_27:2.44%
  • fatal_intent_28:2.27%
  • fatal_intent_29:2.11%
  • fatal_intent_30:1.91%
  • fatal_intent_31:1.68%
  • fatal_intent_32:1.48%
  • fatal_intent_33:1.25%
  • fatal_intent_34:1.03%
  • fatal_intent_35:0.85%
  • fatal_intent_36:0.67%
  • fatal_intent_37:0.52%
  • fatal_intent_38:0.40%
  • fatal_intent_39:0.30%
  • fatal_intent_40:0.22%
  • fatal_intent_41:0.15%
  • fatal_intent_42:0.13%
  • fatal_intent_43:0.09%
  • fatal_intent_44:0.07%
  • fatal_intent_45:0.06%
  • fatal_intent_46:0.05%
  • fatal_intent_47:0.04%
  • fatal_intent_48:0.07%
  • fatal_intent_49:0.07%
  • fatal_intent_50:0.05%
  • fatal_intent_51:0.02%
  • fatal_intent_52:0.00%
  • fatal_intent_53:0.01%
  • fatal_intent_54:0.02%
  • fatal_intent_55:0.02%
  • fatal_intent_56:0.01%

Spelldata

  • id:461981
  • name:Fatal Intent
  • tooltip:Falling below {$461980=}M~3% health will cause Fatal Intent to inflict {$=}{{$461984s1=0}*(1+{$@=}versadmg)} Plague damage.
  • description:{$@spelldesc461980=Your damaging abilities against enemies above {$=}M3% health have a very high chance to apply Fatal Intent. When an enemy falls below {$=}M3% health, Fatal Intent inflicts {$=}{{$461984s1=0}*(1+{$@=}versadmg)} Plague damage per stack.}
  • max_stacks:999
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Shiv10.30.130.4s30.0s7.9s27.29%27.27%0.1 (0.1)9.7

Buff Details

  • buff initial source:Lycrow
  • cooldown name:buff_shiv
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.30
  • periodic:1.00
  • auto_attack:1.00
  • crit_chance:1.00
  • is_stacking:false

Trigger Details

  • interval_min/max:5.0s / 125.5s
  • trigger_min/max:1.0s / 125.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:20.13% / 31.10%

Stack Uptimes

  • shiv_1:27.29%

Spelldata

  • id:319504
  • name:Shiv
  • tooltip:{$=}w1% increased Nature {$?a400783=true}[and Bleed ][]damage taken from {$@=}auracaster.{$?=}{$=}{{$=}W2<0}[ Healing received reduced by {$=}w2%.][]
  • description:{$@spelldesc245388=Stab your enemy with a toxic poisoned blade, dealing {$s2=0} Nature damage. Your Nature damage done against the target is increased by {$245389s1=30}% for {$245389d=9 seconds}. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 300.00
Minimum 240.01
Maximum 359.97
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 765448.55
Minimum 669621.59
Maximum 899215.88
Spread ( max - min ) 229594.29
Range [ ( max - min ) / 2 * 100% ] 15.00%
Standard Deviation 28437.4761
5th Percentile 720891.62
95th Percentile 814120.15
( 95th Percentile - 5th Percentile ) 93228.53
Mean Distribution
Standard Deviation 284.3890
95.00% Confidence Interval ( 764891.15 - 766005.94 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5303
0.1 Scale Factor Error with Delta=300 6903444
0.05 Scale Factor Error with Delta=300 27613774
0.01 Scale Factor Error with Delta=300 690344337
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health02868588990
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.