SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.5.56865 Live (hotfix 2024-10-20/56865, git build c17f61468a)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Frygg : 1,078,039 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,078,039.21,078,039.21,092.9 / 0.101%219,521.2 / 20.4%37.3
Resource Out In Waiting APM Active
Mana28,167.228,099.80.00%57.8100.0%
Originhttps://worldofwarcraft.com/en-gb/character/frostwolf/frygg
TalentCAEArhxZfsv/vllYUrQS3iw2nPzYzsZBzwMzmBmZmGjxYmZwwMMzMzMzMzMzMzYmZGzABABMzMLLLzMtBAAAAAALAAAAAAAAA
Set Bonus
Scale Factors for Frygg Damage Per Second
Int Crit Vers Mastery Haste
Scale Factors 16.53 13.18 12.40 11.10 9.72
Normalized 1.00 0.80 0.75 0.67 0.59
Scale Deltas 2310 2310 2310 2310 2310
Error 0.68 0.68 0.68 0.68 0.68
Ranking
  • Int > Crit > Vers > Mastery > Haste
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, Intellect=16.53, CritRating=13.18, HasteRating=9.72, MasteryRating=11.10, Versatility=12.40 )

Scale Factors for other metrics

Scale Factors for Frygg Priority Target Damage Per Second
Int Crit Vers Mastery Haste
Scale Factors 16.53 13.18 12.40 11.10 9.72
Normalized 1.00 0.80 0.75 0.67 0.59
Scale Deltas 2310 2310 2310 2310 2310
Error 0.68 0.68 0.68 0.68 0.68
Ranking
  • Int > Crit > Vers > Mastery > Haste
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, Intellect=16.53, CritRating=13.18, HasteRating=9.72, MasteryRating=11.10, Versatility=12.40 )
Scale Factors for Frygg Damage Per Second (Effective)
Int Crit Vers Mastery Haste
Scale Factors 16.53 13.18 12.40 11.10 9.72
Normalized 1.00 0.80 0.75 0.67 0.59
Scale Deltas 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00
Ranking
  • Int > Crit > Vers > Mastery > Haste
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, Intellect=16.53, CritRating=13.18, HasteRating=9.72, MasteryRating=11.10, Versatility=12.40 )
Scale Factors for Frygg Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Frygg Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Frygg Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Frygg Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Frygg Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Frygg Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, )
Scale Factors for Frygg Fight Length
Vers Int Haste Crit Mastery
Scale Factors 0.00 0.00 0.00 0.00 -0.00
Normalized 1.95 1.00 0.98 0.49 -0.94
Scale Deltas 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00
Ranking
  • Vers > Int > Haste > Crit > Mastery
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, Intellect=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=-0.00, Versatility=0.00 )
Scale Factors for Raid Damage Per Second
Int Crit Vers Mastery Haste
Scale Factors 16.53 13.18 12.40 11.10 9.72
Normalized 1.00 0.80 0.75 0.67 0.59
Scale Deltas 2310 2310 2310 2310 2310
Error 0.68 0.68 0.68 0.68 0.68
Ranking
  • Int > Crit > Vers > Mastery > Haste
Pawn string ( Pawn: v1: "Frygg-Frost": Class=Mage, Spec=Frost, Intellect=16.53, CritRating=13.18, HasteRating=9.72, MasteryRating=11.10, Versatility=12.40 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Frygg1,078,039
Comet Storm 0 (18,546)0.0% (1.7%)9.233.63s603,153670,605

Stats Details: Comet Storm

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.220.000.000.000.000.89950.00000.000.000.00%670,605.19670,605.19

Action Details: Comet Storm

  • id:153595
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:25000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:153595
  • name:Comet Storm
  • school:frost
  • tooltip:
  • description:Calls down a series of 7 icy comets on and around the target, that deals up to {$=}{7*{$153596s1=0}} Frost damage to all enemies within {$228601=}A1 yds of its impacts.

Action Priority List

    ss_st
    [P]:9.22
  • if_expr:prev_gcd.1.flurry|prev_gcd.1.cone_of_cold|action.splinterstorm.in_flight
    Comet Storm (_projectile) 18,5461.7%64.24.37s86,6690Direct64.271,693156,30886,66417.7%

Stats Details: Comet Storm Projectile

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage64.1664.160.000.000.000.00000.00005,560,658.265,560,658.260.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.30%52.81227971,693.4952,65394,17771,702.8765,64978,8173,785,8653,785,8650.00%
crit17.70%11.35131156,307.76113,708200,215156,224.64133,792176,6061,774,7941,774,7940.00%

Action Details: Comet Storm Projectile

  • id:153596
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.550000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:153596
  • name:Comet Storm
  • school:frost
  • tooltip:
  • description:{$@spelldesc153595=Calls down a series of 7 icy comets on and around the target, that deals up to {$=}{7*{$153596s1=0}} Frost damage to all enemies within {$228601=}A1 yds of its impacts.}
Flurry 0 (59,366)0.0% (5.5%)35.78.46s498,232550,221

Stats Details: Flurry

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage35.740.000.000.000.000.90550.00000.000.000.00%550,220.76550,220.76

Action Details: Flurry

  • id:44614
  • school:frost
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:25000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:44614
  • name:Flurry
  • school:frost
  • tooltip:
  • description:Unleash a flurry of ice, striking the target {$s1=3} times for a total of {$=}{{$228354s2=0}*{$m1=3}} Frost damage. Each hit reduces the target's movement speed by {$228354s1=70}% for {$228354d=1 second}{$?a378947=true}[, has a {$378947s1=25}% chance to activate Glacial Assault,][] and applies Winter's Chill to the target. Winter's Chill causes the target to take damage from your spells as if it were frozen.

Action Priority List

    cds
    [F]:1.00
  • if_expr:time=0&active_enemies<=2
    ss_st
    [K]:27.43
  • if_expr:cooldown_react&remaining_winters_chill=0&debuff.winters_chill.down&(prev_gcd.1.frostbolt|prev_gcd.1.glacial_spike)
    ss_st
    [R]:7.31
  • if_expr:cooldown_react&buff.icy_veins.up&!action.splinterstorm.in_flight
    Flurry (_bolt) 50,7074.7%107.12.77s142,0320Direct107.187,810189,590142,02953.3%

Stats Details: Flurry Bolt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage107.07107.070.000.000.000.00000.000015,206,941.2815,206,941.280.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit46.73%50.03277887,809.9349,966131,37187,749.8778,04097,0114,393,1854,393,1850.00%
crit53.27%57.043090189,590.10108,754282,731189,480.58171,136208,52210,813,75710,813,7570.00%

Action Details: Flurry Bolt

  • id:228354
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.595000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.15

Spelldata

  • id:228354
  • name:Flurry
  • school:frost
  • tooltip:Movement slowed by {$=}w1%.
  • description:{$@spelldesc44614=Unleash a flurry of ice, striking the target {$s1=3} times for a total of {$=}{{$228354s2=0}*{$m1=3}} Frost damage. Each hit reduces the target's movement speed by {$228354s1=70}% for {$228354d=1 second}{$?a378947=true}[, has a {$378947s1=25}% chance to activate Glacial Assault,][] and applies Winter's Chill to the target. Winter's Chill causes the target to take damage from your spells as if it were frozen.}
    (flurry_) Icicle 3,3890.3%9.428.91s107,5910Direct9.464,053158,909107,70646.0%

Stats Details: Flurry Icicle

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.459.440.000.000.000.00000.00001,016,704.391,016,704.390.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit53.98%5.1001764,052.8046,05498,64763,703.09092,241326,371326,3710.00%
crit46.02%4.34014158,908.57112,202237,905156,993.470220,031690,333690,3330.00%

Action Details: Flurry Icicle

  • id:148022
  • school:frost
  • range:100.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.001000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.16

Spelldata

  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=true}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched. Increases the damage of Frozen Orb, Blizzard,{$?a443739=true}[ Frost Splinters,][] and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.}
    Glacial Assault 5,2700.5%26.711.06s59,2900Direct26.732,39869,84659,28771.8%

Stats Details: Glacial Assault

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage26.6626.660.000.000.000.00000.00001,580,947.911,580,947.910.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit28.19%7.5202032,397.7025,13341,87332,356.62037,288243,523243,5230.00%
crit71.81%19.1534269,845.7754,21991,59169,812.8162,23777,3361,337,4251,337,4250.00%

Action Details: Glacial Assault

  • id:379029
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.333270
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:379029
  • name:Glacial Assault
  • school:frost
  • tooltip:
  • description:{$@spelldesc378947=Your Comet Storm now increases the damage enemies take from you by {$417490s1=6}% for {$417490d=6 seconds} and Flurry has a {$s1=25}% chance each hit to call down an icy comet, crashing into your target and nearby enemies for {$379029s1=0} Frost damage.}
Frost Splinter 89,213 (268,982)8.3% (24.9%)542.71.06s148,5840Direct540.9 (1,386.4)34,84674,58849,44336.7% (31.1%)

Stats Details: Frost Splinter

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage542.75540.850.000.000.000.00000.000026,742,045.5326,742,045.530.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit63.27%342.2018962334,845.9425,63845,16534,819.8832,75737,23811,924,37811,924,3780.00%
crit36.73%198.6611231274,588.4554,77297,33074,560.5370,07879,69714,817,66714,817,6670.00%

Action Details: Frost Splinter

  • id:443722
  • school:frost
  • range:100.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.288000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:443722
  • name:Frost Splinter
  • school:frost
  • tooltip:
  • description:Conjure raw Frost magic into a sharp projectile that deals {$s1=0} Frost damage. Frost Splinters embed themselves into their target, dealing {$443740=}o1 Frost damage over {$443740d=18 seconds}. This effect stacks.
    Embedded Frost Splinter 9,4430.9%540.90.58s5,2390Periodic214.89,68421,98613,19428.5%71.5%

Stats Details: Embedded Frost Splinter

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage540.850.00214.75214.75491.000.00000.99952,833,720.882,833,720.880.00%13,202.450.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.46%153.47922229,684.06377,2949,697.347,42712,2341,486,3011,486,3010.00%
crit28.54%61.283110521,986.277150,16722,014.8515,15431,3881,347,4201,347,4200.00%

Action Details: Embedded Frost Splinter

  • id:443740
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:443740
  • name:Embedded Frost Splinter
  • school:frost
  • tooltip:Dealing {$s1=0} Frost damage every {$t1=1} sec.
  • description:{$@spelldesc443722=Conjure raw Frost magic into a sharp projectile that deals {$s1=0} Frost damage. Frost Splinters embed themselves into their target, dealing {$443740=}o1 Frost damage over {$443740d=18 seconds}. This effect stacks.}
    Volatile Magic 24,1642.2%49.06.05s147,7890Direct49.0108,375240,362147,78129.9%

Stats Details: Volatile Magic

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage49.0249.020.000.000.000.00000.00007,244,635.977,244,635.970.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.14%34.381858108,375.097,788398,448108,317.9388,292136,1023,726,0233,726,0230.00%
crit29.86%14.64331240,362.4417,215938,136240,429.95165,825339,4603,518,6133,518,6130.00%

Action Details: Volatile Magic

  • id:444967
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.100000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:444967
  • name:Volatile Magic
  • school:frost
  • tooltip:
  • description:{$@spelldesc444968=Whenever an Embedded {$?=}c1[Arcane][Frost] Splinter is removed, it explodes, dealing {$?=}c1[{$444966s1=0 + 10.0%} Arcane][{$444967s1=0} Frost] damage to nearby enemies. Deals reduced damage beyond {$s2=5} targets.}
    Embedded Frost Splinter (splinter_recall) 63,5745.9%48.86.07s390,7740Direct48.8390,7750390,7750.0%

Stats Details: Splinter Recall

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage48.7748.770.000.000.000.00000.000019,059,857.4219,059,857.420.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%48.773080390,774.83192,0171,614,318390,591.94333,748461,69919,059,85719,059,8570.00%

Action Details: Splinter Recall

  • id:443934
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:354790.60
  • base_dd_max:354790.60
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:443934
  • name:Embedded Frost Splinter
  • school:frost
  • tooltip:
  • description:{$@spelldesc443740={$@spelldesc443722=Conjure raw Frost magic into a sharp projectile that deals {$s1=0} Frost damage. Frost Splinters embed themselves into their target, dealing {$443740=}o1 Frost damage over {$443740d=18 seconds}. This effect stacks.}}
    Splinterstorm 82,5887.7%534.70.55s46,3110Direct533.034,88775,78546,46128.3%

Stats Details: Splinterstorm

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage534.71532.960.000.000.000.00000.000024,762,954.8124,762,954.810.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.70%382.1121965034,886.7525,51244,98034,873.0532,98637,14413,330,81313,330,8130.00%
crit28.30%150.856326175,784.5354,97996,93175,764.7470,82281,20411,432,14211,432,1420.00%

Action Details: Splinterstorm

  • id:443747
  • school:frost
  • range:100.0
  • travel_speed:90.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.288000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:443747
  • name:Splinterstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc443722=Conjure raw Frost magic into a sharp projectile that deals {$s1=0} Frost damage. Frost Splinters embed themselves into their target, dealing {$443740=}o1 Frost damage over {$443740d=18 seconds}. This effect stacks.}
Frostbolt 21,000 (23,829)2.0% (2.2%)33.68.09s212,849173,027Direct34.6 (42.3)125,396296,207182,28733.3% (37.8%)

Stats Details: Frostbolt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage33.6334.600.000.000.001.23020.00006,307,176.966,307,176.960.00%173,026.76173,026.76
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.70%23.08649125,395.9599,617170,744125,394.43111,993138,6162,893,9062,893,9060.00%
crit33.30%11.52226296,207.09235,618401,942295,919.39259,067344,5263,413,2713,413,2710.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:50000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.063700
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26
  • base_multiplier:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.{$?a378749=false}[ Frostbolt deals {$378749m1=40}% additional damage to Frozen targets.][]

Action Priority List

    ss_st
    [T]:33.78
    (frostbolt_) Icicle 2,8290.3%7.727.67s110,0580Direct7.760,426146,379110,24858.0%

Stats Details: Frostbolt Icicle

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage7.747.730.000.000.000.00000.0000851,805.28851,805.280.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit42.03%3.2501460,426.3846,43594,89955,944.53090,079196,230196,2300.00%
crit57.97%4.48016146,378.94109,634237,711143,192.220213,780655,575655,5750.00%

Action Details: Frostbolt Icicle

  • id:148022
  • school:frost
  • range:100.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.001000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.16

Spelldata

  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=true}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched. Increases the damage of Frozen Orb, Blizzard,{$?a443739=true}[ Frost Splinters,][] and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.}
Frozen Orb 0 (85,797)0.0% (8.0%)26.411.22s973,6111,116,768

Stats Details: Frozen Orb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage26.410.000.000.000.000.87180.00000.000.000.00%1,116,768.301,116,768.30

Action Details: Frozen Orb

  • id:84714
  • school:frost
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:25000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches an orb of swirling ice up to {$s1=40} yds forward which deals up to {$=}{20*{$84721s1=0}} Frost damage to all enemies it passes through over {$d=15 seconds}. Deals reduced damage beyond {$84721s2=8} targets. Grants 1 charge of Fingers of Frost when it first damages an enemy.{$?a382103=true}[ While Frozen Orb is active, you gain Fingers of Frost every {$382106t1=3} sec.][] Enemies damaged by the Frozen Orb are slowed by {$289308s1=30}% for {$289308d=3 seconds}.

Action Priority List

    ss_st
    [M]:26.41
    Frozen Orb (_bolt) 85,7978.0%622.20.47s41,3250Direct622.231,34067,79441,32427.4%

Stats Details: Frozen Orb Bolt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage622.17622.170.000.000.000.00000.000025,711,356.5225,711,356.520.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.61%451.7819198431,340.5018,56042,08131,298.6828,73534,19514,159,32514,159,3250.00%
crit27.39%170.396837967,794.1540,00590,47967,713.6861,28773,87211,552,03211,552,0320.00%

Action Details: Frozen Orb Bolt

  • id:84721
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:9.5
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.132000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.43

Spelldata

  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=0}%.
  • description:{$@spelldesc84714=Launches an orb of swirling ice up to {$s1=40} yds forward which deals up to {$=}{20*{$84721s1=0}} Frost damage to all enemies it passes through over {$d=15 seconds}. Deals reduced damage beyond {$84721s2=8} targets. Grants 1 charge of Fingers of Frost when it first damages an enemy.{$?a382103=true}[ While Frozen Orb is active, you gain Fingers of Frost every {$382106t1=3} sec.][] Enemies damaged by the Frozen Orb are slowed by {$289308s1=30}% for {$289308d=3 seconds}.}
Glacial Spike 230,63421.4%37.17.96s1,866,1221,143,988Direct37.01,153,9932,785,2481,867,43543.7%

Stats Details: Glacial Spike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage37.0737.040.000.000.001.63130.000069,178,095.7569,178,095.750.00%1,143,987.961,143,987.96
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit56.26%20.845361,153,993.38883,7091,614,9301,153,873.971,053,9731,266,91824,049,55024,049,5500.00%
crit43.74%16.204312,785,248.092,107,7943,774,7382,785,626.422,535,0383,180,67145,128,54645,128,5460.00%

Action Details: Glacial Spike

  • id:199786
  • school:frost
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:25000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.540000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.10

Spelldata

  • id:199786
  • name:Glacial Spike
  • school:frost
  • tooltip:Frozen in place.
  • description:Conjures a massive spike of ice, and merges your current Icicles into it. It impales your target, dealing {$228600s1=0} damage plus all of the damage stored in your Icicles, and freezes the target in place for {$228600d=4 seconds}. Damage may interrupt the freeze effect. Requires 5 Icicles to cast. |cFFFFFFFFPassive:|r Ice Lance no longer launches Icicles.

Action Priority List

    ss_st
    [Q]:37.27
  • if_expr:buff.icicles.react=5
Ice Lance 299,866 (321,335)27.8% (29.8%)133.32.24s722,393802,199Direct133.2 (263.8)368,878794,826674,57371.8% (52.0%)

Stats Details: Ice Lance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage133.34133.250.000.000.000.90050.000089,886,437.3389,886,437.330.00%802,198.77802,198.77
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit28.23%37.621763368,877.99103,097560,514368,806.74324,224412,26313,876,39513,876,3950.00%
crit71.77%95.6363135794,826.09472,7771,197,438794,857.41734,305861,46676,010,04276,010,0420.00%

Action Details: Ice Lance

  • id:30455
  • school:frost
  • range:40.0
  • travel_speed:47.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:25000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.605000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.30

Spelldata

  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Quickly fling a shard of ice at the target, dealing {$228598s1=0} Frost damage{$?s56377=true}[, and {$=}{{$228598s1=0}*{$56377m2=90}/100} Frost damage to a second nearby target][]. Ice Lance damage is tripled against frozen targets.

Action Priority List

    ss_st
    [L]:37.29
  • if_expr:buff.icy_veins.up&(debuff.winters_chill.stack=2|debuff.winters_chill.stack=1&action.splinterstorm.in_flight)
    ss_st
    [O]:33.83
  • if_expr:remaining_winters_chill
    ss_st
    [S]:62.21
  • if_expr:buff.fingers_of_frost.react
    (ice_lance_) Icicle 7,0330.7%18.914.59s111,9870Direct18.862,633152,397112,13455.1%

Stats Details: Ice Lance Icicle

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage18.8518.830.000.000.000.00000.00002,111,099.212,111,099.210.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit44.86%8.4502562,633.2946,02199,71962,556.51083,259529,000529,0000.00%
crit55.14%10.38127152,397.34110,095238,687152,476.50124,595200,2431,582,0991,582,0990.00%

Action Details: Ice Lance Icicle

  • id:148022
  • school:frost
  • range:100.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.001000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.16

Spelldata

  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=true}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched. Increases the damage of Frozen Orb, Blizzard,{$?a443739=true}[ Frost Splinters,][] and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.}
    Frigid Pulse 14,4351.3%111.72.63s38,7160Direct111.729,21163,16938,71528.0%

Stats Details: Frigid Pulse

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage111.71111.710.000.000.000.00000.00004,324,876.424,324,876.420.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.01%80.454612829,210.8722,44438,38329,212.3627,44631,2702,349,9242,349,9240.00%
crit27.99%31.26145763,169.1848,99382,45263,171.9658,62069,5801,974,9531,974,9530.00%

Action Details: Frigid Pulse

  • id:460623
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:460623
  • name:Frigid Pulse
  • school:frost
  • tooltip:
  • description:{$@spelldesc453720=Damage dealt by Fingers of Frost enhanced Ice Lances invoke a Frigid Pulse, dealing {$460623s1=0} Frost damage to nearby targets. Damage reduced beyond {$s1=8} targets.}
Shifting Power 6,0690.6%5.460.79s336,858127,864Periodic21.558,176128,73884,57337.4%4.3%

Stats Details: Shifting Power

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.390.0021.4821.480.002.63450.59861,816,689.751,816,689.750.00%127,863.86127,863.86
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit62.58%13.4412458,175.5546,32876,42858,088.5549,53469,337782,013782,0130.00%
crit37.42%8.04021128,738.4299,731167,177128,822.870157,0941,034,6761,034,6760.00%

Action Details: Shifting Power

  • id:382440
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:125000
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:382440
  • name:Shifting Power
  • school:arcane
  • tooltip:Every {$t1=1} sec, deal {$382445s1=0 + 61.0%} Arcane damage to enemies within {$382445=}A1 yds and reduce the remaining cooldown of your abilities by {$=}{-{$s2=3000}/1000} sec.
  • description:Draw power from within, dealing {$=}{{$382445s1=0 + 61.0%}*{$d=4 seconds}/$t} Arcane damage over {$d=4 seconds} to enemies within {$382445=}A1 yds. While channeling, your Mage ability cooldowns are reduced by {$=}{-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:382445
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.609960
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:382445
  • name:Shifting Power
  • school:arcane
  • tooltip:
  • description:{$@spelldesc382440=Draw power from within, dealing {$=}{{$382445s1=0 + 61.0%}*{$d=4 seconds}/$t} Arcane damage over {$d=4 seconds} to enemies within {$382445=}A1 yds. While channeling, your Mage ability cooldowns are reduced by {$=}{-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    ss_st
    [N]:5.39
Spidersting 7,6120.7%10.920.44s210,0860Periodic125.916,02632,01718,21513.7%25.0%

Stats Details: Spidersting

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.910.00125.87125.872.910.00000.59662,292,942.982,292,942.980.00%30,533.900.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit86.31%108.653224116,026.4717127,41315,784.2411,02347,3371,741,3451,741,3450.00%
crit13.69%17.2314532,016.9233254,82631,534.8617,12395,495551,598551,5980.00%

Action Details: Spidersting

  • id:452229
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:10563.21
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:452229
  • name:Spidersting
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every second.
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}
Suffocating Darkness 29,3132.7%28.810.23s305,1520Periodic131.566,888066,8880.0%87.7%

Stats Details: Suffocating Darkness

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage28.830.00131.51131.5122.900.00002.00008,796,031.918,796,031.910.00%33,442.830.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%131.518817666,887.5926,33589,97466,720.3340,64681,0648,796,0328,796,0320.00%

Action Details: Suffocating Darkness

  • id:449217
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:23720.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:449217
  • name:Suffocating Darkness
  • school:shadow
  • tooltip:The shadows gather, inflicting {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc445341=|cnNORMAL_FONT_COLOR:Nerubian Novelties|R Permanently enchants a weapon with the Authority of the Depths. Damaging foes may invoke it, applying Suffocating Darkness which periodically inflicts {$=}{{$=}<rolemult>*{$=}ec1s1} Shadow damage. The darkness may deepen up to {$449217u=3} times. Cannot be applied to items lower than level {$=}ecim.}
pet - water_elemental 44952 / 26556
Water Jet 12,9480.7%10.828.55s211,34679,181Periodic53.537,55775,14642,83714.0%7.7%

Stats Details: Water Jet

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.840.0053.5053.500.002.66920.43142,291,726.792,291,726.790.00%79,180.6979,180.69
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit85.96%45.99297237,557.0831,76047,22837,547.0235,50441,1531,727,2241,727,2240.00%
crit14.04%7.5102075,145.6164,15492,12575,110.04087,055564,503564,5030.00%

Action Details: Water Jet

  • id:135029
  • school:frost
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.566000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking {$=}w1 damage every {$t1=1} sec.
  • description:Channels a jet of icy water at the target, {$?s198146=false}[slowing the target by {$m2=0}% and ][]dealing {$=}o1 Frost damage to the target over {$d=4 seconds}. Water Jet automatically activates Brain Freeze.

Action Priority List

    default
    [ ]:10.89
Waterbolt 32,0041.8%107.82.64s52,46539,828Direct107.745,90191,84152,53214.4%

Stats Details: Waterbolt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage107.83107.700.000.000.001.31730.00005,657,510.305,657,510.300.00%39,828.1639,828.16
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit85.57%92.156413345,901.1938,88257,32445,900.9143,92648,9344,229,8464,229,8460.00%
crit14.43%15.5433691,840.5877,975113,37691,855.3286,37098,8001,427,6641,427,6640.00%

Action Details: Waterbolt

  • id:31707
  • school:frost
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.687000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals $sw1 Frost damage to the target.

Action Priority List

    default
    [ ]:112.04
Simple Action Stats Execute Interval
Frygg
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Frygg
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Frygg
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Everything Stew 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:455960
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Frygg
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Icy Veins 3.598.74s

Stats Details: Icy Veins

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Icy Veins

  • id:12472
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:Haste increased by {$=}w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=25 seconds}, granting {$m1=20}% haste and preventing damage from delaying your spellcasts. Activating Icy Veins summons a water elemental to your side for its duration. The water elemental's abilities grant you Frigid Empowerment, increasing the Frost damage you deal by {$417488s1=3}%, up to {$=}{{$417488s1=3}*{$417488u=5}}%.

Action Priority List

    cds
    [G]:3.48
Tempered Potion 1.5300.46s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [E]:1.49
  • if_expr:prev_off_gcd.icy_veins|fight_remains<60
arakara_sacbrood 10.920.44s

Stats Details: Spiderfling

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.940.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Spiderfling

  • id:452227
  • school:physical
  • range:100.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:452227
  • name:Spiderfling
  • school:physical
  • tooltip:
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance (Haste)7.02.339.7s29.1s10.5s24.38%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_Ascendance_Haste
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:89.00

Trigger Details

  • interval_min/max:16.0s / 240.0s
  • trigger_min/max:8.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.0s
  • uptime_min/max:0.00% / 52.01%

Stack Uptimes

  • Ascendance_Haste_1:0.69%
  • Ascendance_Haste_2:0.69%
  • Ascendance_Haste_3:0.69%
  • Ascendance_Haste_4:0.68%
  • Ascendance_Haste_5:0.67%
  • Ascendance_Haste_6:0.70%
  • Ascendance_Haste_7:0.67%
  • Ascendance_Haste_8:0.68%
  • Ascendance_Haste_9:0.68%
  • Ascendance_Haste_10:18.23%

Spelldata

  • id:458503
  • name:Ascendance
  • tooltip:Haste increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Ascendance (Vers)7.02.339.7s29.1s10.4s24.28%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_Ascendance_Vers
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:89.00

Trigger Details

  • interval_min/max:16.0s / 264.0s
  • trigger_min/max:8.0s / 264.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.0s
  • uptime_min/max:0.81% / 55.49%

Stack Uptimes

  • Ascendance_Vers_1:0.66%
  • Ascendance_Vers_2:0.70%
  • Ascendance_Vers_3:0.66%
  • Ascendance_Vers_4:0.68%
  • Ascendance_Vers_5:0.67%
  • Ascendance_Vers_6:0.66%
  • Ascendance_Vers_7:0.67%
  • Ascendance_Vers_8:0.66%
  • Ascendance_Vers_9:0.69%
  • Ascendance_Vers_10:18.23%

Spelldata

  • id:458524
  • name:Ascendance
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Ascension (Crit)7.02.339.5s29.0s10.4s24.36%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_Ascension_Crit
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:89.00

Trigger Details

  • interval_min/max:16.0s / 248.0s
  • trigger_min/max:8.0s / 248.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.0s
  • uptime_min/max:2.58% / 56.10%

Stack Uptimes

  • Ascension_Crit_1:0.68%
  • Ascension_Crit_2:0.65%
  • Ascension_Crit_3:0.67%
  • Ascension_Crit_4:0.68%
  • Ascension_Crit_5:0.68%
  • Ascension_Crit_6:0.68%
  • Ascension_Crit_7:0.69%
  • Ascension_Crit_8:0.69%
  • Ascension_Crit_9:0.66%
  • Ascension_Crit_10:18.28%

Spelldata

  • id:458502
  • name:Ascension
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Ascension (Mastery)7.02.239.6s29.1s10.4s24.28%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_Ascension_Mastery
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:89.00

Trigger Details

  • interval_min/max:16.0s / 256.0s
  • trigger_min/max:8.0s / 256.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.0s
  • uptime_min/max:2.98% / 52.80%

Stack Uptimes

  • Ascension_Mastery_1:0.68%
  • Ascension_Mastery_2:0.67%
  • Ascension_Mastery_3:0.68%
  • Ascension_Mastery_4:0.66%
  • Ascension_Mastery_5:0.68%
  • Ascension_Mastery_6:0.67%
  • Ascension_Mastery_7:0.67%
  • Ascension_Mastery_8:0.67%
  • Ascension_Mastery_9:0.67%
  • Ascension_Mastery_10:18.22%

Spelldata

  • id:458525
  • name:Ascension
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bone Chilling1.2761.9149.9s0.4s240.0s99.86%0.00%750.7 (751.4)0.2

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_bone_chilling
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.8s / 354.1s
  • trigger_min/max:0.0s / 12.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 359.8s
  • uptime_min/max:97.94% / 99.94%

Stack Uptimes

  • bone_chilling_1:0.07%
  • bone_chilling_2:0.08%
  • bone_chilling_3:0.14%
  • bone_chilling_4:0.72%
  • bone_chilling_5:0.24%
  • bone_chilling_6:0.22%
  • bone_chilling_7:0.25%
  • bone_chilling_8:0.23%
  • bone_chilling_9:0.22%
  • bone_chilling_10:97.69%

Spelldata

  • id:205766
  • name:Bone Chilling
  • tooltip:Spell damage done increased by {$=}{{$=}W1}.1%.
  • description:{$@spelldesc205027=Whenever you attempt to chill a target, you gain Bone Chilling, increasing spell damage you deal by {$=}{{$m1=5}/10}.1% for {$205766d=8 seconds}, stacking up to {$205766u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Brain Freeze23.71.612.7s12.0s2.3s18.08%65.79%1.6 (1.6)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_brain_freeze
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • brain_freeze_1:18.08%

Spelldata

  • id:190446
  • name:Brain Freeze
  • tooltip:Your next Flurry deals {$s2=50}% increased damage.
  • description:{$@spelldesc190447=Frostbolt has a {$m1=25}% chance to reset the remaining cooldown on Flurry and cause your next Flurry to deal {$190446s2=50}% increased damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Chain Reaction1.9131.4138.1s2.2s159.8s98.87%0.00%124.1 (124.1)0.9

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_chain_reaction
  • max_stacks:5
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 344.4s
  • trigger_min/max:0.8s / 28.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.7s
  • uptime_min/max:91.97% / 99.66%

Stack Uptimes

  • chain_reaction_1:1.57%
  • chain_reaction_2:2.20%
  • chain_reaction_3:1.12%
  • chain_reaction_4:1.21%
  • chain_reaction_5:92.76%

Spelldata

  • id:278310
  • name:Chain Reaction
  • tooltip:Ice Lance damage increased by {$278309s1=2}%.
  • description:{$@spelldesc278309=Your Ice Lances against frozen targets increase the damage of your Ice Lances by {$s1=2}% for {$278310d=10 seconds}, stacking up to {$278310u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Deliberate Incubation1.0120.60.0s2.4s300.0s100.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_deliberate_incubation
  • max_stacks:30
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:159.41

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:1.0s / 44.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • deliberate_incubation_17:0.10%
  • deliberate_incubation_18:1.13%
  • deliberate_incubation_19:7.69%
  • deliberate_incubation_20:11.46%
  • deliberate_incubation_21:20.11%
  • deliberate_incubation_22:18.29%
  • deliberate_incubation_23:13.36%
  • deliberate_incubation_24:8.49%
  • deliberate_incubation_25:5.75%
  • deliberate_incubation_26:4.14%
  • deliberate_incubation_27:3.23%
  • deliberate_incubation_28:2.51%
  • deliberate_incubation_29:1.78%
  • deliberate_incubation_30:1.96%

Spelldata

  • id:449578
  • name:Deliberate Incubation
  • tooltip:{$=}pri increased by {$=}w1, and may be further increased by remaining stationary, up to {$u=30} times.
  • description:{$@spelldesc445066=Carefully balance the Egg's incubation. While stationary, gain {$s1=95} {$=}pri every {$t6=1} sec, up to {$s3=30} times. Diminishes while moving. While moving, gain {$s2=207} of your highest secondary stat every {$t6=1} sec, up to {$s3=30} times. Diminishes while stationary. Additional stacks above {$s5=20} grant {$s4=60}% reduced benefit. }
  • max_stacks:30
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Egg Sac13.90.0134.1s20.2s235.0s92.53%0.00%0.0 (0.0)0.2

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_egg_sac
  • max_stacks:99
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:1241.34

Trigger Details

  • interval_min/max:0.1s / 357.3s
  • trigger_min/max:0.1s / 88.5s
  • trigger_pct:99.99%
  • duration_min/max:0.1s / 358.8s
  • uptime_min/max:68.37% / 99.94%

Stack Uptimes

  • egg_sac_1:19.39%
  • egg_sac_2:27.48%
  • egg_sac_3:22.30%
  • egg_sac_4:13.33%
  • egg_sac_5:6.33%
  • egg_sac_6:2.51%
  • egg_sac_7:0.86%
  • egg_sac_8:0.27%
  • egg_sac_9:0.08%
  • egg_sac_10:0.02%
  • egg_sac_11:0.02%
  • egg_sac_12:0.01%

Spelldata

  • id:452146
  • name:Egg Sac
  • tooltip:Overcome by parental instinct, you gain {$=}w1 {$=}pri to protect your brood.
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}
  • max_stacks:99
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Fingers of Frost51.9118.35.7s1.7s3.3s57.47%83.81%57.7 (57.7)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 72.6s
  • trigger_min/max:0.0s / 49.3s
  • trigger_pct:17.56%
  • duration_min/max:0.0s / 55.8s
  • uptime_min/max:34.68% / 81.32%

Stack Uptimes

  • fingers_of_frost_1:33.01%
  • fingers_of_frost_2:24.46%

Spelldata

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance deals damage as if the target were frozen.
  • description:{$@spelldesc112965=Frostbolt has a {$s1=15}% chance and Frozen Orb damage has a {$s2=10}% to grant a charge of Fingers of Frost. Fingers of Frost causes your next Ice Lance to deal damage as if the target were frozen. Maximum {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6112.3s76.8s35.3s25.10%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 353.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 79.90%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.10%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6112.3s77.2s35.4s24.85%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 344.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 82.02%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.85%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.4s76.3s35.3s25.01%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 356.7s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 80.27%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.01%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.5s76.1s35.6s25.05%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 345.7s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 82.26%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.05%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Freezing Rain8.418.037.0s11.2s22.5s63.37%0.00%18.0 (18.0)7.8

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_freezing_rain
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 162.2s
  • trigger_min/max:0.8s / 62.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 156.3s
  • uptime_min/max:41.87% / 88.01%

Stack Uptimes

  • freezing_rain_1:63.37%

Spelldata

  • id:270232
  • name:Freezing Rain
  • tooltip:Blizzard is instant cast and deals {$s2=60}% increased damage.
  • description:{$@spelldesc270233=Frozen Orb makes Blizzard instant cast and increases its damage done by {$270232s2=60}% for {$270232d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Freezing Winds8.018.438.9s11.2s24.5s65.74%0.00%76.3 (76.3)7.4

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_freezing_winds
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:12.0s / 189.8s
  • trigger_min/max:0.8s / 62.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 174.0s
  • uptime_min/max:42.68% / 90.00%

Stack Uptimes

  • freezing_winds_1:65.74%

Spelldata

  • id:382106
  • name:Freezing Winds
  • tooltip:Gaining Fingers of Frost every {$t1=3} sec.
  • description:{$@spelldesc382103=While Frozen Orb is active, you gain Fingers of Frost every {$382106t1=3} sec.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Frigid Empowerment4.6166.169.8s1.7s37.4s57.92%0.00%147.6 (147.6)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_frigid_empowerment
  • max_stacks:5
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:9.1s / 119.8s
  • trigger_min/max:0.0s / 68.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.8s
  • uptime_min/max:45.74% / 75.12%

Stack Uptimes

  • frigid_empowerment_1:0.29%
  • frigid_empowerment_2:0.96%
  • frigid_empowerment_3:0.94%
  • frigid_empowerment_4:0.91%
  • frigid_empowerment_5:54.81%

Spelldata

  • id:417488
  • name:Frigid Empowerment
  • tooltip:Your elemental is empowering you increasing your Frost damage dealt by {$s1=3}%.
  • description:{$@spelldesc417487=Your water elemental's abilities apply Frigid Empowerment increasing the Frost damage you deal by {$417488s1=3}%, up to {$=}{{$417488s1=3}*{$417488u=5}}%.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Icicles38.0186.88.0s1.3s7.6s96.28%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_icicles
  • max_stacks:5
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.5s / 19.2s
  • trigger_min/max:0.0s / 11.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.2s
  • uptime_min/max:89.67% / 99.95%

Stack Uptimes

  • icicles_1:11.09%
  • icicles_2:13.71%
  • icicles_3:15.90%
  • icicles_4:13.95%
  • icicles_5:41.63%

Spelldata

  • id:205473
  • name:Icicles
  • tooltip:{$=}w1 |4Icicle:Icicles; stored.
  • description:{$@spelldesc76613=Casting Frostbolt{$?a381244=true}[, Ice Lance,][] or Flurry grants you an Icicle. Casting Ice Lance causes all Icicles stored to begin launching at the target, each dealing {$148022s1=0} Frost damage.{$?a379049=true}[ Frostbolt and Flurry have a {$379049s2=30}% chance to generate {$379049s1=2} Icicles.][] Up to {$s2=5} Icicles can be stored. Any excess Icicles gained will be automatically launched. Increases the damage of Frozen Orb, Blizzard,{$?a443739=true}[ Frost Splinters,][] and Comet Storm by {$321684s1=0}%. Increases the damage of Ice Lance, Glacial Spike, and Ray of Frost by {$321684s2=0}%.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Veins4.70.369.7s64.2s38.1s59.11%0.00%0.3 (0.3)4.2

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:20.00%

Trigger Details

  • interval_min/max:8.6s / 120.0s
  • trigger_min/max:0.0s / 109.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 66.4s
  • uptime_min/max:46.28% / 77.16%

Stack Uptimes

  • icy_veins_1:59.11%

Spelldata

  • id:12472
  • name:Icy Veins
  • tooltip:Haste increased by {$=}w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=25 seconds}, granting {$m1=20}% haste and preventing damage from delaying your spellcasts. Activating Icy Veins summons a water elemental to your side for its duration. The water elemental's abilities grant you Frigid Empowerment, increasing the Frost damage you deal by {$417488s1=3}%, up to {$=}{{$417488s1=3}*{$417488u=5}}%.
  • max_stacks:0
  • duration:25.00
  • cooldown:120.00
  • default_chance:0.00%
Incanter's Flow1.00.00.0s0.0s300.0s100.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_incanters_flow
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s
  • uptime_min/max:100.00% / 100.00%

Stack Uptimes

  • incanters_flow_1:20.00%
  • incanters_flow_2:20.00%
  • incanters_flow_3:20.00%
  • incanters_flow_4:20.00%
  • incanters_flow_5:20.00%

Spelldata

  • id:116267
  • name:Incanter's Flow
  • tooltip:Increases spell damage by {$=}w1%.
  • description:{$@spelldesc1463=Magical energy flows through you while in combat, building up to {$=}{{$116267m1=2}*5}% increased damage and then diminishing down to {$116267s1=2}% increased damage, cycling every 10 sec.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Overflowing Energy100.946.33.0s2.0s0.9s31.68%0.00%1.4 (1.4)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_overflowing_energy
  • max_stacks:5
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 39.8s
  • trigger_min/max:0.0s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.2s
  • uptime_min/max:16.66% / 47.04%

Stack Uptimes

  • overflowing_energy_1:21.08%
  • overflowing_energy_2:6.57%
  • overflowing_energy_3:2.28%
  • overflowing_energy_4:0.97%
  • overflowing_energy_5:0.78%

Spelldata

  • id:394195
  • name:Overflowing Energy
  • tooltip:Spell critical strike chance increased by {$=}w1%.
  • description:{$@spelldesc390218=Your spell critical strike damage is increased by {$s1=10}%. When your direct damage spells fail to critically strike a target, your spell critical strike chance is increased by {$394195s1=2}%, up to {$=}{{$394195u=5}*{$394195s1=2}}% for {$394195d=8 seconds}. When your spells critically strike Overflowing Energy is reset.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Permafrost Lances7.319.143.2s11.2s29.1s70.58%0.00%19.1 (19.1)6.6

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_permafrost_lances
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 189.8s
  • trigger_min/max:0.8s / 62.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 174.2s
  • uptime_min/max:48.62% / 92.81%

Stack Uptimes

  • permafrost_lances_1:70.58%

Spelldata

  • id:455122
  • name:Permafrost Lances
  • tooltip:The damage of Ice Lance is increased by {$s1=15}%.
  • description:{$@spelldesc453720=Damage dealt by Fingers of Frost enhanced Ice Lances invoke a Frigid Pulse, dealing {$460623s1=0} Frost damage to nearby targets. Damage reduced beyond {$s1=8} targets.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Reckless Incubation (Haste)3.1115.774.3s2.4s94.5s98.04%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_reckless_incubation_Haste
  • max_stacks:30
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:147.41

Trigger Details

  • interval_min/max:2.0s / 357.9s
  • trigger_min/max:1.0s / 43.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.9s
  • uptime_min/max:81.29% / 100.00%

Stack Uptimes

  • reckless_incubation_Haste_1:1.78%
  • reckless_incubation_Haste_2:2.51%
  • reckless_incubation_Haste_3:3.23%
  • reckless_incubation_Haste_4:4.14%
  • reckless_incubation_Haste_5:5.75%
  • reckless_incubation_Haste_6:8.49%
  • reckless_incubation_Haste_7:13.36%
  • reckless_incubation_Haste_8:18.29%
  • reckless_incubation_Haste_9:20.11%
  • reckless_incubation_Haste_10:11.46%
  • reckless_incubation_Haste_11:7.69%
  • reckless_incubation_Haste_12:1.13%
  • reckless_incubation_Haste_13:0.11%

Spelldata

  • id:449581
  • name:Reckless Incubation
  • tooltip:Haste increased by {$=}w1, and may be further increased by moving, up to {$u=30} times.
  • description:{$@spelldesc445066=Carefully balance the Egg's incubation. While stationary, gain {$s1=95} {$=}pri every {$t6=1} sec, up to {$s3=30} times. Diminishes while moving. While moving, gain {$s2=207} of your highest secondary stat every {$t6=1} sec, up to {$s3=30} times. Diminishes while stationary. Additional stacks above {$s5=20} grant {$s4=60}% reduced benefit. }
  • max_stacks:30
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Spellfrost Teachings9.317.132.8s11.1s18.2s56.45%0.00%17.1 (17.1)8.8

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_spellfrost_teachings
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 158.8s
  • trigger_min/max:0.0s / 91.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 150.9s
  • uptime_min/max:33.02% / 84.09%

Stack Uptimes

  • spellfrost_teachings_1:56.45%

Spelldata

  • id:458411
  • name:Spellfrost Teachings
  • tooltip:{$?=}c1[Arcane Orb][Frozen Orb] damage increased by {$s1=10}%.
  • description:{$@spelldesc444986=Direct damage from {$?=}c1[Arcane][Frost] Splinters has a small chance to {$?=}c1[launch an Arcane Orb at {$s1=50}% effectiveness][reset the cooldown of Frozen Orb] and increase all damage dealt by {$?=}c1[Arcane Orb by {$458411s1=10}][Frozen Orb by {$458411s2=30}]% for {$458411d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Spiderling10.90.020.3s20.3s0.3s0.94%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_spiderling
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 88.5s
  • trigger_min/max:0.5s / 88.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.5s
  • uptime_min/max:0.03% / 3.79%

Stack Uptimes

  • spiderling_1:0.94%
  • spiderling_2:0.01%
  • spiderling_3:0.01%

Spelldata

  • id:452226
  • name:Spiderling
  • tooltip:A new brood is ready to attack!
  • description:Casting a harmful spell or ability launches one of your spiderlings at the enemy inflicting {$443541s2=6209} Nature damage over $12096d.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Suspended Incubation3.00.0120.5s120.5s19.4s19.46%0.00%0.0 (0.0)2.8

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_suspended_incubation
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 122.0s
  • trigger_min/max:120.0s / 122.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:16.46% / 22.95%

Stack Uptimes

  • suspended_incubation_1:19.46%

Spelldata

  • id:445560
  • name:Suspended Incubation
  • tooltip:{$@=}spellname449578 and {$@=}spellname449581 are unaffected by your movements.
  • description:Suspend the Egg's incubation state for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Tempered Potion1.50.0300.4s300.4s27.5s13.37%0.00%0.0 (0.0)1.2

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 301.8s
  • trigger_min/max:300.0s / 301.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.92% / 18.12%

Stack Uptimes

  • tempered_potion_1:13.37%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Time Warp4.50.059.4s59.4s5.9s8.94%0.00%0.0 (0.0)4.4

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_time_warp
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:30.00%

Trigger Details

  • interval_min/max:6.0s / 314.0s
  • trigger_min/max:6.0s / 314.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:0.00% / 19.52%

Stack Uptimes

  • time_warp_1:8.94%

Spelldata

  • id:342242
  • name:Time Warp
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc210805=At any moment, you have a chance to gain Arcane Power for {$s1=8} sec, gain Evocation for {$s2=1} sec, or gain Time Warp for {$342242d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Ascendance (_darkmoon)

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_ascendance_darkmoon
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:8.00

Spelldata

  • id:457594
  • name:Ascendance
  • tooltip:
  • description:{$@spelldesc453575=Gain {$@=}spellname453575 every $457594t seconds spent in combat. {$@=}spellname453575 grants {$458573s2=89} of a random secondary stat for {$457596d=15 seconds}, stacking up to {$457594s1=10} times. This is a Nerubian embellishment.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Everything Stew

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_everything_stew
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:470.00

Spelldata

  • id:454137
  • name:Well Fed
  • tooltip:The benefit of your recent meal adapts to your current needs as it digests. {$?=}{$=}W1>0[Critical strike increased by {$=}w1. ][]{$?=}{$=}W2>0[Versatility increased by {$=}w2. ][]{$?=}{$=}W3>0[Haste increased by {$=}w3. ][]{$?=}{$=}W4>0[Mastery increased by {$=}w4.][]
  • description:Increases your lowest secondary stat by {$s1=176} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Frygg
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Brain Freeze25.314.041.011.9s0.0s73.5s
Brain Freeze from Frostbolt8.71.019.031.2s0.7s286.5s
Brain Freeze from Splinterstorm2.50.012.069.5s2.0s350.0s
Brain Freeze from Time Anomaly3.40.010.067.1s2.0s334.0s
Brain Freeze from Water Jet10.88.016.028.3s20.3s87.8s
Fingers of Frost170.282.0306.01.8s0.0s49.3s
Fingers of Frost from Flash Freeze11.11.028.026.7s0.0s279.7s
Fingers of Frost from Freezing Winds65.337.099.04.5s3.0s52.5s
Fingers of Frost from Frostbolt5.20.017.044.6s0.7s302.9s
Fingers of Frost from Frozen Orb Initial Impact26.411.057.011.2s0.8s62.8s
Fingers of Frost from Frozen Orb Tick62.314.0130.04.6s0.0s104.0s
Fingers of Frost wasted due to Winter's Chill49.525.081.05.9s0.8s95.1s
Flurry cast35.724.052.08.5s2.3s37.3s
Icicles generated224.9170.0285.01.5s0.0s11.9s
Icicles overflowed36.011.071.08.1s0.0s149.5s
Winter's Chill stacks applied214.1144.0312.02.8s0.1s36.7s
Winter's Chill stacks consumed99.464.0143.03.0s0.7s35.2s
Winter's Chill stacks consumed by Frostbolt10.42.022.029.4s3.1s207.0s
Winter's Chill stacks consumed by Glacial Spike18.06.031.016.5s3.9s119.5s
Winter's Chill stacks consumed by Ice Lance71.048.0104.04.2s0.8s36.1s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap33.83%26.53%40.31%0.7s0.0s2.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Frozen Orb0.9230.0004.79524.4276.81652.211
Comet Storm7.0110.00071.52266.75819.768160.498
Shifting Power1.1400.0005.9356.1672.52715.758
Flurry0.4980.00013.16317.8700.64059.409
Icy Veins0.5970.0002.9162.0781.0176.849

Shatter

None Winter's Chill Fingers of Frost Other effects
Ability Count Percent Count Percent Utilization Count Percent Count Percent
(frostbolt_) Icicle1.924.5%5.875.5%16.3%
(flurry_) Icicle4.244.8%5.255.2%14.6%
(ice_lance_) Icicle5.529.4%13.370.6%37.2%
Frostbolt24.270.1%10.429.9%29.0%
Ice Lance0.00.0%71.053.3%198.8%62.246.7%
Thermal Void extension50.255.9%140.5%39.644.1%
Glacial Spike19.151.5%18.048.5%50.3%

Icy Veins

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Frygg
Mana RegenMana2,448.958,429,663.39100.00%3,442.156,559,324.9243.76%
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Mana2,575,000.028,099.7928,167.196,559,088.72,604,782.12,450,200.02,625,000.0
Usage Type Count Total Tot% Avg RPE APR
Frygg
Comet StormMana9.22230,482.392.73%25,000.0024,999.9324.13
FlurryMana35.73893,370.2510.57%25,000.0024,999.4719.93
FrostboltMana34.631,731,527.4920.49%50,000.0051,481.214.13
Frozen OrbMana26.41660,223.987.81%25,000.0025,000.6838.94
Glacial SpikeMana37.07926,745.9810.97%25,000.0024,999.5574.65
Ice LanceMana133.343,333,520.4039.45%25,000.0025,000.5228.90
Shifting PowerMana5.39674,012.277.98%125,000.00124,978.192.70

Statistics & Data Analysis

Fight Length
Frygg Fight Length
Count 9999
Mean 300.00
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Frygg Damage Per Second
Count 9999
Mean 1078039.25
Minimum 869796.84
Maximum 1284105.34
Spread ( max - min ) 414308.50
Range [ ( max - min ) / 2 * 100% ] 19.22%
Standard Deviation 55760.0050
5th Percentile 987116.63
95th Percentile 1170945.64
( 95th Percentile - 5th Percentile ) 183829.01
Mean Distribution
Standard Deviation 557.6279
95.00% Confidence Interval ( 1076946.32 - 1079132.18 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 103
0.1% Error 10278
0.1 Scale Factor Error with Delta=300 26541734
0.05 Scale Factor Error with Delta=300 106166933
0.01 Scale Factor Error with Delta=300 2654173303
Priority Target DPS
Frygg Priority Target Damage Per Second
Count 9999
Mean 1078039.25
Minimum 869796.84
Maximum 1284105.34
Spread ( max - min ) 414308.50
Range [ ( max - min ) / 2 * 100% ] 19.22%
Standard Deviation 55760.0050
5th Percentile 987116.63
95th Percentile 1170945.64
( 95th Percentile - 5th Percentile ) 183829.01
Mean Distribution
Standard Deviation 557.6279
95.00% Confidence Interval ( 1076946.32 - 1079132.18 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 103
0.1% Error 10278
0.1 Scale Factor Error with Delta=300 26541734
0.05 Scale Factor Error with Delta=300 106166933
0.01 Scale Factor Error with Delta=300 2654173303
DPS(e)
Frygg Damage Per Second (Effective)
Count 9999
Mean 1078039.25
Minimum 869796.84
Maximum 1284105.34
Spread ( max - min ) 414308.50
Range [ ( max - min ) / 2 * 100% ] 19.22%
Damage
Frygg Damage
Count 9999
Mean 315284978.56
Minimum 223292707.96
Maximum 442626936.57
Spread ( max - min ) 219334228.61
Range [ ( max - min ) / 2 * 100% ] 34.78%
DTPS
Frygg Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Frygg Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Frygg Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Frygg Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Frygg Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 snapshot_stats
5 0.00 blizzard,if=active_enemies>=2&talent.ice_caller&!talent.fractured_frost|active_enemies>=3
6 0.00 frostbolt,if=active_enemies<=2
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell
7 0.00 call_action_list,name=cds
8 0.00 run_action_list,name=aoe,if=active_enemies>=7|active_enemies>=3&talent.ice_caller
9 0.00 run_action_list,name=ss_cleave,if=active_enemies>=2&active_enemies<=3&talent.splinterstorm
A 0.00 run_action_list,name=cleave,if=active_enemies>=2&active_enemies<=3
B 0.00 run_action_list,name=ss_st,if=talent.splinterstorm
C 0.00 run_action_list,name=st
actions.cds
# count action,conditions
0.00 use_item,name=imperfect_ascendancy_serum,if=buff.icy_veins.remains>19|fight_remains<25
0.00 use_item,name=spymasters_web,if=(buff.icy_veins.remains>19&(fight_remains<100|buff.spymasters_report.stack=40&fight_remains>120))|fight_remains<25
E 1.49 potion,if=prev_off_gcd.icy_veins|fight_remains<60
0.00 use_item,name=dreambinder_loom_of_the_great_cycle,if=(equipped.nymues_unraveling_spindle&prev_gcd.1.nymues_unraveling_spindle)|fight_remains>2
0.00 use_item,name=belorrelos_the_suncaller,if=time>5&!prev_gcd.1.flurry
F 1.00 flurry,if=time=0&active_enemies<=2
G 3.48 icy_veins
H 2.98 use_items
0.00 invoke_external_buff,name=power_infusion,if=buff.power_infusion.down
0.00 invoke_external_buff,name=blessing_of_summer,if=buff.blessing_of_summer.down
0.00 blood_fury
0.00 berserking
0.00 lights_judgment
0.00 fireblood
0.00 ancestral_call
actions.ss_st
# count action,conditions
K 27.43 flurry,if=cooldown_react&remaining_winters_chill=0&debuff.winters_chill.down&(prev_gcd.1.frostbolt|prev_gcd.1.glacial_spike)
L 37.29 ice_lance,if=buff.icy_veins.up&(debuff.winters_chill.stack=2|debuff.winters_chill.stack=1&action.splinterstorm.in_flight)
0.00 ray_of_frost,if=buff.icy_veins.down&buff.freezing_winds.down&remaining_winters_chill=1
M 26.41 frozen_orb
N 5.39 shifting_power
O 33.83 ice_lance,if=remaining_winters_chill
P 9.22 comet_storm,if=prev_gcd.1.flurry|prev_gcd.1.cone_of_cold|action.splinterstorm.in_flight
Q 37.27 glacial_spike,if=buff.icicles.react=5
R 7.31 flurry,if=cooldown_react&buff.icy_veins.up&!action.splinterstorm.in_flight
S 62.21 ice_lance,if=buff.fingers_of_frost.react
T 33.78 frostbolt
U 0.00 call_action_list,name=movement

Sample Sequence

0126FGEHLMNLPMQKLLMMSQKLLMSSMQSSTKLLMQKLLMSSQMSSSSSPQKLMOSSQKLOSQSSSSTQKOOTKLMNLMPMQKMOOSSQKLOSSMQKLOSQSTSTKGLOQPSMSRLOQKLOMSSQSSSSSQSHSTTNRLLMPMQ