SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.1.0.59679 Live (hotfix 2025-03-21/59679, git build 341b466ea1)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-3-21 Frost Death Knight Guardian Damage Buffed by 4%
Frost Death Knight (effect#4) base_value 4.00 0.00
2025-3-21 Frost Death Knight Pet Damage Buffed by 4%
Frost Death Knight (effect#3) base_value 4.00 0.00
2025-3-21 Frost Death Knight Periodic Damage Buffed by 4%
Frost Death Knight (effect#2) base_value 4.00 0.00
2025-3-21 Frost Death Knight Direct Damage Buffed by 4%
Frost Death Knight (effect#1) base_value 4.00 0.00

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Evoker

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Priest

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-03-21 Shadow Priest periodic modifier reduced to 21%
Shadow Priest (effect#2) base_value 21.00 24.00
2025-03-21 Shadow Priest direct modifier reduced to 21%
Shadow Priest (effect#1) base_value 21.00 24.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Raid Summary

Raid Event List
0 heal,name=tank_heal,amount=1500000,cooldown=5.0,duration=0,player_if=role.tank

Additional Raid Information

DPS Scale Factors (dps increase per unit stat)

Profile Str Sta Crit Haste Mastery Vers Wdps wowhead
Deadscrew 14.39 -0.17 14.10 11.09 14.61 14.19 80.05 wowhead

Deadscrew : 1,172,253 dps, 841,966 dtps, 889,547 hps (231,369 aps)

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,172,252.71,172,252.7810.7 / 0.069%160,520.9 / 13.7%90,327.8
HPS HPS(e) HPS Error HPS Range HPR
658,177.6658,177.6727.9 / 0.111%146,538.2 / 22.3%63,471.6
APS APS Error APS Range APR
231,369.0960.3 / 0.415%39,173.0 / 16.9%63,471.6
DTPS DTPS Error DTPS Range
841,966.3897.12 / 0.11%181,541 / 21.6%
Resource Out In Waiting APM Active
Runic Power10.410.51.41%70.8100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/deadscrew
TalentCoPAtbMOTHlnKIwUyAn+DK70SjhxYmZMjZmZYYmZmmhxMzYGzAAAAAwMzMzMzMzsZmZMAAAYmZmBAAAYmllxwYGzWjltlhJbDDbAYwG
Set Bonus
Scale Factors for Deadscrew Damage Per Second
Wdps Mastery Str Vers Crit Haste Sta
Scale Factors 80.05 14.61 14.39 14.19 14.10 11.09 -0.17
Normalized 5.56 1.02 1.00 0.99 0.98 0.77 -0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.53 0.50 0.50 0.50 0.50 0.50 0.49
Ranking
  • Wdps > Mastery ~= Str ~= Vers ~= Crit > Haste > Sta
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=14.39, Stamina=-0.17, CritRating=14.10, HasteRating=11.09, MasteryRating=14.61, Versatility=14.19, Dps=80.05 )

Scale Factors for other metrics

Scale Factors for Deadscrew Priority Target Damage Per Second
Wdps Mastery Str Vers Crit Haste Sta
Scale Factors 80.05 14.61 14.39 14.19 14.10 11.09 -0.17
Normalized 5.56 1.02 1.00 0.99 0.98 0.77 -0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.53 0.50 0.50 0.50 0.50 0.50 0.49
Ranking
  • Wdps > Mastery ~= Str ~= Vers ~= Crit > Haste > Sta
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=14.39, Stamina=-0.17, CritRating=14.10, HasteRating=11.09, MasteryRating=14.61, Versatility=14.19, Dps=80.05 )
Scale Factors for Deadscrew Damage Per Second (Effective)
Wdps Mastery Str Vers Crit Haste Sta
Scale Factors 80.05 14.61 14.39 14.19 14.10 11.09 -0.17
Normalized 5.56 1.02 1.00 0.99 0.98 0.77 -0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Mastery > Str > Vers > Crit > Haste > Sta
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=14.39, Stamina=-0.17, CritRating=14.10, HasteRating=11.09, MasteryRating=14.61, Versatility=14.19, Dps=80.05 )
Scale Factors for Deadscrew Healing Per Second
Mastery Vers Crit Str Haste Sta Wdps
Scale Factors -10.43 -5.04 -4.38 -2.23 -0.46 -0.15 2.62
Normalized 4.67 2.26 1.97 1.00 0.21 0.07 -1.17
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.45 0.45 0.45 0.45 0.44 0.45 0.45
Ranking
  • Mastery > Vers > Crit > Str > Haste ~= Sta > Wdps
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=2.23, Stamina=0.15, CritRating=4.38, HasteRating=0.46, MasteryRating=10.43, Versatility=5.04, Dps=-2.62 )
Scale Factors for Deadscrew Healing Per Second (Effective)
Mastery Vers Crit Str Haste Sta Wdps
Scale Factors -10.43 -5.04 -4.38 -2.23 -0.46 -0.15 2.62
Normalized 4.67 2.26 1.97 1.00 0.21 0.07 -1.17
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Mastery > Vers > Crit > Str > Haste > Sta > Wdps
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=2.23, Stamina=0.15, CritRating=4.38, HasteRating=0.46, MasteryRating=10.43, Versatility=5.04, Dps=-2.62 )
Scale Factors for Deadscrew Absorb Per Second
Crit Str Sta Wdps Haste Vers Mastery
Scale Factors -0.87 -0.66 -0.32 0.13 0.74 1.71 13.77
Normalized 1.32 1.00 0.48 -0.20 -1.12 -2.59 -20.79
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.57 0.55 0.60 0.57 0.57 0.58 0.62
Ranking
  • Crit ~= Str ~= Sta ~= Wdps > Haste > Vers > Mastery
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=0.66, Stamina=0.32, CritRating=0.87, HasteRating=-0.74, MasteryRating=-13.77, Versatility=-1.71, Dps=-0.13 )
Scale Factors for Healing + Absorb per second
Crit Vers Str Sta Haste Wdps Mastery
Scale Factors -5.26 -3.33 -2.89 -0.47 0.28 2.75 3.34
Normalized 1.82 1.15 1.00 0.16 -0.10 -0.95 -1.15
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.72 0.73 0.71 0.75 0.72 0.73 0.76
Ranking
  • Crit > Vers ~= Str > Sta > Haste > Wdps ~= Mastery
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=2.89, Stamina=0.47, CritRating=5.26, HasteRating=-0.28, MasteryRating=-3.34, Versatility=3.33, Dps=-2.75 )
Scale Factors for Deadscrew Damage Taken Per Second
Mastery Vers Crit Str Haste Wdps Sta
Scale Factors -13.90 -9.22 -6.95 -3.79 -2.49 -0.82 -0.53
Normalized 3.66 2.43 1.83 1.00 0.66 0.22 0.14
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.55 0.55 0.56 0.55 0.55 0.55 0.55
Ranking
  • Mastery > Vers > Crit > Str > Haste > Wdps ~= Sta
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=3.79, Stamina=0.53, CritRating=6.95, HasteRating=2.49, MasteryRating=13.90, Versatility=9.22, Dps=0.82 )
Scale Factors for Deadscrew Damage Taken
Mastery Vers Crit Str Haste Wdps Sta
Scale Factors -4173.98 -2766.23 -2086.39 -1130.72 -730.53 -237.24 -164.17
Normalized 3.69 2.45 1.85 1.00 0.65 0.21 0.15
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Mastery > Vers > Crit > Str > Haste > Wdps > Sta
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=1130.72, Stamina=164.17, CritRating=2086.39, HasteRating=730.53, MasteryRating=4173.98, Versatility=2766.23, Dps=237.24 )
Scale Factors for Deadscrew Healing Taken Per Second
Mastery Vers Crit Str Haste Wdps Sta
Scale Factors -13.82 -8.98 -6.82 -3.65 -2.43 -0.64 -0.46
Normalized 3.79 2.46 1.87 1.00 0.66 0.18 0.13
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Mastery > Vers > Crit > Str > Haste > Wdps > Sta
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=3.65, Stamina=0.46, CritRating=6.82, HasteRating=2.43, MasteryRating=13.82, Versatility=8.98, Dps=0.64 )
Scale Factors for Deadscrew Fight Length
Haste Wdps Str Crit Sta Vers Mastery
Scale Factors 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Normalized 1.67 1.34 1.00 0.66 0.34 0.33 0.33
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Haste > Wdps > Str > Crit > Sta > Vers > Mastery
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=0.00, Stamina=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=0.00, Versatility=0.00, Dps=0.00 )
Scale Factors for Raid Damage Per Second
Wdps Mastery Str Vers Crit Haste Sta
Scale Factors 80.05 14.61 14.39 14.19 14.10 11.09 -0.17
Normalized 5.56 1.02 1.00 0.99 0.98 0.77 -0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.53 0.50 0.50 0.50 0.50 0.50 0.49
Ranking
  • Wdps > Mastery ~= Str ~= Vers ~= Crit > Haste > Sta
Pawn string ( Pawn: v1: "Deadscrew-Blood": Class=Deathknight, Spec=Blood, Strength=14.39, Stamina=-0.17, CritRating=14.10, HasteRating=11.09, MasteryRating=14.61, Versatility=14.19, Dps=80.05 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Deadscrew1,172,253
Abomination Limb 12,8771.1%3.0120.41s1,285,0381,447,245Periodic38.185,806171,396100,53717.2%11.7%

Stats Details: Abomination Limb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.980.0038.0938.090.000.88790.92183,829,410.713,829,410.710.00%101,427.911,447,245.17
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.79%31.53153985,805.5566,225113,41985,800.7775,85199,6522,705,9002,705,9000.00%
crit17.21%6.56016171,395.74139,073226,838171,252.780226,8381,123,5111,123,5110.00%

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:12.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}.

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}.}

Action Priority List

    sanlayn
    [I]:2.98

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%DISABLED
Brittle37455716.0%DISABLED
auto_attack_mh 49,0894.2%208.91.72s70,49440,789Direct208.960,708121,53670,49316.1%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage208.86208.860.000.000.001.72830.000014,723,450.7921,033,480.0930.00%40,788.8040,788.80
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.91%175.2611822960,707.5749,01485,59360,695.5656,50664,42210,639,82715,199,73830.00%
crit16.09%33.601263121,535.9998,029171,187121,550.65109,092135,1624,083,6245,833,74230.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Boil 32,2212.8%42.36.81s228,512251,575Direct42.3197,545394,344228,50915.7%

Stats Details: Blood Boil

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage42.3442.340.000.000.000.90830.00009,674,076.089,674,076.080.00%251,575.29251,575.29
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit84.27%35.671951197,544.74148,172286,185197,522.02181,319213,9387,047,1437,047,1430.00%
crit15.73%6.66019394,344.14296,344572,370393,768.290511,2462,626,9332,626,9330.00%

Action Details: Blood Boil

  • id:50842
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:50842
  • name:Blood Boil
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage$?s212744[ to all enemies within {$=}A1 yds.][ and infects all enemies within {$=}A1 yds with Blood Plague. {$@=}spellicon55078 |cFFFFFFFF{$@=}spellname55078|r {$@spelldesc55078=A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}. }]

Action Priority List

    sanlayn
    [B]:7.09
  • if_expr:!dot.blood_plague.ticking|(dot.blood_plague.remains<10&buff.dancing_rune_weapon.up)
    sanlayn
    [T]:35.25
  • if_expr:charges>=2|(full_recharge_time<=gcd.max)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown Duration (Category)Death Knight1370053SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
Brittle37455716.0%
Blood Draw 3,1380.3%2.2126.56s420,1450Direct2.2360,776720,802420,09816.5%

Stats Details: Blood Draw

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.242.240.000.000.000.00000.0000940,503.78940,503.780.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.51%1.8703360,775.92293,816526,659351,186.360479,235674,517674,5170.00%
crit16.49%0.3703720,801.64587,6321,009,935236,788.1101,009,935265,987265,9870.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies, the damage you take is reduced by {$454871s1=10}% and your Death Strike cost is reduced by {$=}{{$454871s2=100}/-10} for {$454871d=8 seconds}. Can only occur every {$374609d=120 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
Brittle37455716.0%
Blood Plague 34,4422.9%43.47.10s238,1980Periodic118.675,369149,32887,17516.0%95.7%

Stats Details: Blood Plague

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage43.410.00118.61118.6136.320.00002.421710,339,431.2510,339,431.250.00%35,997.670.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit84.04%99.686913275,368.8228,424110,98175,334.6869,68380,6297,512,5877,512,5870.00%
crit15.96%18.93439149,328.2256,848221,963149,238.03123,342168,0272,826,8442,826,8440.00%

Action Details: Blood Plague

  • id:55078
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.097042
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:2.23
  • base_multiplier:1.00
  • dot_duration:24.00
  • base_tick_time:2.55
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining {$=}w1 health from the target every {$t1=3} sec.
  • description:A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%
Spell Periodic AmountBlood Death Knight13700815PCT15.0%
Spell Tick TimeRapid Decomposition1946621PCT-15.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Coagulopathy391481125.0%Spell Data
Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Percent Tick Time Consumption2741565-30.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
Brittle37455716.0%
Bonestorm 17,9811.5%5.460.41s999,8101,110,780Periodic53.086,602173,232101,71517.4%17.7%

Stats Details: Bonestorm

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.390.0053.0053.000.000.90031.00005,390,613.145,390,613.140.00%93,180.981,110,779.55
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.56%43.75256086,602.2366,761119,61186,564.4176,96298,0973,789,0693,789,0690.00%
crit17.44%9.25021173,232.23133,068239,223173,149.680204,2661,601,5441,601,5440.00%

Action Details: Bonestorm

  • id:194844
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:2.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:194844
  • name:Bonestorm
  • school:shadow
  • tooltip:Dealing {$196528s1=0} Shadow damage to nearby enemies every {$t3=1} sec, and healing for {$196545s1=2}% of maximum health for each target hit (up to {$=}{{$s1=2}*{$s4=5}}%).
  • description:Consume up to {$s4=5} Bone Shield charges to create a whirl of bone and gore that batters all nearby enemies, dealing {$196528s1=0} Shadow damage every {$t3=1} sec, and healing you for {$196545s1=2}% of your maximum health every time it deals damage (up to {$=}{{$s1=2}*{$s4=5}}%). Deals reduced damage beyond {$196528s2=8} targets. Lasts {$d=2 seconds} per Bone Shield charge spent and rapidly regenerates a Bone Shield every {$t3=1} sec.

Action Details: Bonestorm Damage

  • id:196528
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196528
  • name:Bonestorm
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194844=Consume up to {$s4=5} Bone Shield charges to create a whirl of bone and gore that batters all nearby enemies, dealing {$196528s1=0} Shadow damage every {$t3=1} sec, and healing you for {$196545s1=2}% of your maximum health every time it deals damage (up to {$=}{{$s1=2}*{$s4=5}}%). Deals reduced damage beyond {$196528s2=8} targets. Lasts {$d=2 seconds} per Bone Shield charge spent and rapidly regenerates a Bone Shield every {$t3=1} sec.}

Action Priority List

    sanlayn
    [D]:5.39
  • if_expr:(buff.death_and_decay.up)&buff.bone_shield.stack>5&cooldown.dancing_rune_weapon.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%DISABLED
Brittle37455716.0%DISABLED
Consumption 5,5950.5%8.237.27s205,322238,255Direct8.2177,236354,883205,32415.8%

Stats Details: Consumption

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage8.188.180.000.000.000.86190.00001,679,699.612,399,568.4730.00%238,255.26238,255.26
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit84.19%6.89111177,236.49130,831281,917177,211.99140,940223,5021,220,7481,743,92330.00%
crit15.81%1.2906354,883.04261,662563,833266,313.970533,487458,952655,64522.53%

Action Details: Consumption

  • id:274156
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:274156
  • name:Consumption
  • school:physical
  • tooltip:Your Blood Plague deals damage {$=}w5% more often.
  • description:Strikes all enemies in front of you with a hungering attack that deals $sw1 Physical damage and heals you for {$=}{{$=}e1*100}% of that damage. Deals reduced damage beyond {$s3=8} targets. Causes your Blood Plague damage to occur {$s5=30}% more quickly for {$d=6 seconds}. |cFFFFFFFFGenerates {$s4=2} Runes.|r

Action Priority List

    sanlayn
    [C]:4.62
  • if_expr:pet.dancing_rune_weapon.active&pet.dancing_rune_weapon.remains<=3
    sanlayn
    [U]:3.56
  • if_expr:cooldown.dancing_rune_weapon.remains>20

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
Brittle37455716.0%
Dancing Rune Weapon 0 (185,961)0.0% (15.9%)6.449.91s8,772,1509,585,887

Stats Details: Dancing Rune Weapon

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.350.000.000.000.000.91510.00000.000.000.00%9,585,886.759,585,886.75

Action Details: Dancing Rune Weapon

  • id:49028
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:49028
  • name:Dancing Rune Weapon
  • school:physical
  • tooltip:
  • description:Summons a rune weapon for {$81256d=8 seconds} that mirrors your melee attacks and bolsters your defenses. While active, you gain {$81256s1=35}% parry chance.

Action Priority List

    sanlayn
    [K]:6.30
  • if_expr:buff.coagulopathy.remains>=2*gcd&(!buff.essence_of_the_blood_queen.up|buff.essence_of_the_blood_queen.remains>=3*gcd)&(!buff.dancing_rune_weapon.up|buff.dancing_rune_weapon.remains>=6*gcd)
    sanlayn
    [R]:0.05
  • if_expr:buff.coagulopathy.up
    auto_attack_mh 39,303 / 11,4551.0%87.23.60s39,33120,765Direct87.233,69267,35439,33116.7%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage87.2287.220.000.000.001.89410.00003,430,423.154,900,599.6030.00%20,764.5220,764.52
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.25%72.61459433,692.4528,33443,20333,676.2231,39036,1692,446,5423,495,05630.00%
crit16.75%14.6123067,354.3658,70786,40767,349.8661,07273,983983,8821,405,54430.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Blood Plague 26,950 / 7,8410.7%5.272.91s452,6240Periodic50.939,78379,72146,06215.7%37.4%

Stats Details: Blood Plague

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.180.0050.9250.920.590.00002.20232,345,552.782,345,552.780.00%20,915.920.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit84.27%42.91014239,783.322362,37137,991.35052,4351,707,1621,707,1620.00%
crit15.73%8.0103379,720.52401124,74275,506.660112,196638,391638,3910.00%

Action Details: Blood Plague

  • id:55078
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.097042
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:2.23
  • base_multiplier:1.00
  • dot_duration:24.00
  • base_tick_time:2.55
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining {$=}w1 health from the target every {$t1=3} sec.
  • description:A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%
Spell Periodic AmountBlood Death Knight13700815PCT15.0%
Spell Tick TimeRapid Decomposition1946621PCT-15.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Percent Tick Time Consumption2741565-30.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
    Blood Boil 7,486 / 2,1800.2%5.273.01s126,2770Direct5.2109,459219,022126,28215.4%

Stats Details: Blood Boil

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.185.180.000.000.000.00000.0000654,307.67654,307.670.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit84.65%4.39016109,458.5888,579152,697104,003.310151,705480,096480,0960.00%
crit15.35%0.8006219,022.04177,157304,379115,666.940302,513174,211174,2110.00%

Action Details: Blood Boil

  • id:50842
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:50842
  • name:Blood Boil
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage$?s212744[ to all enemies within {$=}A1 yds.][ and infects all enemies within {$=}A1 yds with Blood Plague. {$@=}spellicon55078 |cFFFFFFFF{$@=}spellname55078|r {$@spelldesc55078=A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}. }]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown Duration (Category)Death Knight1370053SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
    Death's Caress 0 / 00.0%0.00.00s47,9520Direct0.036,21771,42247,95233.3%

Stats Details: Deaths Caress

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.000028.7728.770.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.67%0.000236,217.2334,70836,72310.82036,72314140.00%
crit33.33%0.000171,422.1269,41673,42914.29073,42914140.00%

Action Details: Deaths Caress

  • id:195292
  • school:shadow
  • range:30.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:195292
  • name:Death's Caress
  • school:shadow
  • tooltip:
  • description:Reach out with necrotic tendrils, dealing {$s1=0} Shadow damage and applying Blood Plague to your target and generating {$s3=2} Bone Shield charges. {$@=}spellicon55078 |cFFFFFFFF{$@=}spellname55078|r {$@spelldesc55078=A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}. }

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
    Death Strike 261,898 / 76,3386.5%51.010.96s449,0540Direct51.0385,474767,836449,07816.6%

Stats Details: Death Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage51.0251.020.000.000.000.00000.000022,909,699.2232,728,109.0230.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.37%42.532461385,473.69144,500669,103385,283.65322,261436,18216,395,98623,422,81330.00%
crit16.63%8.48022767,835.80289,0011,308,212767,610.2901,038,7226,513,7139,305,29629.99%

Action Details: Death Strike

  • id:49998
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:45
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49998
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of {$=}{{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$=}{{$s2=25}}.2% of all damage taken in the last {$s4=5} sec, minimum {$=}{{$s3=7}}.1% of maximum health.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%
Spell Direct AmountBlood Death Knight1370083PCT139.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Heartrend377656220.0%Spell Data
Hemostasis27394718.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Essence of the Blood Queen43392525.0%Spell DataValue-function
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Flat Cost Ossuary2197881-5Spell Data
Damage on Debuff Blood Plague5507845.0%
    Consumption 13,639 / 3,9750.3%10.353.60s114,7420Direct10.397,901194,957114,73817.4%

Stats Details: Consumption

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.3210.320.000.000.000.00000.00001,183,704.981,691,005.4230.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.65%8.5321497,901.4676,753138,92797,873.9185,070115,464834,7601,192,51330.00%
crit17.35%1.7908194,956.53153,507277,021166,602.450266,165348,945498,49225.64%

Action Details: Consumption

  • id:274156
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rune
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:274156
  • name:Consumption
  • school:physical
  • tooltip:Your Blood Plague deals damage {$=}w5% more often.
  • description:Strikes all enemies in front of you with a hungering attack that deals $sw1 Physical damage and heals you for {$=}{{$=}e1*100}% of that damage. Deals reduced damage beyond {$s3=8} targets. Causes your Blood Plague damage to occur {$s5=30}% more quickly for {$d=6 seconds}. |cFFFFFFFFGenerates {$s4=2} Runes.|r

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
    Vampiric Strike 288,808 / 84,1747.2%127.54.42s197,6770Direct127.5169,499338,364197,67616.7%

Stats Details: Vampiric Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage127.48127.480.000.000.000.00000.000025,199,043.1225,199,043.120.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.31%106.2167137169,499.36134,428244,085169,399.64153,921189,97018,001,93318,001,9330.00%
crit16.69%21.27446338,364.38268,857488,170338,349.43303,677386,3007,197,1107,197,1100.00%

Action Details: Vampiric Strike

  • id:433895
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:10
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:433895
  • name:Vampiric Strike
  • school:shadow
  • tooltip:
  • description:A vampiric strike that deals {$?a137007=false}[{$s1=0}][{$s5=0}] Shadow damage and heals you for {$?a137007=false}[{$434422s2=1}][{$434422s3=2}]% of your maximum health. Additionally grants you Essence of the Blood Queen for {$433925d=20 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%
Spell TargetsBlood Death Knight13700816ADD1.000
Spell Direct AmountImproved Heart Strike3747171PCT30.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
Death and Decay 14,1421.2%20.315.14s209,379225,218Periodic219.316,70133,34119,35015.9%0.0%

Stats Details: Death And Decay

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage20.270.000.00219.300.000.92970.00004,243,562.534,243,562.530.00%225,218.26225,218.26
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit84.08%184.3912923716,701.5013,20123,60416,696.8915,49517,9413,079,6193,079,6190.00%
crit15.92%34.91116033,341.3826,40147,20933,339.0329,77036,6261,163,9441,163,9440.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    sanlayn
    [G]:20.27
  • if_expr:!buff.death_and_decay.up

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time% (Category)Blood Death Knight1370085SET-0.500
Spell Tick TimeRapid Decomposition1946621PCT-15.0%
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%
Spell Direct AmountBlood Death Knight13700814PCT48.2%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Percent Cost Crimson Scourge811411-100.0%Spell Data
Damage on Debuff Blood Plague5507845.0%DISABLED
Brittle37455716.0%DISABLED
Death Strike 411,29335.1%90.53.29s1,363,9671,542,395Direct90.51,178,6532,332,7121,363,94116.1%

Stats Details: Death Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage90.4990.490.000.000.000.88430.0000123,420,925.02176,315,430.8630.00%1,542,395.241,542,395.24
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.94%75.96511011,178,652.99396,3153,490,0101,178,139.921,049,2041,299,97989,530,769127,900,97030.00%
crit16.06%14.533312,332,711.65792,6906,867,7842,330,429.711,484,2133,791,86233,890,15648,414,46030.00%

Action Details: Death Strike

  • id:49998
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:45
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49998
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of {$=}{{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$=}{{$s2=25}}.2% of all damage taken in the last {$s4=5} sec, minimum {$=}{{$s3=7}}.1% of maximum health.

Action Priority List

    sanlayn
    [9]:1.03
  • if_expr:buff.coagulopathy.remains<=gcd
    sanlayn
    [E]:8.19
  • if_expr:runic_power>=108
    sanlayn
    [L]:0.01
  • if_expr:!buff.vampiric_strike.up&cooldown.dancing_rune_weapon.remains<=10&(target.health.pct<variable.death_strike_sang_low_hp&runic_power>variable.death_strike_pre_essence_dump_amount_low_hp)&buff.essence_of_the_blood_queen.stack>=3
    sanlayn
    [M]:5.91
  • if_expr:!buff.vampiric_strike.up&cooldown.dancing_rune_weapon.remains<=10&(target.health.pct>variable.death_strike_sang_low_hp&runic_power>variable.death_strike_pre_essence_dump_amount)&buff.essence_of_the_blood_queen.stack>=3
    sanlayn
    [O]:8.19
  • if_expr:buff.dancing_rune_weapon.up&(buff.coagulopathy.remains<2*gcd|(target.health.pct<variable.death_strike_sang_low_hp&runic_power>50))
    sanlayn
    [P]:2.15
  • if_expr:buff.dancing_rune_weapon.up&(buff.coagulopathy.remains<2*gcd|(runic_power.deficit<=variable.heart_strike_rp_drw&debuff.incite_terror.stack>=3))
    sanlayn
    [S]:65.00
  • if_expr:runic_power.deficit<=variable.heart_strike_rp_drw|runic_power>=variable.death_strike_dump_amount

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%
Spell Direct AmountBlood Death Knight1370083PCT139.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Heartrend377656220.0%Spell Data
Hemostasis27394718.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Essence of the Blood Queen43392525.0%Spell DataValue-function
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Flat Cost Blood Draw4548712-10Spell Data
Ossuary2197881-5Spell Data
Damage on Debuff Blood Plague5507845.0%
Brittle37455716.0%
Death's Caress 1880.0%0.182.03s774,822751,862Direct1.145,32790,41951,90514.6%

Stats Details: Deaths Caress

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.071.070.000.000.001.03790.000055,637.7855,637.780.00%751,861.93751,861.93
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit85.41%0.920345,327.3443,51872,67238,786.25071,43741,49441,4940.00%
crit14.59%0.160290,419.0387,037135,36914,003.510135,36914,14414,1440.00%

Action Details: Deaths Caress

  • id:195292
  • school:shadow
  • range:30.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:195292
  • name:Death's Caress
  • school:shadow
  • tooltip:
  • description:Reach out with necrotic tendrils, dealing {$s1=0} Shadow damage and applying Blood Plague to your target and generating {$s3=2} Bone Shield charges. {$@=}spellicon55078 |cFFFFFFFF{$@=}spellname55078|r {$@spelldesc55078=A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}. }

Action Priority List

    sanlayn
    [A]:0.07
  • if_expr:!buff.bone_shield.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
Brittle37455716.0%
Heart Strike 35,349 (348,006)3.0% (29.7%)144.02.05s724,413829,359Direct55.8 (404.8)164,584328,593190,28215.7% (15.9%)

Stats Details: Heart Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage143.9655.800.000.000.000.87350.000010,618,982.4215,169,959.7230.00%829,359.13829,359.13
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit84.33%47.062573164,583.95123,314278,251164,523.50147,748183,5877,745,12811,064,45730.00%
crit15.67%8.75022328,592.77246,628556,503328,475.750435,6872,873,8554,105,50329.99%

Action Details: Heart Strike

  • id:206930
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:15.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:206930
  • name:Heart Strike
  • school:physical
  • tooltip:Movement speed reduced by {$s5=20}%.
  • description:Instantly strike the target and 1 other nearby enemy, causing {$s2=0} Physical damage, and reducing enemies' movement speed by {$s5=20}% for {$d=8 seconds}{$?s316575=true}[ |cFFFFFFFFGenerates {$s3=5} bonus Runic Power][]{$?s221536=true}[, plus {$=}{{$210738s1=20}/10} Runic Power per additional enemy struck][].|r

Action Priority List

    sanlayn
    [F]:36.41
  • if_expr:buff.dancing_rune_weapon.up&rune>1
    sanlayn
    [H]:6.46
  • if_expr:buff.infliction_of_sorrow.up&buff.death_and_decay.up
    sanlayn
    [Q]:51.38
  • if_expr:buff.vampiric_strike.up|buff.infliction_of_sorrow.up&((talent.consumption.enabled&buff.consumption.up)|!talent.consumption.enabled)&dot.blood_plague.ticking&dot.blood_plague.remains>20
    sanlayn
    [V]:49.70
  • if_expr:rune>1

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%
Spell Direct AmountImproved Heart Strike3747171PCT30.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
Brittle37455716.0%
    Vampiric Strike 118,552 (312,657)10.1% (26.6%)88.23.32s1,062,5200Direct88.2 (349.0)346,097689,720402,89416.5% (16.0%)

Stats Details: Vampiric Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage88.1688.160.000.000.000.00000.000035,516,816.8435,516,816.840.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.47%73.5944101346,096.57242,890499,467345,895.15320,490380,10425,468,43825,468,4380.00%
crit16.53%14.57331689,719.55527,056998,934689,547.33613,814785,86010,048,37910,048,3790.00%

Action Details: Vampiric Strike

  • id:433895
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:15.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:433895
  • name:Vampiric Strike
  • school:shadow
  • tooltip:
  • description:A vampiric strike that deals {$?a137007=false}[{$s1=0}][{$s5=0}] Shadow damage and heals you for {$?a137007=false}[{$434422s2=1}][{$434422s3=2}]% of your maximum health. Additionally grants you Essence of the Blood Queen for {$433925d=20 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%
Spell TargetsBlood Death Knight13700816ADD1.000
Spell Direct AmountImproved Heart Strike3747171PCT30.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
Brittle37455716.0%
Incite Terror45847843.0%
        Infliction of Sorrow 125,72910.7%94.33.10s399,3880Direct94.3345,287674,979399,37416.4%

Stats Details: Infliction Of Sorrow

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage94.2694.260.000.000.000.00000.000037,644,728.0937,644,728.090.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.59%78.7948111345,286.9058,3973,911,431345,504.62206,831440,13227,206,74727,206,7470.00%
crit16.41%15.46231674,979.42154,3467,822,058675,293.75237,2512,463,75210,437,98110,437,9810.00%

Action Details: Infliction Of Sorrow

  • id:434144
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:148845.33
  • base_dd_max:148845.33
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:434144
  • name:Infliction of Sorrow
  • school:shadow
  • tooltip:
  • description:{$@spelldesc434143=When Vampiric Strike damages an enemy affected by your {$?a137008=true}[Blood Plague][Virulent Plague], it extends the duration of the disease by {$s3=3} sec, and deals {$s2=10}% of the remaining damage to the enemy. After Gift of the San'layn ends, your next {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] consumes the disease to deal {$s1=100}% of their remaining damage to the target.}
        The Blood is Life 49,2294.2%8.331.52s1,774,7680Direct8.31,774,80301,774,8030.0%

Stats Details: The Blood Is Life

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage8.328.320.000.000.000.00000.000014,765,236.5214,765,236.520.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%8.322201,774,802.61165,2006,305,6211,795,401.77838,8593,364,35414,765,23714,765,2370.00%

Action Details: The Blood Is Life

  • id:434246
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1787439.27
  • base_dd_max:1787439.27
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:434246
  • name:The Blood is Life
  • school:shadow
  • tooltip:
  • description:{$@spelldesc434260=Vampiric Strike has a chance to summon a Blood Beast to attack your enemy for {$434237d=10 seconds}. Each time the Blood Beast attacks, it stores a portion of the damage dealt. When the Blood Beast dies, it explodes, dealing {$?a137007=false}[{$s2=25}][{$s1=50}]% of the damage accumulated to nearby enemies and healing the Death Knight for the same amount. Deals reduced damage beyond {$s3=8} targets.}
        auto_attack_mh 32,288 / 8,0410.7%128.11.95s18,81333,626Direct128.116,17632,37718,81216.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage128.11128.110.000.000.000.55950.00002,410,023.463,442,887.2230.00%33,626.2033,626.20
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.73%107.262624616,176.4413,51421,47116,163.0314,47817,7591,735,1682,478,80930.00%
crit16.27%20.8405332,377.3027,29642,94132,351.63036,525674,855964,07830.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
        Corrupted Blood 44,600 / 11,1050.9%30.28.50s110,264108,994Direct30.294,989190,032110,26416.1%

Stats Details: Corrupted Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage30.2030.200.000.000.001.01170.00003,330,318.233,330,318.230.00%108,994.21108,994.21
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.93%25.3566094,989.4179,540126,37094,938.8585,460105,7542,407,9562,407,9560.00%
crit16.07%4.85018190,031.66162,230243,395187,787.420228,720922,362922,3620.00%

Action Details: Corrupted Blood

  • id:434574
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:434574
  • name:Corrupted Blood
  • school:shadow
  • tooltip:
  • description:Blood Beast cleaves enemies around it for {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:30.32
Marrowrend 6,2760.5%8.537.17s222,648251,195Direct8.5191,600381,063222,64216.4%

Stats Details: Marrowrend

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage8.458.450.000.000.000.88640.00001,881,449.612,687,782.4730.00%251,194.87251,194.87
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.61%7.07214191,600.26106,420418,586192,322.87117,352323,9371,353,8101,934,01330.00%
crit16.39%1.38010381,063.38213,565837,172295,334.980834,852527,639753,76923.24%

Action Details: Marrowrend

  • id:195182
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:195182
  • name:Marrowrend
  • school:physical
  • tooltip:
  • description:Smash the target, dealing {$s2=0} Physical damage and generating {$s3=3} charges of Bone Shield. {$@=}spellicon195181 |cFFFFFFFF{$@=}spellname195181|r {$@spelldesc195181=Surrounds you with a barrier of whirling bones, increasing Armor by {$=}{{$s1=100}*{$=}STR/100}{$?s316746=true}[, and your Haste by {$s4=0}%][]. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.}

Action Priority List

    sanlayn
    [N]:8.45
  • if_expr:!dot.bonestorm.ticking&(buff.bone_shield.stack<variable.bone_shield_refresh_value&runic_power.deficit>20|buff.bone_shield.remains<=3)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Ossified Vitriol458745115.0%Spell Data
Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
Brittle37455716.0%
Raise Dead 0 (30,286)0.0% (2.6%)3.0120.27s3,027,5000

Stats Details: Raise Dead

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    default
    [6]:3.00
    auto_attack_mh 37,350 / 20,5201.7%143.71.97s42,79138,220Direct143.736,81973,66942,79116.2%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage143.65143.650.000.000.001.11960.00006,146,971.148,781,378.5630.00%38,220.3038,220.30
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.80%120.377815036,819.3130,27948,75236,826.6634,55139,1914,432,1576,331,64630.00%
crit16.20%23.2874673,669.3060,76897,31273,711.8968,17480,2931,714,8152,449,73330.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Claw 17,756 / 9,7530.8%76.13.77s38,36038,360Direct76.132,99365,95938,36016.3%

Stats Details: Claw

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage76.1276.120.000.000.001.00000.00002,919,945.934,171,347.1630.00%38,360.2838,360.28
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.72%63.73398032,993.1727,25143,96332,997.1231,03935,3402,102,6243,003,74630.00%
crit16.28%12.3922865,958.8254,68787,75365,991.4857,42474,064817,3221,167,60230.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:76.13
  • if_expr:energy>70
    Gnaw 23 / 130.0%3.0120.24s1,2691,269Direct3.01,0942,1671,26916.3%

Stats Details: Gnaw

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.972.970.000.000.001.00000.00003,773.155,390.2130.00%1,269.141,269.14
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.74%2.49031,094.459671,4061,088.8001,3542,7253,89329.83%
crit16.26%0.48032,167.141,9342,708884.4102,7081,0481,49712.25%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.97
Seabed Leviathan's Citrine 3290.0%5.435.97s18,2840Direct5.415,62231,37918,28416.9%

Stats Details: Seabed Leviathans Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.385.380.000.000.000.00000.000098,413.8598,413.850.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.11%4.4701415,622.3314,51217,22215,578.08017,22269,88569,8850.00%
crit16.89%0.910631,379.1029,02334,44519,009.77034,44528,52928,5290.00%

Action Details: Seabed Leviathans Citrine

  • id:468990
  • school:frost
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:12950.13
  • base_dd_max:12950.13
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:468990
  • name:Seabed Leviathan's Citrine
  • school:frost
  • tooltip:
  • description:{$@spelldesc462527=Grants {$?a462527=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=435}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=435}/100)*({$462342s5=5663}/3)}] Stamina and increases your size slightly. In addition, being above {$s6=80}% health causes attackers to take {$?a462342=false}[{$=}{{$462342=}w1*({$s5=82}/100)}][{$=}{{$462342s3=10779}*({$s5=82}/100)}] Frost damage.}
Shattering Bone 20,4301.7%43.06.86s142,2810Direct43.0122,101246,385142,28616.2%

Stats Details: Shattering Bone

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage43.0343.030.000.000.000.00000.00006,122,814.416,122,814.410.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.76%36.052051122,101.0716,215457,649122,174.3481,736165,9304,401,0104,401,0100.00%
crit16.24%6.99017246,384.5332,430915,297247,067.360794,2751,721,8051,721,8050.00%

Action Details: Shattering Bone

  • id:377642
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377642
  • name:Shattering Bone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc377640=When Bone Shield is consumed it shatters dealing {$s3=0} Shadow damage to nearby enemies. This damage is tripled while you are within your Death and Decay.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
Brittle37455716.0%
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Deadscrew 889547
Blood Plague (_heal) 44,9705.1%118.62.52s113,8340Direct118.698,838193,303113,82415.9%

Stats Details: Blood Plague Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal118.61118.610.000.000.000.00000.000013,501,457.1620,846,624.9135.23%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit84.14%99.796713398,837.790453,04898,796.8968,938126,6239,863,74415,133,37434.80%
crit15.86%18.82438193,302.810857,605193,256.4845,647410,9273,637,7135,713,25036.24%

Action Details: Blood Plague Heal

  • id:55078
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:118617.02
  • base_dd_max:118617.02
  • base_dd_mult:1.94
  • base_multiplier:1.00

Spelldata

  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining {$=}w1 health from the target every {$t1=3} sec.
  • description:A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%
Spell Periodic AmountBlood Death Knight13700815PCT15.0%
Spell Tick TimeRapid Decomposition1946621PCT-15.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Coagulopathy391481125.0%Spell Data
Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Percent Tick Time Consumption2741565-30.0%Spell Data
Blood Shield 212,65323.9%90.53.29s705,0690Direct189.1337,3760337,3760.0%

Stats Details: Blood Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb90.49189.100.000.000.000.00000.000063,799,401.1672,883,378.2012.46%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%189.10145237337,375.5603,949,123337,290.21280,636401,41263,799,40172,883,37812.25%

Action Details: Blood Shield

  • id:77535
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:446707.28
  • base_dd_max:446707.28
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:77535
  • name:Blood Shield
  • school:shadow
  • tooltip:Absorbs {$=}w1 Physical damage{$?a391398=true} [ and Physical damage increased by {$s2=0}%][].
  • description:When you deal damage with Death Strike while in Blood Presence, you gain a percentage of your health gained as a physical absorption shield.
Bonestorm (_heal) 51,8705.8%53.05.24s293,4420Direct53.0293,4480293,4480.0%

Stats Details: Bonestorm Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal53.0053.000.000.000.000.00000.000015,551,606.5917,209,687.449.63%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%53.004060293,448.430437,245293,254.64177,165378,15315,551,60717,209,6879.58%

Action Details: Bonestorm Heal

  • id:196545
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196545
  • name:Bonestorm
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194844=Consume up to {$s4=5} Bone Shield charges to create a whirl of bone and gore that batters all nearby enemies, dealing {$196528s1=0} Shadow damage every {$t3=1} sec, and healing you for {$196545s1=2}% of your maximum health every time it deals damage (up to {$=}{{$s1=2}*{$s4=5}}%). Deals reduced damage beyond {$196528s2=8} targets. Lasts {$d=2 seconds} per Bone Shield charge spent and rapidly regenerates a Bone Shield every {$t3=1} sec.}
Consumption (_heal) 5,1790.6%8.237.27s190,7310Direct8.2190,7110190,7110.0%

Stats Details: Consumption Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal8.188.180.000.000.000.00000.00001,560,336.872,828,437.5344.83%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%8.18611190,710.5501,045,220189,782.1832,725411,1671,560,3372,828,43844.70%

Action Details: Consumption Heal

  • id:274156
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:154169.20
  • base_dd_max:154169.20
  • base_dd_mult:1.94
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:274156
  • name:Consumption
  • school:physical
  • tooltip:Your Blood Plague deals damage {$=}w5% more often.
  • description:Strikes all enemies in front of you with a hungering attack that deals $sw1 Physical damage and heals you for {$=}{{$=}e1*100}% of that damage. Deals reduced damage beyond {$s3=8} targets. Causes your Blood Plague damage to occur {$s5=30}% more quickly for {$d=6 seconds}. |cFFFFFFFFGenerates {$s4=2} Runes.|r

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT94.0%
Spell Periodic AmountBlood Death Knight1370082PCT94.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Death Strike (_heal) 356,67740.1%90.53.29s1,182,8790Direct90.51,182,78401,182,7840.0%

Stats Details: Death Strike Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal90.4990.490.000.000.000.00000.0000107,034,878.70167,305,015.3136.02%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%90.49711111,182,783.53011,047,7731,182,110.91827,3901,502,962107,034,879167,305,01536.11%

Action Details: Death Strike Heal

  • id:45470
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:45470
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc49998=Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of {$=}{{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$=}{{$s2=25}}.2% of all damage taken in the last {$s4=5} sec, minimum {$=}{{$s3=7}}.1% of maximum health.}

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Hemostasis27394718.0%Spell Data
Frost Shield 17,5692.0%208.91.72s25,2330Direct343.015,365015,3650.0%

Stats Details: Frost Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb208.86343.010.000.000.000.00000.00005,270,214.068,449,252.5437.63%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%343.0125643115,364.660125,53315,359.4612,73118,0115,270,2148,449,25337.56%

Action Details: Frost Shield

  • id:207203
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:22443.67
  • base_dd_max:22443.67
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:207203
  • name:Frost Shield
  • school:frost
  • tooltip:Absorbs {$=}w1 damage.
  • description:{$@spelldesc207200=Your auto attack damage grants you an absorb shield equal to {$s1=40}% of the damage dealt.}
Leech 123,84413.9%342.90.87s108,4020Direct342.9108,3890108,3890.0%

Stats Details: Leech

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal342.91342.910.000.000.000.00000.000037,171,959.5561,067,308.3839.13%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%342.91270417108,388.7302,249,638108,293.8576,921137,17537,171,96061,067,30839.14%

Action Details: Leech

  • id:143924
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:143924
  • name:Leech
  • school:physical
  • tooltip:
  • description:Health leeched.
Rune of Sanguination 28,2913.1%1.0305.67s8,135,3460Periodic8.21,020,93001,020,9300.0%2.7%

Stats Details: Rune Of Sanguination

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal1.031.038.238.230.000.00001.00008,399,771.5312,548,546.6333.06%1,020,752.400.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%1.03120.00000.0000000.00%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%8.238161,020,930.3502,959,1771,025,397.91214,9331,993,3758,399,77212,548,54730.29%

Action Details: Rune Of Sanguination

  • id:326808
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.20
  • base_multiplier:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:326808
  • name:Rune of Sanguination
  • school:physical
  • tooltip:Healing for {$s1=6}% of your maximum health every $t sec.
  • description:{$@spelldesc326801=Your Death Strike deals increased damage based on the target's missing health. When you fall below {$s1=35}% Health, you heal for {$=}{{$326808s1=6}*{$326808d=8 seconds}}% of your maximum health over {$326808d=8 seconds}. Can only occur once every {$326808s1=6} minutes.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Effect 1Unholy Bond3742611PCT20.0%
Vampiric Strike (_heal) 47,3475.3%88.23.32s161,0240Direct88.2109,757419,470161,00416.5%

Stats Details: Vampiric Strike Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal88.1688.160.000.000.000.00000.000014,195,133.7921,430,421.2233.76%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit83.45%73.5743101109,756.810218,622109,696.4457,825152,0848,075,59511,943,89232.46%
crit16.55%14.59233419,469.800874,489420,103.030790,5206,119,5399,486,52935.40%

Action Details: Vampiric Strike Heal

  • id:434422
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:434422
  • name:Vampiric Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc433895=A vampiric strike that deals {$?a137007=false}[{$s1=0}][{$s5=0}] Shadow damage and heals you for {$?a137007=false}[{$434422s2=1}][{$434422s3=2}]% of your maximum health. Additionally grants you Essence of the Blood Queen for {$433925d=20 seconds}.}
Simple Action Stats Execute Interval
Deadscrew
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Beast (_summon) 8.531.58s

Stats Details: Blood Beast Summon

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage8.540.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Blood Beast Summon

  • id:434237
  • school:physical
  • range:50000.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:434237
  • name:Blood Beast
  • school:physical
  • tooltip:
  • description:Raises a Blood Beast to fight by your side. You can have a maximum of one Blood Beast at a time. Lasts {$d=10 seconds}.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Beledar's Bounty 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:454149
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Funhouse Lens 3.790.46s

Stats Details: Funhouse Lens

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.740.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Funhouse Lens

  • id:1214603
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1214603
  • name:Funhouse Lens
  • school:physical
  • tooltip:
  • description:
Tempered Potion 1.4303.91s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.430.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [4]:1.43
  • if_expr:buff.dancing_rune_weapon.up
Tombstone 4.766.61s

Stats Details: Tombstone

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.720.000.000.000.000.90080.00000.000.000.00%0.000.00

Action Details: Tombstone

  • id:219809
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:219809
  • name:Tombstone
  • school:shadow
  • tooltip:Absorbing {$=}w1 damage.
  • description:Consume up to {$s5=5} Bone Shield charges. For each charge consumed, you gain {$s3=6} Runic Power and absorb damage equal to {$s4=6}% of your maximum health for {$d=8 seconds}.

Action Priority List

    sanlayn
    [J]:4.66
  • if_expr:(!buff.dancing_rune_weapon.up&buff.death_and_decay.up)&buff.bone_shield.stack>5&runic_power.deficit>=30&cooldown.dancing_rune_weapon.remains>=25&buff.coagulopathy.remains>2*gcd
    sanlayn
    [W]:0.07
  • if_expr:buff.death_and_decay.up&buff.bone_shield.stack>5&runic_power.deficit>=30&cooldown.dancing_rune_weapon.remains
Vampiric Blood 11.427.72s

Stats Details: Vampiric Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage11.380.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vampiric Blood

  • id:55233
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55233
  • name:Vampiric Blood
  • school:physical
  • tooltip:Maximum health increased by {$s4=30}%. Healing and absorbs received increased by {$s1=30}%.
  • description:Embrace your undeath, increasing your maximum health by {$s4=30}% and increasing all healing and absorbs received by {$s1=30}% for {$d=10 seconds}.

Action Priority List

    default
    [5]:11.38
  • if_expr:!buff.vampiric_blood.up

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blood Draw2.20.0126.7s126.7s7.9s5.92%0.00%0.0 (0.0)2.2

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_blood_draw
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:119.8s / 260.0s
  • trigger_min/max:119.8s / 260.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:2.24% / 9.33%

Stack Uptimes

  • blood_draw_1:5.92%

Spelldata

  • id:454871
  • name:Blood Draw
  • tooltip:Damage taken reduced by {$=}w1% and Death Strike cost reduced by {$=}{{$s2=100}/-10}.
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies, the damage you take is reduced by {$454871s1=10}% and your Death Strike cost is reduced by {$=}{{$454871s2=100}/-10} for {$454871d=8 seconds}. Can only occur every {$374609d=120 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Shield74.316.24.0s3.3s1.5s37.72%57.19%16.2 (16.2)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_blood_shield
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:physical
  • high priority:no

Trigger Details

  • interval_min/max:0.8s / 33.6s
  • trigger_min/max:0.8s / 12.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 31.9s
  • uptime_min/max:26.65% / 49.02%

Stack Uptimes

  • blood_shield_1:37.72%

Spelldata

  • id:77535
  • name:Blood Shield
  • tooltip:Absorbs {$=}w1 Physical damage{$?a391398=true} [ and Physical damage increased by {$s2=0}%][].
  • description:When you deal damage with Death Strike while in Blood Presence, you gain a percentage of your health gained as a physical absorption shield.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked Ground39.90.07.6s7.6s7.0s92.41%91.69%0.0 (0.0)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_bloodsoaked_ground
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 15.3s
  • trigger_min/max:4.0s / 15.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:87.22% / 95.24%

Stack Uptimes

  • bloodsoaked_ground_1:92.41%

Spelldata

  • id:434034
  • name:Blood-Soaked Ground
  • tooltip:Physical damage taken reduced by {$s1=5}%. Chance to gain Vampiric Strike increased by {$434033s2=5}%.
  • description:{$@spelldesc391458=You deal {$391459s1=6}% more damage and receive {$391459s2=5}% more healing while standing in your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Bone Shield1.167.8168.1s4.3s279.3s99.99%100.00%13.7 (19.0)0.1

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_bone_shield
  • max_stacks:12
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.7s / 350.0s
  • trigger_min/max:0.0s / 33.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 360.0s
  • uptime_min/max:98.60% / 100.00%

Stack Uptimes

  • bone_shield_1:0.08%
  • bone_shield_2:1.06%
  • bone_shield_3:0.58%
  • bone_shield_4:1.01%
  • bone_shield_5:2.40%
  • bone_shield_6:3.13%
  • bone_shield_7:12.98%
  • bone_shield_8:8.27%
  • bone_shield_9:14.97%
  • bone_shield_10:10.69%
  • bone_shield_11:18.60%
  • bone_shield_12:26.22%

Spelldata

  • id:195181
  • name:Bone Shield
  • tooltip:Armor increased by {$=}{{$=}w1*{$=}STR/100}. {$?a374715=true}[Haste increased by {$=}w4%.][]
  • description:Surrounds you with a barrier of whirling bones, increasing Armor by {$=}{{$s1=100}*{$=}STR/100}{$?s316746=true}[, and your Haste by {$s4=0}%][]. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Coagulopathy1.089.50.0s3.3s296.9s98.95%98.17%85.5 (85.5)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_coagulopathy
  • max_stacks:5
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.8s / 12.0s
  • trigger_pct:100.00%
  • duration_min/max:236.8s / 356.9s
  • uptime_min/max:98.66% / 99.16%

Stack Uptimes

  • coagulopathy_1:2.07%
  • coagulopathy_2:0.81%
  • coagulopathy_3:0.48%
  • coagulopathy_4:0.89%
  • coagulopathy_5:94.71%

Spelldata

  • id:391481
  • name:Coagulopathy
  • tooltip:Blood Plague damage is increased by {$s1=25}%.
  • description:{$@spelldesc391477=Enemies affected by Blood Plague take {$s1=5}% increased damage from you and Death Strike increases the damage of your Blood Plague by {$391481s1=25}% for {$391481d=12 seconds}, stacking up to {$391481u=5} times.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391477
  • name:Coagulopathy
  • tooltip:
  • description:Enemies affected by Blood Plague take {$s1=5}% increased damage from you and Death Strike increases the damage of your Blood Plague by {$391481s1=25}% for {$391481d=12 seconds}, stacking up to {$391481u=5} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Combat Analysis1.058.50.0s5.0s295.0s98.31%0.00%50.5 (50.5)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_combat_analysis
  • max_stacks:10
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:strength
  • amount:153.16

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:5.0s / 5.0s
  • trigger_pct:100.00%
  • duration_min/max:235.0s / 355.0s
  • uptime_min/max:97.92% / 98.61%

Stack Uptimes

  • combat_analysis_1:1.69%
  • combat_analysis_3:1.69%
  • combat_analysis_4:1.69%
  • combat_analysis_5:1.69%
  • combat_analysis_6:1.69%
  • combat_analysis_7:1.69%
  • combat_analysis_8:1.69%
  • combat_analysis_9:1.69%
  • combat_analysis_10:84.79%

Spelldata

  • id:312923
  • name:Combat Analysis
  • tooltip:
  • description:You gather and analyze combat data every {$t1=5} sec, increasing your primary stat by {$s1=153}, stacking up to {$s3=10} times. The data decays while out of combat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Consumption8.20.037.2s37.2s5.9s16.16%0.00%0.0 (0.0)8.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_consumption
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:30.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.0s / 61.1s
  • trigger_min/max:30.0s / 61.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:13.37% / 19.21%

Stack Uptimes

  • consumption_1:16.16%

Spelldata

  • id:274156
  • name:Consumption
  • tooltip:Your Blood Plague deals damage {$=}w5% more often.
  • description:Strikes all enemies in front of you with a hungering attack that deals $sw1 Physical damage and heals you for {$=}{{$=}e1*100}% of that damage. Deals reduced damage beyond {$s3=8} targets. Causes your Blood Plague damage to occur {$s5=30}% more quickly for {$d=6 seconds}. |cFFFFFFFFGenerates {$s4=2} Runes.|r
  • max_stacks:0
  • duration:6.00
  • cooldown:30.00
  • default_chance:0.00%
Crimson Scourge12.64.823.0s16.3s2.6s10.99%61.67%4.8 (4.8)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_crimson_scourge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:25.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 174.0s
  • trigger_min/max:0.0s / 174.0s
  • trigger_pct:25.04%
  • duration_min/max:0.0s / 9.8s
  • uptime_min/max:2.97% / 20.29%

Stack Uptimes

  • crimson_scourge_1:10.99%

Spelldata

  • id:81141
  • name:Crimson Scourge
  • tooltip:Your next Death and Decay costs no Runes and generates no Runic Power.
  • description:{$@spelldesc81136=Your auto attacks on targets infected with your Blood Plague have a chance to make your next Death and Decay cost no runes and reset its cooldown.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:81136
  • name:Crimson Scourge
  • tooltip:
  • description:Your auto attacks on targets infected with your Blood Plague have a chance to make your next Death and Decay cost no runes and reset its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:25.00%
Dancing Rune Weapon6.46.449.9s22.8s13.7s29.15%19.93%6.4 (6.4)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_dancing_rune_weapon
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.5s / 70.7s
  • trigger_min/max:0.0s / 70.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s
  • uptime_min/max:24.94% / 32.32%

Stack Uptimes

  • dancing_rune_weapon_1:29.15%

Spelldata

  • id:81256
  • name:Dancing Rune Weapon
  • tooltip:Parry chance increased by {$s1=35}%.
  • description:{$@spelldesc49028=Summons a rune weapon for {$81256d=8 seconds} that mirrors your melee attacks and bolsters your defenses. While active, you gain {$81256s1=35}% parry chance.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Decay39.90.07.6s7.6s7.0s92.41%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_death_and_decay
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 15.3s
  • trigger_min/max:4.0s / 15.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:87.22% / 95.24%

Stack Uptimes

  • death_and_decay_1:92.41%

Spelldata

  • id:188290
  • name:Death and Decay
  • tooltip:{$?s206930=true}[Heart Strike will hit up to {$=}{{$m3=0}+2} targets.]?s207311[Clawing Shadows will hit {$=}{{$55090s4=8}-1} enemies near the target.]?s55090[Scourge Strike will hit {$=}{{$55090s4=8}-1} enemies near the target.][Dealing Shadow damage to enemies inside Death and Decay.]
  • description:{$@spelldesc43265=Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$316916=}M2 additional {$=}Ltarget:targets;.]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Essence of the Blood Queen1.486.7160.0s3.3s203.0s97.39%98.27%78.2 (78.2)0.5

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_essence_of_the_blood_queen
  • max_stacks:7
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:27.5s / 353.3s
  • trigger_min/max:0.8s / 53.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.6s
  • uptime_min/max:86.72% / 98.53%

Stack Uptimes

  • essence_of_the_blood_queen_1:0.84%
  • essence_of_the_blood_queen_2:0.59%
  • essence_of_the_blood_queen_3:0.49%
  • essence_of_the_blood_queen_4:0.47%
  • essence_of_the_blood_queen_5:0.72%
  • essence_of_the_blood_queen_6:0.51%
  • essence_of_the_blood_queen_7:93.77%

Spelldata

  • id:433925
  • name:Essence of the Blood Queen
  • tooltip:Haste increased by {$=}{{$=}W1}.1%. {$?a434075=true}[Damage of Death Strike and Death Coil increased by {$=}W2%.][]
  • description:Essence of the Blood Queen empowers you, {$?a434075=true}[increasing your Haste by {$=}{{$s1=10}/10}.1% up to {$=}{{$s1=10}/10*{$u=5}}.1%, and increases the damage of your Death Coil and Death Strike by {$s2=0}% up to {$=}{{$s2=0}*{$=}U}%][increasing your Haste by {$=}{{$s1=10}/10}.1% up to {$=}{{$s1=10}*{$=}U/10}.1%] for {$d=20 seconds}.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6111.3s76.3s35.3s25.03%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 350.8s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 86.98%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.03%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6111.8s76.9s35.2s24.94%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 340.2s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 82.42%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.94%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.3s77.0s35.2s25.04%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.2s / 351.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 82.89%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.04%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.9s77.3s35.1s24.99%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 353.3s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 85.51%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.99%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Frost Shield131.977.02.3s1.4s1.3s58.35%100.00%77.0 (77.0)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_frost_shield
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 32.2s
  • trigger_min/max:0.0s / 2.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.6s
  • uptime_min/max:46.57% / 68.98%

Stack Uptimes

  • frost_shield_1:58.35%

Spelldata

  • id:207203
  • name:Frost Shield
  • tooltip:Absorbs {$=}w1 damage.
  • description:{$@spelldesc207200=Your auto attack damage grants you an absorb shield equal to {$s1=40}% of the damage dealt.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Funhouse Lens (Crit)1.90.0120.4s106.5s14.8s9.13%0.00%0.0 (0.0)1.8

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_funhouse_lens_crit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:7944.67

Trigger Details

  • interval_min/max:90.0s / 272.6s
  • trigger_min/max:90.0s / 181.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:0.00% / 20.96%

Stack Uptimes

  • funhouse_lens_crit_1:9.13%

Spelldata

  • id:1213433
  • name:Funhouse Lens
  • tooltip:Critical Strike increased by {$1214603=}w1.
  • description:
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Funhouse Lens (Haste)1.90.0120.7s106.8s14.7s9.27%0.00%0.0 (0.0)1.8

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_funhouse_lens_haste
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:7944.67

Trigger Details

  • interval_min/max:90.0s / 272.6s
  • trigger_min/max:90.0s / 181.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:0.00% / 20.96%

Stack Uptimes

  • funhouse_lens_haste_1:9.27%

Spelldata

  • id:1213434
  • name:Funhouse Lens
  • tooltip:Haste increased by {$1214603=}w2.
  • description:
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Gift of the San'layn6.46.449.9s22.8s13.7s29.15%0.00%6.4 (6.4)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_gift_of_the_sanlayn
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.5s / 70.7s
  • trigger_min/max:0.0s / 70.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s
  • uptime_min/max:24.94% / 32.32%

Stack Uptimes

  • gift_of_the_sanlayn_1:29.15%

Spelldata

  • id:434153
  • name:Gift of the San'layn
  • tooltip:The effectiveness of Essence of the Blood Queen is increased by {$?a137007=false}[{$=}w1][{$=}w4]%. {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] has been replaced with Vampiric Strike.
  • description:{$@spelldesc434152=While {$?a137008=true}[Dancing Rune Weapon][Dark Transformation] is active you gain Gift of the San'layn. Gift of the San'layn increases the effectiveness of your Essence of the Blood Queen by {$?a137007=false}[{$434153s1=100}][{$434153s4=200}]%, and Vampiric Strike replaces your {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] for the duration. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Heartrend13.31.121.2s19.5s2.1s9.39%14.59%1.1 (1.1)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_heartrend
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:10.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 233.0s
  • trigger_min/max:0.8s / 233.0s
  • trigger_pct:9.98%
  • duration_min/max:0.0s / 10.3s
  • uptime_min/max:0.79% / 21.67%

Stack Uptimes

  • heartrend_1:9.39%

Spelldata

  • id:377656
  • name:Heartrend
  • tooltip:Your next Death Strike deals an additional {$s2=0}% damage.
  • description:{$@spelldesc377655=Heart Strike has a chance to increase the damage of your next Death Strike by {$s1=20}%.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hemostasis40.51.87.5s6.8s2.7s36.75%44.28%0.0 (0.0)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_hemostasis
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.5s / 30.7s
  • trigger_min/max:1.6s / 29.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:25.57% / 47.73%

Stack Uptimes

  • hemostasis_1:35.84%
  • hemostasis_2:0.91%
  • hemostasis_3:0.00%

Spelldata

  • id:273947
  • name:Hemostasis
  • tooltip:Damage and healing done by your next Death Strike increased by {$s1=8}%.
  • description:{$@spelldesc273946=Each enemy hit by Blood Boil increases the damage and healing done by your next Death Strike by {$273947s1=8}%, stacking up to {$273947u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:273946
  • name:Hemostasis
  • tooltip:
  • description:Each enemy hit by Blood Boil increases the damage and healing done by your next Death Strike by {$273947s1=8}%, stacking up to {$273947u=5} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Icebound Fortitude7.60.635.6s32.4s4.2s10.76%9.19%25.5 (25.5)7.5

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_icebound_fortitude
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:4.0s / 140.0s
  • trigger_min/max:0.0s / 140.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:2.94% / 24.72%

Stack Uptimes

  • icebound_fortitude_1:10.76%

Spelldata

  • id:48792
  • name:Icebound Fortitude
  • tooltip:Damage taken reduced by {$=}w3%. Immune to Stun effects.
  • description:Your blood freezes, granting immunity to Stun effects and reducing all damage you take by {$s3=30}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:100.00%
Icy Talons1.0125.892.3s2.3s290.8s98.95%0.00%123.7 (123.7)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:50.1s / 266.3s
  • trigger_min/max:0.5s / 11.8s
  • trigger_pct:100.00%
  • duration_min/max:2.5s / 356.9s
  • uptime_min/max:98.27% / 99.16%

Stack Uptimes

  • icy_talons_1:0.87%
  • icy_talons_2:0.35%
  • icy_talons_3:97.74%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased by {$=}w1%{$?a436687=false}[, and Runic Power spending abilities deal Shadowfrost damage.][.]
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=6}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=6}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Infliction of Sorrow6.40.049.6s49.6s1.0s2.06%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_infliction_of_sorrow
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:29.9s / 70.7s
  • trigger_min/max:29.9s / 70.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.3s
  • uptime_min/max:0.68% / 8.38%

Stack Uptimes

  • infliction_of_sorrow_1:2.06%

Spelldata

  • id:460049
  • name:Infliction of Sorrow
  • tooltip:{$?a137007=false}[Scourge Strike][Heart Strike] consumes your {$?a137007=false}[Virulent Plague][Blood Plague] to deal {$=}w1% of their remaining damage to the target.
  • description:{$@spelldesc434143=When Vampiric Strike damages an enemy affected by your {$?a137008=true}[Blood Plague][Virulent Plague], it extends the duration of the disease by {$s3=3} sec, and deals {$s2=10}% of the remaining damage to the enemy. After Gift of the San'layn ends, your next {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] consumes the disease to deal {$s1=100}% of their remaining damage to the target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Luck of the Draw!6.61.742.1s32.4s11.1s24.26%23.99%1.7 (1.7)6.3

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_luck_of_the_draw
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 144.9s
  • trigger_min/max:0.0s / 140.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.0s
  • uptime_min/max:7.36% / 51.07%

Stack Uptimes

  • luck_of_the_draw_1:24.26%

Spelldata

  • id:1218601
  • name:Luck of the Draw!
  • tooltip:Damage increased by {$s1=15}%.{$?a1215993=false}[ Death Strike costs {$=}{-{$=}S5/10} less Runic Power and strikes {$m4=2} additional nearby {$=}Ltarget:targets;.][]
  • description:{$@spelldesc1215992=Each time you take damage you have a chance to cast Icebound Fortitude for {$=}{{$s1=4000}/1000} sec and gain |cFFFFFFFFLuck of the Draw!|r which increases your damage dealt by {$1218601s1=15}% for {$1218601d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Ossified Vitriol12.530.624.6s6.9s13.7s56.70%57.03%27.1 (34.4)7.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_ossified_vitriol
  • max_stacks:5
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 65.1s
  • trigger_min/max:0.0s / 45.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.2s
  • uptime_min/max:43.30% / 66.31%

Stack Uptimes

  • ossified_vitriol_1:10.07%
  • ossified_vitriol_2:3.81%
  • ossified_vitriol_3:0.78%
  • ossified_vitriol_4:0.28%
  • ossified_vitriol_5:41.76%

Spelldata

  • id:458745
  • name:Ossified Vitriol
  • tooltip:Marrowrend damage is increased by {$s1=15}%.
  • description:{$@spelldesc458744=When you lose a Bone Shield charge the damage of your next Marrowrend is increased by 15%, stacking up to 75%.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Ossuary5.050.968.0s5.2s58.7s97.26%91.01%50.9 (50.9)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_ossuary
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 308.6s
  • trigger_min/max:0.0s / 52.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 305.3s
  • uptime_min/max:88.39% / 99.24%

Stack Uptimes

  • ossuary_1:97.26%

Spelldata

  • id:219788
  • name:Ossuary
  • tooltip:Death Strike cost reduced by {$=}{{$m1=-50}/-10} Runic Power.
  • description:{$@spelldesc219786=While you have at least {$s1=5} Bone Shield charges, the cost of Death Strike is reduced by {$=}{{$219788m1=-50}/-10} Runic Power. Additionally, your maximum Runic Power is increased by {$=}{{$m2=100}/10}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Perseverance of the Ebon Blade12.50.022.8s22.8s5.9s24.77%0.00%0.0 (0.0)12.3

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_perseverance_of_the_ebon_blade
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.0s / 176.0s
  • trigger_min/max:14.0s / 176.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:8.90% / 39.05%

Stack Uptimes

  • perseverance_of_the_ebon_blade_1:24.77%

Spelldata

  • id:374748
  • name:Perseverance of the Ebon Blade
  • tooltip:Versatility increased by {$=}w1%
  • description:{$@spelldesc374747=When Crimson Scourge is consumed, you gain {$374748s1=6}% Versatility for {$374748d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Rune Mastery13.412.722.3s11.2s11.5s51.56%0.00%12.7 (12.7)12.9

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 143.5s
  • trigger_min/max:0.8s / 131.4s
  • trigger_pct:15.02%
  • duration_min/max:0.0s / 86.9s
  • uptime_min/max:21.04% / 79.17%

Stack Uptimes

  • rune_mastery_1:51.56%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Sanguine Ground39.90.07.6s7.6s7.0s92.41%93.21%0.0 (0.0)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_sanguine_ground
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 15.3s
  • trigger_min/max:4.0s / 15.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:87.22% / 95.24%

Stack Uptimes

  • sanguine_ground_1:92.41%

Spelldata

  • id:391459
  • name:Sanguine Ground
  • tooltip:Damage dealt increased by {$s1=6}%. Healing received increased by {$s2=5}%.
  • description:{$@spelldesc391458=You deal {$391459s1=6}% more damage and receive {$391459s2=5}% more healing while standing in your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Tempered Potion1.40.0304.0s304.0s27.4s12.80%0.00%0.0 (0.0)1.2

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 320.2s
  • trigger_min/max:300.0s / 320.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.36% / 17.78%

Stack Uptimes

  • tempered_potion_1:12.80%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Tombstone4.70.066.6s66.6s5.9s9.23%100.00%0.0 (0.0)2.5

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_tombstone
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:60.0s / 110.8s
  • trigger_min/max:60.0s / 110.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:1.65% / 13.23%

Stack Uptimes

  • tombstone_1:9.23%

Spelldata

  • id:219809
  • name:Tombstone
  • tooltip:Absorbing {$=}w1 damage.
  • description:Consume up to {$s5=5} Bone Shield charges. For each charge consumed, you gain {$s3=6} Runic Power and absorb damage equal to {$s4=6}% of your maximum health for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Unholy Ground39.90.07.6s7.6s7.0s92.41%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_unholy_ground
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 15.3s
  • trigger_min/max:4.0s / 15.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:87.22% / 95.24%

Stack Uptimes

  • unholy_ground_1:92.41%

Spelldata

  • id:374271
  • name:Unholy Ground
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc374265=Gain {$374271s1=5}% Haste while you remain within your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Vampiric Blood11.40.027.5s27.7s9.8s37.35%36.60%0.0 (0.0)11.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_vampiric_blood
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:18.0s / 36.8s
  • trigger_min/max:18.0s / 36.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:34.81% / 40.51%

Stack Uptimes

  • vampiric_blood_1:37.35%

Spelldata

  • id:55233
  • name:Vampiric Blood
  • tooltip:Maximum health increased by {$s4=30}%. Healing and absorbs received increased by {$s1=30}%.
  • description:Embrace your undeath, increasing your maximum health by {$s4=30}% and increasing all healing and absorbs received by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Vampiric Strike30.91.49.7s9.2s3.8s38.81%0.00%1.4 (1.4)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_vampiric_strike
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 65.6s
  • trigger_min/max:0.8s / 65.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.2s
  • uptime_min/max:31.45% / 46.79%

Stack Uptimes

  • vampiric_strike_1:38.81%

Spelldata

  • id:433899
  • name:Vampiric Strike
  • tooltip:
  • description:{$@spelldesc433901=Your Death Coil{$?a137007=false}[, Epidemic][] and Death Strike have a {$s1=25}% chance to make your next {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] become Vampiric Strike. Vampiric Strike heals you for {$?a137008=true}[{$434422s2=1}][{$434422s3=2}]% of your maximum health and grants you Essence of the Blood Queen, increasing your Haste by {$=}{{$433925s1=10}/10}.1%, up to {$=}{{$433925s1=10}*{$433925u=5}/10}.1% for {$433925d=20 seconds}. }
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Visceral Strength12.50.022.8s22.8s11.8s49.03%0.00%0.0 (0.0)12.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_visceral_strength
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:12.00%

Trigger Details

  • interval_min/max:14.0s / 176.0s
  • trigger_min/max:14.0s / 176.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s
  • uptime_min/max:16.20% / 76.82%

Stack Uptimes

  • visceral_strength_1:49.03%

Spelldata

  • id:461130
  • name:Visceral Strength
  • tooltip:Your Strength is increased by {$=}w1%.
  • description:{$@spelldesc434157=When {$?a137008=true}[Crimson Scourge][Sudden Doom] is consumed, you gain {$?a137008=true}[{$461130s1=12}][{$434159s1=8}]% Strength for {$?a137008=true}[{$461130d=12 seconds}][{$434159d=5 seconds}].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Voracious3.087.589.0s3.3s97.3s98.43%0.00%87.5 (87.5)2.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_voracious
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 321.3s
  • trigger_min/max:0.8s / 12.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.7s
  • uptime_min/max:96.08% / 99.16%

Stack Uptimes

  • voracious_1:98.43%

Spelldata

  • id:274009
  • name:Voracious
  • tooltip:Leech increased by {$s1=12}%.
  • description:{$@spelldesc273953=Death Strike's healing is increased by {$s2=15}% and grants you {$274009s1=12}% Leech for {$274009d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:273953
  • name:Voracious
  • tooltip:
  • description:Death Strike's healing is increased by {$s2=15}% and grants you {$274009s1=12}% Leech for {$274009d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Beledar's Bounty

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_beledars_bounty
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:470.00

Spelldata

  • id:461957
  • name:Well Fed
  • tooltip:Mastery increased by {$=}w9.
  • description:Increases Mastery by {$s1=0} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Crystallization

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Seabed Leviathan's Citrine

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_seabed_leviathans_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:10783.58
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:stamina
  • amount:10783.58

Spelldata

  • id:462527
  • name:Seabed Leviathan's Citrine
  • tooltip:
  • description:Grants {$?a462527=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=435}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=435}/100)*({$462342s5=5663}/3)}] Stamina and increases your size slightly. In addition, being above {$s6=80}% health causes attackers to take {$?a462342=false}[{$=}{{$462342=}w1*({$s5=82}/100)}][{$=}{{$462342s3=10779}*({$s5=82}/100)}] Frost damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Stormbringer's Runed Citrine

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_stormbringers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:619.75
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:619.75
  • stat:haste_rating
  • amount:619.75
  • stat:mastery_rating
  • amount:619.75
  • stat:versatility_rating
  • amount:619.75

Spelldata

  • id:462536
  • name:Stormbringer's Runed Citrine
  • tooltip:
  • description:Grants {$?a462536=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=25}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=25}/100)*({$462342s5=5663}/3)}] of every secondary stat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (Haste)

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_windsingers_runed_citrine_Haste
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2478.98

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Blood Beast8.52.021.032.4s0.8s174.6s
Rune ready165.5130.0202.01.9s0.0s9.7s
Skyfury (Main Hand)34.814.060.08.4s0.7s107.0s
Vampiric Strike Proc26.011.048.011.0s0.8s112.2s
Vampiric Strike Proc Wasted1.40.07.097.9s0.9s347.0s
parry_haste16.45.031.017.9s2.0s186.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap0.06%0.00%1.38%0.6s0.0s2.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Death's Caress11.0730.000344.030293.551222.456353.964
Vampiric Blood0.6020.0001.0756.8602.02710.908
Raise Dead0.1550.0000.9780.4640.0001.454
Dancing Rune Weapon0.9910.0004.0186.3033.92111.067
Blood Boil2.5920.00024.141111.32365.629160.026
Bonestorm1.1920.00015.1406.4304.53521.126
Death and Decay1.3810.0009.92828.1358.59558.840
Tombstone9.7320.00050.83345.99921.551100.195
Abomination Limb0.7980.0008.4182.3801.50610.392
Consumption8.1770.00031.13267.87626.211117.612

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=179343)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0641.241 / 0.8263.81312.886
Total Seconds per Iteration (n=10023)
Minimum 5th percentile Mean / Median 95th percentile Maximum
4.27010.49522.202 / 21.44836.16860.322

Player Effects

TypeSpellID#ValueSourceNotes
Auto Attack SpeedIcy Talons19487916.0%Spell Data
Attribute MultiplierRune Mastery37458516.0%Spell DataStrength
Unholy Strength53365118.0%Spell DataStrength
Veteran of the Third War48263120.0%Spell DataPassive, Stamina
Blood Fortification374721130.0%Spell DataPassive, Stamina
Matching ArmorPlate Specialization8653715.0%Spell DataPassive, Stamina
VersatilityPerseverance of the Ebon Blade37474816.0%Spell Data
Player MultiplierBlood Shield77535225.0%Spell DataPhysical
Pet MultiplierBlood Death Knight1370081276.0%Spell DataPassive, Pet
Blood Death Knight1370081376.0%Spell DataPassive, Guardian
Luck of the Draw!1218601615.0%Spell DataPet
Attack Power MultiplierMastery: Blood Shield7751321.00000Spell DataMastery, Passive
LeechVoracious274009112.0%Spell Data
ExpertiseBlood Death Knight13700883.0%Spell DataPassive
Crit AvoidanceRunic Protection4547882-3.0%Spell DataPassive
Blood Death Knight1370086-6.0%Spell DataPassive
ParryDancing Rune Weapon81256135.0%Spell Data
Armor MultiplierRunic Protection45478816.0%Spell DataPassive
HasteUnholy Ground37427115.0%Spell Data
Bone Shield195181410.0%Spell DataNo-stacks
Essence of the Blood Queen433925110.0%Spell DataValue-function
Parry Rating from CritRiposte1617971100.0%Spell DataPassive
Healing ReceivedAnti-Magic Shell48707415.0%Spell Data
Vampiric Blood55233130.0%Spell Data
Sanguine Ground39145925.0%Spell Data
Absorb Received MultiplierGloom Ward391571115.0%Spell DataPassive
Vampiric Blood55233330.0%Spell Data
Target MultiplierIncite Terror45847811.0%Shadow
Target Pet MultiplierBrittle37455726.0%Pet
Brittle37455736.0%Guardian
Incite Terror45847821.0%Pet
Incite Terror45847831.0%Guardian

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Deadscrew
ConsumptionRune16.3616.369.89%1.000.000.00%
HeartbreakerRunic Power143.96287.929.16%2.000.000.00%
Rune RegenerationRune149.09149.0990.11%1.000.000.00%
Runic AttenuationRunic Power99.53298.419.49%3.000.190.06%
TombstoneRunic Power4.73141.774.51%30.000.000.00%
Blood Plague (_heal)Health118.6113,500,243.116.84%113,823.517,346,287.0035.24%
Bonestorm (_heal)Health52.9915,549,839.187.88%293,448.431,657,188.179.63%
Consumption (_heal)Health8.181,560,123.770.79%190,710.551,268,317.4944.84%
Death and DecayRunic Power7.7677.552.47%10.000.000.00%
Death Strike (_heal)Health90.49107,025,919.9754.22%1,182,783.5360,275,753.9636.03%
Death's CaressRunic Power1.0710.720.34%10.000.000.00%
Heart StrikeRunic Power55.81837.0826.62%15.000.000.00%
LeechHealth342.9037,166,985.0018.83%108,388.7323,898,377.9139.14%
MarrowrendRunic Power8.45168.995.37%20.000.000.00%
Rune of SanguinationHealth9.268,400,801.254.26%907,116.034,147,121.0533.05%
Vampiric StrikeRunic Power88.151,322.2942.05%15.000.000.00%
Vampiric Strike (_heal)Health88.1514,192,988.877.19%161,004.317,236,489.3233.77%
pet - ghoul
Energy RegenEnergy1,063.312,895.20100.00%2.7236.341.24%
pet - dancing_rune_weapon
ConsumptionRune5.160.000.00%0.0010.32100.00%
pet - everlasting_bond
ConsumptionRune5.160.000.00%0.0010.32100.00%
Usage Type Count Total Tot% Avg RPE APR
Deadscrew
Death and DecayRune20.277.764.57%0.380.38547,170.79
Death StrikeRunic Power90.493,110.30100.00%34.3734.3739,681.39
Death's CaressRune1.071.070.63%1.0014.9351,913.75
Heart StrikeRune55.8155.8132.89%1.000.391,868,757.55
MarrowrendRune8.4516.909.96%2.002.00111,332.78
Vampiric StrikeRune88.1588.1551.95%1.001.001,062,553.56
pet - ghoul
ClawEnergy76.133,045.38100.00%40.0040.01958.81
pet - dancing_rune_weapon
Death StrikeRunic Power51.012,040.56100.00%40.0040.0011,227.17
Death's CaressRune0.000.000.00%1.001.0048,067.29
Vampiric StrikeRune127.46127.46100.00%1.001.00197,695.94
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Health12,320,220.0839,915.47841,007.29156,319,746.511,949,300.011,949,300.011,949,300.0
Runic Power10.010.4810.370.234.40.0124.0
Rune5.00.550.570.01.80.06.0

Statistics & Data Analysis

Fight Length
Deadscrew Fight Length
Count 9999
Mean 299.98
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Deadscrew Damage Per Second
Count 9999
Mean 1172252.72
Minimum 1021941.39
Maximum 1337391.10
Spread ( max - min ) 315449.71
Range [ ( max - min ) / 2 * 100% ] 13.45%
Standard Deviation 41361.3041
5th Percentile 1105769.53
95th Percentile 1241555.00
( 95th Percentile - 5th Percentile ) 135785.47
Mean Distribution
Standard Deviation 413.6337
95.00% Confidence Interval ( 1171442.01 - 1173063.43 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4783
0.1 Scale Factor Error with Delta=300 14604010
0.05 Scale Factor Error with Delta=300 58416040
0.01 Scale Factor Error with Delta=300 1460400979
Priority Target DPS
Deadscrew Priority Target Damage Per Second
Count 9999
Mean 1172252.72
Minimum 1021941.39
Maximum 1337391.10
Spread ( max - min ) 315449.71
Range [ ( max - min ) / 2 * 100% ] 13.45%
Standard Deviation 41361.3041
5th Percentile 1105769.53
95th Percentile 1241555.00
( 95th Percentile - 5th Percentile ) 135785.47
Mean Distribution
Standard Deviation 413.6337
95.00% Confidence Interval ( 1171442.01 - 1173063.43 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4783
0.1 Scale Factor Error with Delta=300 14604010
0.05 Scale Factor Error with Delta=300 58416040
0.01 Scale Factor Error with Delta=300 1460400979
DPS(e)
Deadscrew Damage Per Second (Effective)
Count 9999
Mean 1172252.72
Minimum 1021941.39
Maximum 1337391.10
Spread ( max - min ) 315449.71
Range [ ( max - min ) / 2 * 100% ] 13.45%
Damage
Deadscrew Damage
Count 9999
Mean 280945752.44
Minimum 202046473.56
Maximum 370039720.45
Spread ( max - min ) 167993246.89
Range [ ( max - min ) / 2 * 100% ] 29.90%
DTPS
Deadscrew Damage Taken Per Second
Count 9999
Mean 841966.32
Minimum 661077.13
Maximum 998704.95
Spread ( max - min ) 337627.82
Range [ ( max - min ) / 2 * 100% ] 20.05%
Standard Deviation 45770.0423
5th Percentile 766705.87
95th Percentile 917984.71
( 95th Percentile - 5th Percentile ) 151278.85
Mean Distribution
Standard Deviation 457.7233
95.00% Confidence Interval ( 841069.20 - 842863.44 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 114
0.1% Error 11352
0.1 Scale Factor Error with Delta=300 17883244
0.05 Scale Factor Error with Delta=300 71532976
0.01 Scale Factor Error with Delta=300 1788324377
HPS
Deadscrew Healing Per Second
Count 9999
Mean 658177.58
Minimum 496703.47
Maximum 791825.16
Spread ( max - min ) 295121.69
Range [ ( max - min ) / 2 * 100% ] 22.42%
Standard Deviation 37138.7400
5th Percentile 597096.41
95th Percentile 719180.02
( 95th Percentile - 5th Percentile ) 122083.61
Mean Distribution
Standard Deviation 371.4060
95.00% Confidence Interval ( 657449.64 - 658905.53 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 123
0.1% Error 12232
0.1 Scale Factor Error with Delta=300 11774379
0.05 Scale Factor Error with Delta=300 47097515
0.01 Scale Factor Error with Delta=300 1177437869
HPS(e)
Deadscrew Healing Per Second (Effective)
Count 9999
Mean 658177.58
Minimum 496703.47
Maximum 791825.16
Spread ( max - min ) 295121.69
Range [ ( max - min ) / 2 * 100% ] 22.42%
Heal
Deadscrew Heal
Count 9999
Mean 197415144.18
Minimum 128635922.11
Maximum 269140063.93
Spread ( max - min ) 140504141.82
Range [ ( max - min ) / 2 * 100% ] 35.59%
HTPS
Deadscrew Healing Taken Per Second
Count 9999
Mean 839846.75
Minimum 658714.43
Maximum 1002063.07
Spread ( max - min ) 343348.64
Range [ ( max - min ) / 2 * 100% ] 20.44%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
1 0.00 deaths_caress
Default action list Executed every time the actor is available.
# count action,conditions
2 1.00 auto_attack
0.00 use_item,name=tome_of_lights_devotion,if=buff.inner_resilience.up
3 3.74 use_items
0.00 blood_fury,if=buff.dancing_rune_weapon.up
0.00 berserking,if=buff.dancing_rune_weapon.up
0.00 ancestral_call,if=buff.dancing_rune_weapon.up
0.00 fireblood,if=buff.dancing_rune_weapon.up
4 1.43 potion,if=buff.dancing_rune_weapon.up
5 11.38 vampiric_blood,if=!buff.vampiric_blood.up
6 3.00 raise_dead
0.00 blood_tap,if=(rune<=2&rune.time_to_3>gcd&charges_fractional>=1.8)
0.00 blood_tap,if=(rune<=1&rune.time_to_3>gcd)
7 0.00 run_action_list,name=deathbringer,if=hero_tree.deathbringer
8 0.00 run_action_list,name=sanlayn,if=hero_tree.sanlayn
actions.sanlayn
# count action,conditions
0.00 variable,name=death_strike_dump_drw_amount,value=80
0.00 variable,name=death_strike_dump_amount,value=35
0.00 variable,name=death_strike_pre_essence_dump_amount,value=20
0.00 variable,name=death_strike_sang_low_hp,value=40
0.00 variable,name=death_strike_pre_essence_dump_amount_low_hp,value=70
0.00 variable,name=bone_shield_refresh_value,value=7
0.00 variable,name=heart_strike_rp_drw,value=(21+spell_targets.heart_strike*talent.heartbreaker.enabled*2)
9 1.03 death_strike,if=buff.coagulopathy.remains<=gcd
A 0.07 deaths_caress,if=!buff.bone_shield.up
B 7.09 blood_boil,if=!dot.blood_plague.ticking|(dot.blood_plague.remains<10&buff.dancing_rune_weapon.up)
0.00 potion,if=buff.dancing_rune_weapon.up
C 4.62 consumption,if=pet.dancing_rune_weapon.active&pet.dancing_rune_weapon.remains<=3
D 5.39 bonestorm,if=(buff.death_and_decay.up)&buff.bone_shield.stack>5&cooldown.dancing_rune_weapon.remains
E 8.19 death_strike,if=runic_power>=108
F 36.41 heart_strike,if=buff.dancing_rune_weapon.up&rune>1
G 20.27 death_and_decay,if=!buff.death_and_decay.up
H 6.46 heart_strike,if=buff.infliction_of_sorrow.up&buff.death_and_decay.up
0.00 raise_dead
I 2.98 abomination_limb
J 4.66 tombstone,if=(!buff.dancing_rune_weapon.up&buff.death_and_decay.up)&buff.bone_shield.stack>5&runic_power.deficit>=30&cooldown.dancing_rune_weapon.remains>=25&buff.coagulopathy.remains>2*gcd
K 6.30 dancing_rune_weapon,if=buff.coagulopathy.remains>=2*gcd&(!buff.essence_of_the_blood_queen.up|buff.essence_of_the_blood_queen.remains>=3*gcd)&(!buff.dancing_rune_weapon.up|buff.dancing_rune_weapon.remains>=6*gcd)
L 0.01 death_strike,if=!buff.vampiric_strike.up&cooldown.dancing_rune_weapon.remains<=10&(target.health.pct<variable.death_strike_sang_low_hp&runic_power>variable.death_strike_pre_essence_dump_amount_low_hp)&buff.essence_of_the_blood_queen.stack>=3
M 5.91 death_strike,if=!buff.vampiric_strike.up&cooldown.dancing_rune_weapon.remains<=10&(target.health.pct>variable.death_strike_sang_low_hp&runic_power>variable.death_strike_pre_essence_dump_amount)&buff.essence_of_the_blood_queen.stack>=3
N 8.45 marrowrend,if=!dot.bonestorm.ticking&(buff.bone_shield.stack<variable.bone_shield_refresh_value&runic_power.deficit>20|buff.bone_shield.remains<=3)
0.00 marrowrend,if=!dot.bonestorm.ticking&(buff.bone_shield.stack<variable.bone_shield_refresh_value&runic_power.deficit>20&!cooldown.dancing_rune_weapon.up|buff.bone_shield.remains<=3)
0.00 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>(dot.soul_reaper.remains+5)
O 8.19 death_strike,if=buff.dancing_rune_weapon.up&(buff.coagulopathy.remains<2*gcd|(target.health.pct<variable.death_strike_sang_low_hp&runic_power>50))
P 2.15 death_strike,if=buff.dancing_rune_weapon.up&(buff.coagulopathy.remains<2*gcd|(runic_power.deficit<=variable.heart_strike_rp_drw&debuff.incite_terror.stack>=3))
Q 51.38 heart_strike,if=buff.vampiric_strike.up|buff.infliction_of_sorrow.up&((talent.consumption.enabled&buff.consumption.up)|!talent.consumption.enabled)&dot.blood_plague.ticking&dot.blood_plague.remains>20
R 0.05 dancing_rune_weapon,if=buff.coagulopathy.up
S 65.00 death_strike,if=runic_power.deficit<=variable.heart_strike_rp_drw|runic_power>=variable.death_strike_dump_amount
T 35.25 blood_boil,if=charges>=2|(full_recharge_time<=gcd.max)
U 3.56 consumption,if=cooldown.dancing_rune_weapon.remains>20
V 49.70 heart_strike,if=rune>1
0.00 bonestorm,if=buff.death_and_decay.up&buff.bone_shield.stack>5&cooldown.dancing_rune_weapon.remains
W 0.07 tombstone,if=buff.death_and_decay.up&buff.bone_shield.stack>5&runic_power.deficit>=30&cooldown.dancing_rune_weapon.remains

Sample Sequence

12356BGIN9K4DFFFFQSFQPQSQQCFEFGHBEJENQES5SQTVSVNSTGVMTVVMVTVMVVMKFFGQQQPQ5SSTFCFFFHBESGQDSSTVSVSTVVS5TGVSVTJMNKFFFQPQ3QEGQSSCFFFHBSS5QSTVGSQTVSNTVSQVST6VIGSDQTUVSTVVS5QTVGSQSQTVMQTKFFFFQPGFQEQQECFFEHBS5JNEGQSSQSTVVSQTVSV3GTVSDQSTVS5VTVSVGKFFFFOFOOFFOQQCFFGHBESQS5QSQSQTVSJGNSTVSVTSQVSQTUV6GSI5TVDVKFFFFEFOFGOFOFOFQHBSSQTVS5GU3TVVSQTVSVVSQNGJSQSTVSVTVSVS5TVG

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre1deaths_caress
[precombat]
Fluffy_Pillow 0.0/125 0% RP
12320220.0/12320220 100% HP
6.0/6 100% rune
0:00.0002auto_attack
[default]
Fluffy_Pillow 10.0/125 8% RP
12320220.0/12320220 100% HP
5.0/6 83% rune
bone_shield(2)
0:00.0003use_items
[default]
Fluffy_Pillow 10.0/125 8% RP
12320220.0/12320220 100% HP
5.0/6 83% rune
bloodlust, bone_shield(2)
0:00.0005vampiric_blood
[default]
Deadscrew 10.0/125 8% RP
12320220.0/12320220 100% HP
5.0/6 83% rune
bloodlust, bone_shield(2), funhouse_lens_haste
0:00.0006raise_dead
[default]
Deadscrew 10.0/125 8% RP
16016286.0/16016286 100% HP
5.0/6 83% rune
bloodlust, bone_shield(2), vampiric_blood, funhouse_lens_haste
0:00.000Bblood_boil
[sanlayn]
Fluffy_Pillow 10.0/125 8% RP
16016286.0/16016286 100% HP
5.0/6 83% rune
bloodlust, bone_shield(2), vampiric_blood, funhouse_lens_haste
0:00.760Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 10.0/125 8% RP
16016286.0/16016286 100% HP
5.0/6 83% rune
bloodlust, bone_shield(2), hemostasis, vampiric_blood, funhouse_lens_haste
0:01.519Iabomination_limb
[sanlayn]
Fluffy_Pillow 20.0/125 16% RP
16016286.0/16016286 100% HP
4.0/6 67% rune
bloodlust, unholy_ground, death_and_decay, bloodsoaked_ground, bone_shield(2), hemostasis, sanguine_ground, vampiric_blood, funhouse_lens_haste
0:02.272Nmarrowrend
[sanlayn]
Fluffy_Pillow 20.0/125 16% RP
16016286.0/16016286 100% HP
4.0/6 67% rune
bloodlust, unholy_ground, death_and_decay, bloodsoaked_ground, bone_shield(2), hemostasis, sanguine_ground, vampiric_blood, funhouse_lens_haste, frost_shield
0:03.0279death_strike
[sanlayn]
Fluffy_Pillow 40.0/125 32% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
bloodlust, unholy_ground, death_and_decay, bloodsoaked_ground, bone_shield(5), ossuary, hemostasis, sanguine_ground, vampiric_blood, funhouse_lens_haste, frost_shield
0:03.780Kdancing_rune_weapon
[sanlayn]
Deadscrew 8.0/125 6% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
bloodlust, unholy_ground, icy_talons, death_and_decay, vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(5), ossuary, coagulopathy, sanguine_ground, vampiric_blood, voracious, funhouse_lens_haste, frost_shield
0:04.5354potion
[default]
Fluffy_Pillow 8.0/125 6% RP
6991510.3/16016286 44% HP
2.0/6 33% rune
bloodlust, unholy_ground, icy_talons, death_and_decay, gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol, coagulopathy, dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, funhouse_lens_haste
0:04.535Dbonestorm
[sanlayn]
Fluffy_Pillow 8.0/125 6% RP
6991510.3/16016286 44% HP
2.0/6 33% rune
bloodlust, unholy_ground, icy_talons, death_and_decay, gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol, coagulopathy, dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, funhouse_lens_haste, tempered_potion
0:05.290Fheart_strike
[sanlayn]
Fluffy_Pillow 8.0/125 6% RP
9221503.3/16016286 58% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons, death_and_decay, gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(4), ossified_vitriol(5), coagulopathy, dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, funhouse_lens_haste, combat_analysis, tempered_potion, frost_shield
0:06.044Fheart_strike
[sanlayn]
Fluffy_Pillow 25.0/125 20% RP
7120123.4/16016286 44% HP
3.0/6 50% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(2), death_and_decay, essence_of_the_blood_queen, gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy, dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, funhouse_lens_haste, combat_analysis, tempered_potion
0:06.797Fheart_strike
[sanlayn]
Fluffy_Pillow 45.0/125 36% RP
7924491.2/16016286 49% HP
2.0/6 33% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(2), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy, dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, funhouse_lens_haste, combat_analysis, tempered_potion, frost_shield
0:07.549Fheart_strike
[sanlayn]
Fluffy_Pillow 62.0/125 50% RP
8706436.4/16016286 54% HP
2.0/6 33% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(3), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy, dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, funhouse_lens_haste, combat_analysis, tempered_potion
0:08.304Qheart_strike
[sanlayn]
Fluffy_Pillow 82.0/125 66% RP
9230392.4/16016286 58% HP
1.0/6 17% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(4), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy, dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, funhouse_lens_haste, combat_analysis, tempered_potion, frost_shield
0:09.060Sdeath_strike
[sanlayn]
Fluffy_Pillow 99.0/125 79% RP
9404781.5/16016286 59% HP
0.0/6 0% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(5), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(8), ossuary, ossified_vitriol(5), coagulopathy, dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, funhouse_lens_haste, combat_analysis, tempered_potion
0:09.812Fheart_strike
[sanlayn]
Fluffy_Pillow 64.0/125 51% RP
11990909.7/16016286 75% HP
2.0/6 33% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(5), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(2), dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, funhouse_lens_haste, combat_analysis, tempered_potion
0:10.567Qheart_strike
[sanlayn]
Fluffy_Pillow 87.0/125 70% RP
11525018.5/12320220 94% HP
1.0/6 17% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(6), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(2), dancing_rune_weapon, sanguine_ground, voracious, funhouse_lens_haste, combat_analysis(3), tempered_potion, frost_shield
0:11.322Pdeath_strike
[sanlayn]
Fluffy_Pillow 104.0/125 83% RP
11731683.4/12320220 95% HP
1.0/6 17% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(2), dancing_rune_weapon, sanguine_ground, voracious, funhouse_lens_haste, combat_analysis(3), tempered_potion
0:12.075Qheart_strike
[sanlayn]
Fluffy_Pillow 72.0/125 58% RP
9266681.2/12320220 75% HP
1.0/6 17% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(3), dancing_rune_weapon, sanguine_ground, voracious, funhouse_lens_haste, combat_analysis(3), tempered_potion
0:12.828Sdeath_strike
[sanlayn]
Fluffy_Pillow 89.0/125 71% RP
9962443.4/12320220 81% HP
0.0/6 0% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(3), dancing_rune_weapon, sanguine_ground, voracious, funhouse_lens_haste, combat_analysis(3), tempered_potion
0:13.583Qheart_strike
[sanlayn]
Fluffy_Pillow 57.0/125 46% RP
11452857.5/12320220 93% HP
1.0/6 17% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(4), crimson_scourge, dancing_rune_weapon, sanguine_ground, voracious, funhouse_lens_haste, combat_analysis(3), tempered_potion
0:14.336Qheart_strike
[sanlayn]
Fluffy_Pillow 74.0/125 59% RP
11736713.4/12320220 95% HP
1.0/6 17% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(4), crimson_scourge, dancing_rune_weapon, sanguine_ground, voracious, funhouse_lens_haste, combat_analysis(3), tempered_potion, frost_shield
0:15.092Cconsumption
[sanlayn]
Fluffy_Pillow 91.0/125 73% RP
11618407.1/12320220 94% HP
1.0/6 17% rune
bloodlust, icy_talons(3), essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(4), crimson_scourge, dancing_rune_weapon, voracious, combat_analysis(4), tempered_potion
0:15.845Fheart_strike
[sanlayn]
Fluffy_Pillow 91.0/125 73% RP
12320220.0/12320220 100% HP
3.0/6 50% rune
bloodlust, icy_talons(3), essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(4), consumption, crimson_scourge, dancing_rune_weapon, voracious, combat_analysis(4), tempered_potion, frost_shield
0:16.600Edeath_strike
[sanlayn]
Fluffy_Pillow 108.0/125 86% RP
8584943.9/12320220 70% HP
2.0/6 33% rune
bloodlust, icy_talons(3), essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(4), consumption, crimson_scourge, dancing_rune_weapon, voracious, combat_analysis(4), tempered_potion
0:17.355Fheart_strike
[sanlayn]
Fluffy_Pillow 76.0/125 61% RP
10660894.3/12320220 87% HP
3.0/6 50% rune
bloodlust, icy_talons(3), essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, dancing_rune_weapon, voracious, combat_analysis(4), tempered_potion, frost_shield
0:18.109Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 93.0/125 74% RP
7463222.9/12320220 61% HP
3.0/6 50% rune
bloodlust, icy_talons(3), essence_of_the_blood_queen(7), infliction_of_sorrow, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, voracious, combat_analysis(4), tempered_potion, frost_shield
0:18.864Hheart_strike
[sanlayn]
Fluffy_Pillow 93.0/125 74% RP
7477695.8/12320220 61% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), infliction_of_sorrow, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(4), tempered_potion, frost_shield
0:19.617Bblood_boil
[sanlayn]
Fluffy_Pillow 113.0/125 90% RP
7358278.7/12320220 60% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(4), tempered_potion, frost_shield
0:20.372Edeath_strike
[sanlayn]
Fluffy_Pillow 113.0/125 90% RP
5570393.3/12320220 45% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(5), tempered_potion
0:21.125Jtombstone
[sanlayn]
Deadscrew 81.0/125 65% RP
9119602.0/12320220 74% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(5), tempered_potion, frost_shield
0:21.878Edeath_strike
[sanlayn]
Fluffy_Pillow 111.0/125 89% RP
9611736.9/12320220 78% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(5), tempered_potion, frost_shield
0:22.631Nmarrowrend
[sanlayn]
Fluffy_Pillow 76.0/125 61% RP
11269366.0/12320220 91% HP
5.0/6 83% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(5), tempered_potion, frost_shield
0:23.386Qheart_strike
[sanlayn]
Fluffy_Pillow 96.0/125 77% RP
11346224.6/12320220 92% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(5), tempered_potion
0:24.139Edeath_strike
[sanlayn]
Fluffy_Pillow 116.0/125 93% RP
11842255.1/12320220 96% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, tombstone, voracious, combat_analysis(5), tempered_potion, frost_shield
0:24.892Sdeath_strike
[sanlayn]
Fluffy_Pillow 84.0/125 67% RP
12320220.0/12320220 100% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, tombstone, voracious, combat_analysis(5), tempered_potion, frost_shield
0:25.6475vampiric_blood
[default]
Deadscrew 49.0/125 39% RP
12320220.0/12320220 100% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, tombstone, voracious, combat_analysis(6), tempered_potion, frost_shield
0:25.647Sdeath_strike
[sanlayn]
Fluffy_Pillow 49.0/125 39% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(6), tempered_potion, frost_shield
0:26.400Qheart_strike
[sanlayn]
Fluffy_Pillow 14.0/125 11% RP
15399794.0/16016286 96% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol, coagulopathy(5), sanguine_ground, vampiric_blood, voracious, combat_analysis(6), tempered_potion, frost_shield
0:27.155Tblood_boil
[sanlayn]
Fluffy_Pillow 31.0/125 25% RP
15275073.9/16016286 95% HP
2.0/6 33% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol, coagulopathy(5), sanguine_ground, vampiric_blood, voracious, combat_analysis(6), tempered_potion
0:27.910Vheart_strike
[sanlayn]
Fluffy_Pillow 34.0/125 27% RP
15966154.5/16016286 100% HP
4.0/6 67% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol, coagulopathy(5), hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(6), tempered_potion, frost_shield
0:28.663Sdeath_strike
[sanlayn]
Fluffy_Pillow 51.0/125 41% RP
12441158.5/16016286 78% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol, coagulopathy(5), hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(6), tempered_potion
0:29.419Vheart_strike
[sanlayn]
Fluffy_Pillow 19.0/125 15% RP
15371643.8/16016286 96% HP
4.0/6 67% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(7), ossuary, ossified_vitriol, coagulopathy(5), crimson_scourge, sanguine_ground, vampiric_blood, voracious, combat_analysis(6), tempered_potion, frost_shield
0:30.174Nmarrowrend
[sanlayn]
Fluffy_Pillow 36.0/125 29% RP
12504663.6/16016286 78% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(2), coagulopathy(5), crimson_scourge, sanguine_ground, vampiric_blood, voracious, combat_analysis(7), tempered_potion
0:30.929Sdeath_strike
[sanlayn]
Fluffy_Pillow 56.0/125 45% RP
12578657.9/16016286 79% HP
1.0/6 17% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), crimson_scourge, sanguine_ground, vampiric_blood, voracious, combat_analysis(7), tempered_potion, frost_shield
0:31.683Tblood_boil
[sanlayn]
Fluffy_Pillow 21.0/125 17% RP
14842991.5/16016286 93% HP
1.0/6 17% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), crimson_scourge, sanguine_ground, vampiric_blood, voracious, combat_analysis(7), tempered_potion
0:32.437Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 21.0/125 17% RP
14939338.5/16016286 93% HP
2.0/6 33% rune
bloodlust, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(9), ossuary, coagulopathy(5), crimson_scourge, hemostasis, vampiric_blood, voracious, combat_analysis(7), tempered_potion, frost_shield
0:33.190Vheart_strike
[sanlayn]
Fluffy_Pillow 21.0/125 17% RP
14310953.2/16016286 89% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(7), tempered_potion
0:33.943Mdeath_strike
[sanlayn]
Fluffy_Pillow 41.0/125 33% RP
14398302.2/16016286 90% HP
2.0/6 33% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(7), tempered_potion, frost_shield
0:34.699Tblood_boil
[sanlayn]
Fluffy_Pillow 6.0/125 5% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(7), frost_shield
0:35.454Vheart_strike
[sanlayn]
Fluffy_Pillow 6.0/125 5% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(8), frost_shield
0:36.210Vheart_strike
[sanlayn]
Fluffy_Pillow 23.0/125 18% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
bloodlust, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(8), frost_shield
0:36.965Mdeath_strike
[sanlayn]
Fluffy_Pillow 40.0/125 32% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(8), frost_shield
0:37.721Vheart_strike
[sanlayn]
Fluffy_Pillow 8.0/125 6% RP
12320220.0/12320220 100% HP
3.0/6 50% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(8), frost_shield
0:38.475Tblood_boil
[sanlayn]
Fluffy_Pillow 25.0/125 20% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), heartrend, sanguine_ground, voracious, combat_analysis(8), frost_shield
0:39.233Vheart_strike
[sanlayn]
Fluffy_Pillow 25.0/125 20% RP
11721249.0/12320220 95% HP
3.0/6 50% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), heartrend, hemostasis, sanguine_ground, voracious, combat_analysis(8), frost_shield
0:39.987Mdeath_strike
[sanlayn]
Fluffy_Pillow 42.0/125 34% RP
12063809.8/12320220 98% HP
2.0/6 33% rune
bloodlust, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), heartrend, hemostasis, sanguine_ground, voracious, combat_analysis(8), frost_shield
0:40.741Vheart_strike
[sanlayn]
Fluffy_Pillow 7.0/125 6% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(9), frost_shield
0:41.693 Waiting0.599s 27.0/125 22% RP
12239819.9/12320220 99% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(9)
0:42.292Vheart_strike
[sanlayn]
Fluffy_Pillow 27.0/125 22% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(9)
0:43.244Mdeath_strike
[sanlayn]
Fluffy_Pillow 47.0/125 38% RP
11643934.3/12320220 95% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), crimson_scourge, sanguine_ground, voracious, combat_analysis(9)
0:44.196Kdancing_rune_weapon
[sanlayn]
Deadscrew 12.0/125 10% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), crimson_scourge, sanguine_ground, voracious, combat_analysis(9)
0:45.148Fheart_strike
[sanlayn]
Fluffy_Pillow 15.0/125 12% RP
12153211.0/12320220 99% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), crimson_scourge, dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10)
0:45.989Fheart_strike
[sanlayn]
Fluffy_Pillow 32.0/125 26% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), crimson_scourge, dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10)
0:46.830Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 52.0/125 42% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(12), ossuary, coagulopathy(5), crimson_scourge, dancing_rune_weapon, voracious, combat_analysis(10), frost_shield
0:47.715Qheart_strike
[sanlayn]
Fluffy_Pillow 52.0/125 42% RP
11683716.0/12320220 95% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10)
0:48.556Qheart_strike
[sanlayn]
Fluffy_Pillow 69.0/125 55% RP
11941471.4/12320220 97% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), frost_shield
0:49.397Qheart_strike
[sanlayn]
Fluffy_Pillow 86.0/125 69% RP
11539852.6/12320220 94% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10)
0:50.237Pdeath_strike
[sanlayn]
Fluffy_Pillow 106.0/125 85% RP
12320220.0/12320220 100% HP
0.0/6 0% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), frost_shield
0:51.079Qheart_strike
[sanlayn]
Fluffy_Pillow 71.0/125 57% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10)
0:51.9195vampiric_blood
[default]
Deadscrew 88.0/125 70% RP
12320220.0/12320220 100% HP
0.0/6 0% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), frost_shield
0:51.919Sdeath_strike
[sanlayn]
Fluffy_Pillow 88.0/125 70% RP
16016286.0/16016286 100% HP
0.0/6 0% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), frost_shield
0:52.761Sdeath_strike
[sanlayn]
Fluffy_Pillow 53.0/125 42% RP
16016286.0/16016286 100% HP
0.0/6 0% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), frost_shield
0:53.601Tblood_boil
[sanlayn]
Fluffy_Pillow 21.0/125 17% RP
16016286.0/16016286 100% HP
0.0/6 0% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), frost_shield
0:54.443Fheart_strike
[sanlayn]
Fluffy_Pillow 21.0/125 17% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
0:55.287Cconsumption
[sanlayn]
Fluffy_Pillow 38.0/125 30% RP
16016286.0/16016286 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit
0:56.132Fheart_strike
[sanlayn]
Fluffy_Pillow 38.0/125 30% RP
16016286.0/16016286 100% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), consumption, dancing_rune_weapon, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit
0:56.978Fheart_strike
[sanlayn]
Fluffy_Pillow 55.0/125 44% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), consumption, dancing_rune_weapon, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
0:57.822Fheart_strike
[sanlayn]
Fluffy_Pillow 72.0/125 58% RP
15639908.6/16016286 98% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), consumption, dancing_rune_weapon, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit
0:58.668Hheart_strike
[sanlayn]
Fluffy_Pillow 89.0/125 71% RP
16016286.0/16016286 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), infliction_of_sorrow, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), consumption, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
0:59.622Bblood_boil
[sanlayn]
Fluffy_Pillow 106.0/125 85% RP
15857815.3/16016286 99% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), consumption, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit
1:00.577Edeath_strike
[sanlayn]
Fluffy_Pillow 109.0/125 87% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), consumption, hemostasis(2), sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:01.531Sdeath_strike
[sanlayn]
Fluffy_Pillow 74.0/125 59% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(12), ossuary, coagulopathy(5), vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit
1:02.534Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 42.0/125 34% RP
2824092.2/12320220 23% HP
3.0/6 50% rune
blood_draw, icy_talons(3), essence_of_the_blood_queen(7), vampiric_strike, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:03.536Qheart_strike
[sanlayn]
Fluffy_Pillow 52.0/125 42% RP
3391166.6/12320220 28% HP
2.0/6 33% rune
blood_draw, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit
1:04.492Dbonestorm
[sanlayn]
Fluffy_Pillow 72.0/125 58% RP
5101917.8/12320220 41% HP
1.0/6 17% rune
blood_draw, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:05.491Sdeath_strike
[sanlayn]
Fluffy_Pillow 72.0/125 58% RP
7290382.9/12320220 59% HP
1.0/6 17% rune
blood_draw, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit
1:06.445Sdeath_strike
[sanlayn]
Fluffy_Pillow 50.0/125 40% RP
9858763.5/12320220 80% HP
2.0/6 33% rune
blood_draw, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:07.401Tblood_boil
[sanlayn]
Fluffy_Pillow 25.0/125 20% RP
12320220.0/12320220 100% HP
3.0/6 50% rune
blood_draw, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, blood_shield, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:08.356Vheart_strike
[sanlayn]
Fluffy_Pillow 28.0/125 22% RP
9573539.7/12320220 78% HP
3.0/6 50% rune
blood_draw, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(8), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:09.311Sdeath_strike
[sanlayn]
Fluffy_Pillow 45.0/125 36% RP
11302804.8/12320220 92% HP
3.0/6 50% rune
blood_draw, icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:10.266Vheart_strike
[sanlayn]
Fluffy_Pillow 23.0/125 18% RP
11219149.0/12320220 91% HP
3.0/6 50% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_crit
1:11.222Sdeath_strike
[sanlayn]
Fluffy_Pillow 40.0/125 32% RP
11536890.7/12320220 94% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_crit
1:12.177Tblood_boil
[sanlayn]
Fluffy_Pillow 8.0/125 6% RP
12290478.2/12320220 100% HP
3.0/6 50% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_crit
1:13.131Vheart_strike
[sanlayn]
Fluffy_Pillow 11.0/125 9% RP
12320220.0/12320220 100% HP
4.0/6 67% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, hemostasis, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:14.086Vheart_strike
[sanlayn]
Fluffy_Pillow 28.0/125 22% RP
7886553.9/12320220 64% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, hemostasis, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_crit
1:15.040Sdeath_strike
[sanlayn]
Fluffy_Pillow 45.0/125 36% RP
9922005.8/12320220 81% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, hemostasis, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_crit
1:15.9955vampiric_blood
[default]
Deadscrew 13.0/125 10% RP
11866763.5/12320220 96% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:15.995Tblood_boil
[sanlayn]
Fluffy_Pillow 13.0/125 10% RP
15426792.6/16016286 96% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:16.951Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 16.0/125 13% RP
15781074.3/16016286 99% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, hemostasis, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:17.956Vheart_strike
[sanlayn]
Fluffy_Pillow 16.0/125 13% RP
15785599.6/16016286 99% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:18.910Sdeath_strike
[sanlayn]
Fluffy_Pillow 36.0/125 29% RP
11681616.1/16016286 73% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:19.864Vheart_strike
[sanlayn]
Fluffy_Pillow 1.0/125 1% RP
14413894.2/16016286 90% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:20.819Tblood_boil
[sanlayn]
Fluffy_Pillow 18.0/125 14% RP
15980116.8/16016286 100% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:21.774Jtombstone
[sanlayn]
Deadscrew 18.0/125 14% RP
16016286.0/16016286 100% HP
4.0/6 67% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:22.729Mdeath_strike
[sanlayn]
Fluffy_Pillow 48.0/125 38% RP
16016286.0/16016286 100% HP
4.0/6 67% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:23.683Nmarrowrend
[sanlayn]
Fluffy_Pillow 13.0/125 10% RP
16016286.0/16016286 100% HP
4.0/6 67% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_crit, frost_shield
1:24.638Kdancing_rune_weapon
[sanlayn]
Deadscrew 36.0/125 29% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:25.589Fheart_strike
[sanlayn]
Fluffy_Pillow 36.0/125 29% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:26.429Fheart_strike
[sanlayn]
Fluffy_Pillow 56.0/125 45% RP
12291061.1/12320220 100% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
1:27.269Fheart_strike
[sanlayn]
Fluffy_Pillow 73.0/125 58% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:28.113Qheart_strike
[sanlayn]
Fluffy_Pillow 90.0/125 72% RP
11642469.7/12320220 94% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, heartrend, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
1:28.955Pdeath_strike
[sanlayn]
Fluffy_Pillow 107.0/125 86% RP
11893146.4/12320220 97% HP
0.0/6 0% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), crimson_scourge, dancing_rune_weapon, heartrend, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:29.796Qheart_strike
[sanlayn]
Fluffy_Pillow 72.0/125 58% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, coagulopathy(5), crimson_scourge, dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:30.6353use_items
[default]
Fluffy_Pillow 92.0/125 74% RP
8501223.8/12320220 69% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), crimson_scourge, dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:30.635Qheart_strike
[sanlayn]
Fluffy_Pillow 92.0/125 74% RP
8501223.8/12320220 69% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), crimson_scourge, dancing_rune_weapon, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:31.478Edeath_strike
[sanlayn]
Fluffy_Pillow 109.0/125 87% RP
8715879.6/12320220 71% HP
0.0/6 0% rune
icy_talons(3), essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), crimson_scourge, dancing_rune_weapon, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:32.359Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 74.0/125 59% RP
10425197.7/12320220 85% HP
1.0/6 17% rune
icy_talons(3), essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), crimson_scourge, dancing_rune_weapon, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
1:33.244Qheart_strike
[sanlayn]
Fluffy_Pillow 74.0/125 59% RP
10431832.9/12320220 85% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
1:34.085Sdeath_strike
[sanlayn]
Fluffy_Pillow 94.0/125 75% RP
10146310.5/12320220 82% HP
0.0/6 0% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
1:34.926Sdeath_strike
[sanlayn]
Fluffy_Pillow 59.0/125 47% RP
11777121.2/12320220 96% HP
0.0/6 0% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
1:35.766Cconsumption
[sanlayn]
Fluffy_Pillow 27.0/125 22% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:36.608Fheart_strike
[sanlayn]
Fluffy_Pillow 27.0/125 22% RP
12320220.0/12320220 100% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), consumption, dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:37.449Fheart_strike
[sanlayn]
Fluffy_Pillow 47.0/125 38% RP
12320220.0/12320220 100% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), consumption, dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:38.291Fheart_strike
[sanlayn]
Fluffy_Pillow 64.0/125 51% RP
12070591.7/12320220 98% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
1:39.133Hheart_strike
[sanlayn]
Fluffy_Pillow 84.0/125 67% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), infliction_of_sorrow, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:40.083Bblood_boil
[sanlayn]
Fluffy_Pillow 101.0/125 81% RP
11854949.6/12320220 96% HP
1.0/6 17% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, sanguine_ground, voracious, luck_of_the_draw, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
1:41.033Sdeath_strike
[sanlayn]
Fluffy_Pillow 104.0/125 83% RP
11910589.9/12320220 97% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, hemostasis, sanguine_ground, voracious, luck_of_the_draw, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:41.985Sdeath_strike
[sanlayn]
Fluffy_Pillow 69.0/125 55% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:42.9355vampiric_blood
[default]
Deadscrew 37.0/125 30% RP
12320220.0/12320220 100% HP
3.0/6 50% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:42.935Qheart_strike
[sanlayn]
Fluffy_Pillow 37.0/125 30% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:43.886Sdeath_strike
[sanlayn]
Fluffy_Pillow 54.0/125 43% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:44.838Tblood_boil
[sanlayn]
Fluffy_Pillow 22.0/125 18% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, coagulopathy(5), crimson_scourge, sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:45.791Vheart_strike
[sanlayn]
Fluffy_Pillow 22.0/125 18% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, coagulopathy(5), crimson_scourge, hemostasis, sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:46.743Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 39.0/125 31% RP
15877191.1/16016286 99% HP
2.0/6 33% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(11), ossuary, coagulopathy(5), crimson_scourge, hemostasis, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:47.742Sdeath_strike
[sanlayn]
Fluffy_Pillow 39.0/125 31% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:48.694Qheart_strike
[sanlayn]
Fluffy_Pillow 7.0/125 6% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:49.644Tblood_boil
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:50.595Vheart_strike
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
15527379.7/16016286 97% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:51.547Sdeath_strike
[sanlayn]
Fluffy_Pillow 41.0/125 33% RP
15569820.9/16016286 97% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:52.498Nmarrowrend
[sanlayn]
Fluffy_Pillow 6.0/125 5% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:53.449Tblood_boil
[sanlayn]
Fluffy_Pillow 26.0/125 21% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
1:54.399Vheart_strike
[sanlayn]
Fluffy_Pillow 29.0/125 23% RP
11635665.7/12320220 94% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
1:55.349Sdeath_strike
[sanlayn]
Fluffy_Pillow 46.0/125 37% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
1:56.302Qheart_strike
[sanlayn]
Fluffy_Pillow 11.0/125 9% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
1:57.253Vheart_strike
[sanlayn]
Fluffy_Pillow 28.0/125 22% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
1:58.204Sdeath_strike
[sanlayn]
Fluffy_Pillow 48.0/125 38% RP
11621596.0/12320220 94% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
1:59.158Tblood_boil
[sanlayn]
Fluffy_Pillow 13.0/125 10% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:00.1106raise_dead
[default]
Deadscrew 16.0/125 13% RP
12189607.2/12320220 99% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:00.110Vheart_strike
[sanlayn]
Fluffy_Pillow 16.0/125 13% RP
12189607.2/12320220 99% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:01.061 Waiting0.211s 33.0/125 26% RP
12235667.8/12320220 99% HP
1.0/6 17% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(12), ossuary, coagulopathy(5), heartrend, hemostasis, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:01.272Iabomination_limb
[sanlayn]
Fluffy_Pillow 33.0/125 26% RP
12235667.8/12320220 99% HP
1.0/6 17% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(12), ossuary, coagulopathy(5), heartrend, hemostasis, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:02.520Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 36.0/125 29% RP
1473533.1/12320220 12% HP
2.0/6 33% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), heartrend, hemostasis, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:03.520Sdeath_strike
[sanlayn]
Fluffy_Pillow 46.0/125 37% RP
1528824.9/12320220 12% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), heartrend, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:04.472Dbonestorm
[sanlayn]
Fluffy_Pillow 11.0/125 9% RP
3166768.6/12320220 26% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:05.487Qheart_strike
[sanlayn]
Fluffy_Pillow 11.0/125 9% RP
4938353.7/12320220 40% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:06.440Tblood_boil
[sanlayn]
Fluffy_Pillow 28.0/125 22% RP
4753429.9/12320220 39% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:07.393Uconsumption
[sanlayn]
Fluffy_Pillow 31.0/125 25% RP
5204675.9/12320220 42% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(8), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:08.344Vheart_strike
[sanlayn]
Fluffy_Pillow 31.0/125 25% RP
2124716.9/12320220 17% HP
5.0/6 83% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(8), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:09.295Sdeath_strike
[sanlayn]
Fluffy_Pillow 48.0/125 38% RP
1773890.7/12320220 14% HP
4.0/6 67% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:10.246Tblood_boil
[sanlayn]
Fluffy_Pillow 13.0/125 10% RP
2916288.5/12320220 24% HP
4.0/6 67% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:11.197Vheart_strike
[sanlayn]
Fluffy_Pillow 16.0/125 13% RP
2559709.4/12320220 21% HP
4.0/6 67% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:12.149Vheart_strike
[sanlayn]
Fluffy_Pillow 33.0/125 26% RP
-816932.1/12320220 -7% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:13.099Sdeath_strike
[sanlayn]
Fluffy_Pillow 50.0/125 40% RP
-1194225.3/12320220 -10% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:14.0515vampiric_blood
[default]
Deadscrew 15.0/125 12% RP
25369.2/12320220 0% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:14.051Qheart_strike
[sanlayn]
Fluffy_Pillow 15.0/125 12% RP
32979.9/16016286 0% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:15.002Tblood_boil
[sanlayn]
Fluffy_Pillow 32.0/125 26% RP
3315174.8/16016286 21% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:15.956Vheart_strike
[sanlayn]
Fluffy_Pillow 32.0/125 26% RP
2666783.0/16016286 17% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:16.908Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 52.0/125 42% RP
-698256.4/16016286 -4% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, hemostasis, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:17.907Sdeath_strike
[sanlayn]
Fluffy_Pillow 52.0/125 42% RP
-1328015.4/16016286 -8% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:18.858Qheart_strike
[sanlayn]
Fluffy_Pillow 20.0/125 16% RP
461081.6/16016286 3% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:19.809Sdeath_strike
[sanlayn]
Fluffy_Pillow 37.0/125 30% RP
158362.0/16016286 1% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:20.760Qheart_strike
[sanlayn]
Fluffy_Pillow 2.0/125 2% RP
4393282.3/16016286 27% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:21.712Tblood_boil
[sanlayn]
Fluffy_Pillow 19.0/125 15% RP
4885083.8/16016286 31% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:22.663Vheart_strike
[sanlayn]
Fluffy_Pillow 19.0/125 15% RP
1329725.5/16016286 8% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:23.616Mdeath_strike
[sanlayn]
Fluffy_Pillow 36.0/125 29% RP
722437.8/16016286 5% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), heartrend, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
2:24.567Qheart_strike
[sanlayn]
Fluffy_Pillow 1.0/125 1% RP
443179.5/12320220 4% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:25.484Tblood_boil
[sanlayn]
Fluffy_Pillow 18.0/125 14% RP
1535101.9/12320220 12% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:26.400Kdancing_rune_weapon
[sanlayn]
Deadscrew 21.0/125 17% RP
-1962687.1/12320220 -16% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:27.317Fheart_strike
[sanlayn]
Fluffy_Pillow 21.0/125 17% RP
-2617441.6/12320220 -21% HP
4.0/6 67% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:28.129Fheart_strike
[sanlayn]
Fluffy_Pillow 38.0/125 30% RP
-2388039.5/12320220 -19% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:28.940Fheart_strike
[sanlayn]
Fluffy_Pillow 55.0/125 44% RP
-2031896.2/12320220 -16% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:29.749Fheart_strike
[sanlayn]
Fluffy_Pillow 72.0/125 58% RP
-2495751.8/12320220 -20% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:30.559Qheart_strike
[sanlayn]
Fluffy_Pillow 89.0/125 71% RP
-4459647.6/12320220 -36% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:31.369Pdeath_strike
[sanlayn]
Fluffy_Pillow 106.0/125 85% RP
-4855140.1/12320220 -39% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:32.221Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 74.0/125 59% RP
-2598485.0/12320220 -21% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, dancing_rune_weapon, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:33.073Fheart_strike
[sanlayn]
Fluffy_Pillow 74.0/125 59% RP
-2580178.9/12320220 -21% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:33.883Qheart_strike
[sanlayn]
Fluffy_Pillow 94.0/125 75% RP
-1934753.5/12320220 -16% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:34.693Edeath_strike
[sanlayn]
Fluffy_Pillow 111.0/125 89% RP
-1516419.7/12320220 -12% HP
0.0/6 0% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:35.504Qheart_strike
[sanlayn]
Fluffy_Pillow 76.0/125 61% RP
1789687.9/12320220 15% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:36.315Qheart_strike
[sanlayn]
Fluffy_Pillow 93.0/125 74% RP
2150271.8/12320220 17% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:37.125Edeath_strike
[sanlayn]
Fluffy_Pillow 110.0/125 88% RP
2192895.3/12320220 18% HP
0.0/6 0% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:37.936Cconsumption
[sanlayn]
Fluffy_Pillow 75.0/125 60% RP
3673929.4/12320220 30% HP
0.0/6 0% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:38.746Fheart_strike
[sanlayn]
Fluffy_Pillow 78.0/125 62% RP
4051960.9/12320220 33% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, coagulopathy(5), consumption, dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:39.556Fheart_strike
[sanlayn]
Fluffy_Pillow 95.0/125 76% RP
4243667.9/12320220 34% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:40.366Edeath_strike
[sanlayn]
Fluffy_Pillow 115.0/125 92% RP
6073061.1/12320220 49% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:41.176Hheart_strike
[sanlayn]
Fluffy_Pillow 80.0/125 64% RP
7312914.5/12320220 59% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), infliction_of_sorrow, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:42.094Bblood_boil
[sanlayn]
Fluffy_Pillow 97.0/125 78% RP
7771488.8/12320220 63% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:43.010Sdeath_strike
[sanlayn]
Fluffy_Pillow 97.0/125 78% RP
7813279.2/12320220 63% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:43.9255vampiric_blood
[default]
Deadscrew 62.0/125 50% RP
9126223.6/12320220 74% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:43.925Jtombstone
[sanlayn]
Deadscrew 62.0/125 50% RP
11864090.7/16016286 74% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:44.841Nmarrowrend
[sanlayn]
Fluffy_Pillow 92.0/125 74% RP
11957666.7/16016286 75% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:45.757Edeath_strike
[sanlayn]
Fluffy_Pillow 112.0/125 90% RP
14183193.3/16016286 89% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:46.672Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 77.0/125 62% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
icy_talons(3), essence_of_the_blood_queen(7), vampiric_strike, blood_shield, bone_shield(9), ossuary, coagulopathy(5), crimson_scourge, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:47.635Qheart_strike
[sanlayn]
Fluffy_Pillow 77.0/125 62% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:48.551Sdeath_strike
[sanlayn]
Fluffy_Pillow 97.0/125 78% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:49.467Sdeath_strike
[sanlayn]
Fluffy_Pillow 62.0/125 50% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:50.384Qheart_strike
[sanlayn]
Fluffy_Pillow 30.0/125 24% RP
16016286.0/16016286 100% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:51.302Sdeath_strike
[sanlayn]
Fluffy_Pillow 47.0/125 38% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:52.218Tblood_boil
[sanlayn]
Fluffy_Pillow 12.0/125 10% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
2:53.135Vheart_strike
[sanlayn]
Fluffy_Pillow 12.0/125 10% RP
15811852.0/16016286 99% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
2:54.052Vheart_strike
[sanlayn]
Fluffy_Pillow 29.0/125 23% RP
12320220.0/12320220 100% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), heartrend, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:55.007Sdeath_strike
[sanlayn]
Fluffy_Pillow 46.0/125 37% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), heartrend, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:55.961Qheart_strike
[sanlayn]
Fluffy_Pillow 14.0/125 11% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:56.916Tblood_boil
[sanlayn]
Fluffy_Pillow 31.0/125 25% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:57.870Vheart_strike
[sanlayn]
Fluffy_Pillow 34.0/125 27% RP
11668597.0/12320220 95% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:58.824Sdeath_strike
[sanlayn]
Fluffy_Pillow 51.0/125 41% RP
11966738.2/12320220 97% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
2:59.778Vheart_strike
[sanlayn]
Fluffy_Pillow 16.0/125 13% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), crimson_scourge, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:00.7323use_items
[default]
Fluffy_Pillow 33.0/125 26% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(9), ossuary, coagulopathy(5), crimson_scourge, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:00.732Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 33.0/125 26% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(9), ossuary, coagulopathy(5), crimson_scourge, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:01.734Tblood_boil
[sanlayn]
Fluffy_Pillow 33.0/125 26% RP
11702387.3/12320220 95% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:02.690Vheart_strike
[sanlayn]
Fluffy_Pillow 33.0/125 26% RP
2913450.0/12320220 24% HP
3.0/6 50% rune
blood_draw, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, ossified_vitriol, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:03.645Sdeath_strike
[sanlayn]
Fluffy_Pillow 50.0/125 40% RP
2442089.9/12320220 20% HP
2.0/6 33% rune
blood_draw, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, ossified_vitriol, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:04.598Dbonestorm
[sanlayn]
Fluffy_Pillow 25.0/125 20% RP
5045670.2/12320220 41% HP
2.0/6 33% rune
blood_draw, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, ossified_vitriol, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:05.553Qheart_strike
[sanlayn]
Fluffy_Pillow 28.0/125 22% RP
6034503.9/12320220 49% HP
3.0/6 50% rune
blood_draw, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(3), ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:06.507Sdeath_strike
[sanlayn]
Fluffy_Pillow 45.0/125 36% RP
3611195.4/12320220 29% HP
3.0/6 50% rune
blood_draw, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(3), ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:07.462Tblood_boil
[sanlayn]
Fluffy_Pillow 18.0/125 14% RP
6077180.9/12320220 49% HP
3.0/6 50% rune
blood_draw, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(4), ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:08.415Vheart_strike
[sanlayn]
Fluffy_Pillow 18.0/125 14% RP
3006946.9/12320220 24% HP
3.0/6 50% rune
blood_draw, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:09.368Sdeath_strike
[sanlayn]
Fluffy_Pillow 35.0/125 28% RP
3449877.2/12320220 28% HP
3.0/6 50% rune
blood_draw, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), heartrend, hemostasis, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:10.3235vampiric_blood
[default]
Deadscrew 10.0/125 8% RP
2972845.9/12320220 24% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:10.323Vheart_strike
[sanlayn]
Fluffy_Pillow 10.0/125 8% RP
3864699.6/16016286 24% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:11.276Tblood_boil
[sanlayn]
Fluffy_Pillow 27.0/125 22% RP
4738296.1/16016286 30% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:12.230Vheart_strike
[sanlayn]
Fluffy_Pillow 27.0/125 22% RP
4588065.8/16016286 29% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:13.184Sdeath_strike
[sanlayn]
Fluffy_Pillow 47.0/125 38% RP
5092986.6/16016286 32% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:14.139Vheart_strike
[sanlayn]
Fluffy_Pillow 12.0/125 10% RP
8358083.0/16016286 52% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:15.092Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 32.0/125 26% RP
10805331.3/16016286 67% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:16.095Kdancing_rune_weapon
[sanlayn]
Deadscrew 32.0/125 26% RP
6582660.8/16016286 41% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:17.049Fheart_strike
[sanlayn]
Fluffy_Pillow 32.0/125 26% RP
7426087.0/16016286 46% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:17.892Fheart_strike
[sanlayn]
Fluffy_Pillow 49.0/125 39% RP
7774818.0/16016286 49% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:18.736Fheart_strike
[sanlayn]
Fluffy_Pillow 69.0/125 55% RP
4010680.1/16016286 25% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:19.582Fheart_strike
[sanlayn]
Fluffy_Pillow 86.0/125 69% RP
4537489.4/16016286 28% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:20.426Odeath_strike
[sanlayn]
Fluffy_Pillow 106.0/125 85% RP
2074105.0/12320220 17% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:21.271Fheart_strike
[sanlayn]
Fluffy_Pillow 71.0/125 57% RP
6654586.3/12320220 54% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:22.116Odeath_strike
[sanlayn]
Fluffy_Pillow 91.0/125 73% RP
7079477.2/12320220 57% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:22.961Odeath_strike
[sanlayn]
Fluffy_Pillow 56.0/125 45% RP
8847325.0/12320220 72% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:23.804Fheart_strike
[sanlayn]
Fluffy_Pillow 21.0/125 17% RP
10583307.4/12320220 86% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:24.648Fheart_strike
[sanlayn]
Fluffy_Pillow 38.0/125 30% RP
10862214.4/12320220 88% HP
2.0/6 33% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:25.459Odeath_strike
[sanlayn]
Fluffy_Pillow 55.0/125 44% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:26.269Qheart_strike
[sanlayn]
Fluffy_Pillow 20.0/125 16% RP
12284691.2/12320220 100% HP
1.0/6 17% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste
3:27.080Qheart_strike
[sanlayn]
Fluffy_Pillow 37.0/125 30% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:27.890Cconsumption
[sanlayn]
Fluffy_Pillow 54.0/125 43% RP
12320220.0/12320220 100% HP
0.0/6 0% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:28.700Fheart_strike
[sanlayn]
Fluffy_Pillow 57.0/125 46% RP
11868281.4/12320220 96% HP
3.0/6 50% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, dancing_rune_weapon, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:29.513Fheart_strike
[sanlayn]
Fluffy_Pillow 74.0/125 59% RP
12319880.9/12320220 100% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, dancing_rune_weapon, heartrend, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:30.364Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 94.0/125 75% RP
11811694.1/12320220 96% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), infliction_of_sorrow, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, heartrend, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste
3:31.328Hheart_strike
[sanlayn]
Fluffy_Pillow 104.0/125 83% RP
11954788.4/12320220 97% HP
1.0/6 17% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), infliction_of_sorrow, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, heartrend, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste
3:32.243Bblood_boil
[sanlayn]
Fluffy_Pillow 124.0/125 99% RP
11838411.0/12320220 96% HP
1.0/6 17% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, coagulopathy(5), consumption, heartrend, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste
3:33.161Edeath_strike
[sanlayn]
Fluffy_Pillow 124.0/125 99% RP
11894309.5/12320220 97% HP
1.0/6 17% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, coagulopathy(5), consumption, heartrend, hemostasis, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste
3:34.077Sdeath_strike
[sanlayn]
Fluffy_Pillow 92.0/125 74% RP
12138701.3/12320220 99% HP
1.0/6 17% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste
3:34.993Qheart_strike
[sanlayn]
Fluffy_Pillow 57.0/125 46% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste
3:35.908Sdeath_strike
[sanlayn]
Fluffy_Pillow 77.0/125 62% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:36.8265vampiric_blood
[default]
Deadscrew 42.0/125 34% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:36.826Qheart_strike
[sanlayn]
Fluffy_Pillow 42.0/125 34% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:37.742Sdeath_strike
[sanlayn]
Fluffy_Pillow 59.0/125 47% RP
16016286.0/16016286 100% HP
1.0/6 17% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:38.658Qheart_strike
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:39.575Sdeath_strike
[sanlayn]
Fluffy_Pillow 44.0/125 35% RP
16016286.0/16016286 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:40.490Qheart_strike
[sanlayn]
Fluffy_Pillow 9.0/125 7% RP
16016286.0/16016286 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:41.406Tblood_boil
[sanlayn]
Fluffy_Pillow 29.0/125 23% RP
16016286.0/16016286 100% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, coagulopathy(5), crimson_scourge, heartrend, sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:42.323Vheart_strike
[sanlayn]
Fluffy_Pillow 29.0/125 23% RP
15457654.9/16016286 97% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, coagulopathy(5), crimson_scourge, heartrend, hemostasis, sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste
3:43.240Sdeath_strike
[sanlayn]
Fluffy_Pillow 49.0/125 39% RP
15510455.4/16016286 97% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, coagulopathy(5), crimson_scourge, heartrend, hemostasis, sanguine_ground, vampiric_blood, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:44.156Jtombstone
[sanlayn]
Deadscrew 14.0/125 11% RP
15836057.8/16016286 99% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, coagulopathy(5), crimson_scourge, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste
3:45.073Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 47.0/125 38% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:46.037Nmarrowrend
[sanlayn]
Fluffy_Pillow 47.0/125 38% RP
16016286.0/16016286 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:46.954Sdeath_strike
[sanlayn]
Fluffy_Pillow 67.0/125 54% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:47.870Tblood_boil
[sanlayn]
Fluffy_Pillow 32.0/125 26% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(8), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:48.788Vheart_strike
[sanlayn]
Fluffy_Pillow 32.0/125 26% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:49.702Sdeath_strike
[sanlayn]
Fluffy_Pillow 49.0/125 39% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:50.619Vheart_strike
[sanlayn]
Fluffy_Pillow 17.0/125 14% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:51.537Tblood_boil
[sanlayn]
Fluffy_Pillow 34.0/125 27% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:52.453Sdeath_strike
[sanlayn]
Fluffy_Pillow 37.0/125 30% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:53.369Qheart_strike
[sanlayn]
Fluffy_Pillow 2.0/125 2% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_haste, frost_shield
3:54.287Vheart_strike
[sanlayn]
Fluffy_Pillow 22.0/125 18% RP
12316327.9/12320220 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:55.242Sdeath_strike
[sanlayn]
Fluffy_Pillow 39.0/125 31% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:56.197Qheart_strike
[sanlayn]
Fluffy_Pillow 4.0/125 3% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:57.152Tblood_boil
[sanlayn]
Fluffy_Pillow 21.0/125 17% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
3:58.106Uconsumption
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
11703504.2/12320220 95% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), crimson_scourge, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
3:59.062Vheart_strike
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
11957613.4/12320220 97% HP
3.0/6 50% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), consumption, crimson_scourge, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:00.0166raise_dead
[default]
Deadscrew 41.0/125 33% RP
12320220.0/12320220 100% HP
3.0/6 50% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(8), ossuary, coagulopathy(5), consumption, crimson_scourge, hemostasis, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:00.110Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 41.0/125 33% RP
11582697.6/12320220 94% HP
3.0/6 50% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(8), ossuary, coagulopathy(5), consumption, crimson_scourge, hemostasis, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:01.114Sdeath_strike
[sanlayn]
Fluffy_Pillow 41.0/125 33% RP
11595237.4/12320220 94% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), consumption, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:02.067Iabomination_limb
[sanlayn]
Fluffy_Pillow 6.0/125 5% RP
3176968.1/12320220 26% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol, coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:03.0235vampiric_blood
[default]
Deadscrew 6.0/125 5% RP
3240298.3/12320220 26% HP
5.0/6 83% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol, coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:03.023Tblood_boil
[sanlayn]
Fluffy_Pillow 6.0/125 5% RP
4212387.7/16016286 26% HP
5.0/6 83% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol, coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:03.977Vheart_strike
[sanlayn]
Fluffy_Pillow 6.0/125 5% RP
4479745.6/16016286 28% HP
5.0/6 83% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol, coagulopathy(5), consumption, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:04.931Dbonestorm
[sanlayn]
Fluffy_Pillow 23.0/125 18% RP
528569.3/16016286 3% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol, coagulopathy(5), heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:05.887Vheart_strike
[sanlayn]
Fluffy_Pillow 26.0/125 21% RP
2723125.9/16016286 17% HP
5.0/6 83% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(2), ossified_vitriol(5), coagulopathy(5), heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:06.841Kdancing_rune_weapon
[sanlayn]
Deadscrew 43.0/125 34% RP
-1088307.5/16016286 -7% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(2), ossified_vitriol(5), coagulopathy(5), heartrend, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:07.796Fheart_strike
[sanlayn]
Fluffy_Pillow 46.0/125 37% RP
-248681.1/16016286 -2% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:08.641Fheart_strike
[sanlayn]
Fluffy_Pillow 63.0/125 50% RP
-3853129.6/16016286 -24% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, hemostasis, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:09.486Fheart_strike
[sanlayn]
Fluffy_Pillow 80.0/125 64% RP
-2968559.5/16016286 -19% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, hemostasis, sanguine_ground, vampiric_blood, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:10.331Fheart_strike
[sanlayn]
Fluffy_Pillow 97.0/125 78% RP
-46427.4/16016286 -0% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, hemostasis, sanguine_ground, vampiric_blood, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:11.176Edeath_strike
[sanlayn]
Fluffy_Pillow 114.0/125 91% RP
-46222.7/16016286 -0% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, hemostasis, sanguine_ground, vampiric_blood, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:12.020Fheart_strike
[sanlayn]
Fluffy_Pillow 79.0/125 63% RP
430696.9/16016286 3% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:12.865Odeath_strike
[sanlayn]
Fluffy_Pillow 99.0/125 79% RP
1016721.8/16016286 6% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, dancing_rune_weapon, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:13.711Fheart_strike
[sanlayn]
Fluffy_Pillow 64.0/125 51% RP
2680558.5/12320220 22% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, dancing_rune_weapon, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:14.554Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 84.0/125 67% RP
3241708.6/12320220 26% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, dancing_rune_weapon, voracious, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:15.441Odeath_strike
[sanlayn]
Fluffy_Pillow 84.0/125 67% RP
4813891.5/12320220 39% HP
1.0/6 17% rune
icebound_fortitude, rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:16.283Fheart_strike
[sanlayn]
Fluffy_Pillow 49.0/125 39% RP
6448027.8/12320220 52% HP
2.0/6 33% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:17.126Odeath_strike
[sanlayn]
Fluffy_Pillow 66.0/125 53% RP
6849563.5/12320220 56% HP
1.0/6 17% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:17.970Fheart_strike
[sanlayn]
Fluffy_Pillow 31.0/125 25% RP
9549744.2/12320220 78% HP
2.0/6 33% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:18.814Odeath_strike
[sanlayn]
Fluffy_Pillow 51.0/125 41% RP
9955962.7/12320220 81% HP
1.0/6 17% rune
icebound_fortitude, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:19.659Fheart_strike
[sanlayn]
Fluffy_Pillow 16.0/125 13% RP
11866258.7/12320220 96% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:20.505Qheart_strike
[sanlayn]
Fluffy_Pillow 36.0/125 29% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:21.349Hheart_strike
[sanlayn]
Fluffy_Pillow 53.0/125 42% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), infliction_of_sorrow, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_mastery, frost_shield
4:22.303Bblood_boil
[sanlayn]
Fluffy_Pillow 70.0/125 56% RP
9103751.0/12320220 74% HP
0.0/6 0% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:23.257Sdeath_strike
[sanlayn]
Fluffy_Pillow 73.0/125 58% RP
8458042.5/12320220 69% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), hemostasis, sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_mastery
4:24.210Sdeath_strike
[sanlayn]
Fluffy_Pillow 38.0/125 30% RP
7389852.2/12320220 60% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), sanguine_ground, voracious, luck_of_the_draw, combat_analysis(10), flask_of_alchemical_chaos_vers
4:25.164Qheart_strike
[sanlayn]
Fluffy_Pillow 3.0/125 2% RP
10313564.2/12320220 84% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), crimson_scourge, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:26.119Tblood_boil
[sanlayn]
Fluffy_Pillow 20.0/125 16% RP
6839486.2/12320220 56% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(2), coagulopathy(5), crimson_scourge, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:27.074 Waiting0.475s 20.0/125 16% RP
6645205.1/12320220 54% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(2), coagulopathy(5), crimson_scourge, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:27.549Vheart_strike
[sanlayn]
Fluffy_Pillow 20.0/125 16% RP
6870033.2/12320220 56% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(2), coagulopathy(5), crimson_scourge, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:28.504Sdeath_strike
[sanlayn]
Fluffy_Pillow 37.0/125 30% RP
3165595.4/12320220 26% HP
1.0/6 17% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(2), coagulopathy(5), crimson_scourge, hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:29.4595vampiric_blood
[default]
Deadscrew 5.0/125 4% RP
6479543.7/12320220 53% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), blood_shield, bone_shield(10), ossuary, ossified_vitriol(2), coagulopathy(5), crimson_scourge, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:29.459Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 5.0/125 4% RP
8423406.8/16016286 53% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), blood_shield, bone_shield(10), ossuary, ossified_vitriol(2), coagulopathy(5), crimson_scourge, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:30.463Uconsumption
[sanlayn]
Fluffy_Pillow 5.0/125 4% RP
7789629.8/16016286 49% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(3), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:31.4183use_items
[default]
Fluffy_Pillow 8.0/125 6% RP
7604511.8/16016286 47% HP
4.0/6 67% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(3), coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:31.418Tblood_boil
[sanlayn]
Fluffy_Pillow 8.0/125 6% RP
7604511.8/16016286 47% HP
4.0/6 67% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(3), coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:32.373Vheart_strike
[sanlayn]
Fluffy_Pillow 8.0/125 6% RP
7660583.1/16016286 48% HP
5.0/6 83% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(3), coagulopathy(5), consumption, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:33.327Vheart_strike
[sanlayn]
Fluffy_Pillow 25.0/125 20% RP
7490276.9/16016286 47% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(3), coagulopathy(5), consumption, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:34.283Sdeath_strike
[sanlayn]
Fluffy_Pillow 42.0/125 34% RP
7532866.7/16016286 47% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(3), coagulopathy(5), consumption, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:35.235Qheart_strike
[sanlayn]
Fluffy_Pillow 7.0/125 6% RP
12375237.5/16016286 77% HP
4.0/6 67% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(3), coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:36.189Tblood_boil
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
13062271.2/16016286 82% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(3), coagulopathy(5), consumption, sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:37.145Vheart_strike
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
12493642.1/16016286 78% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(3), coagulopathy(5), hemostasis, sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:38.098Sdeath_strike
[sanlayn]
Fluffy_Pillow 41.0/125 33% RP
12852875.2/16016286 80% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), hemostasis, sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:39.052Vheart_strike
[sanlayn]
Fluffy_Pillow 9.0/125 7% RP
15458134.3/16016286 97% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:40.007Vheart_strike
[sanlayn]
Fluffy_Pillow 26.0/125 21% RP
12320220.0/12320220 100% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:40.962Sdeath_strike
[sanlayn]
Fluffy_Pillow 46.0/125 37% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:41.917Qheart_strike
[sanlayn]
Fluffy_Pillow 11.0/125 9% RP
12320220.0/12320220 100% HP
3.0/6 50% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:42.871Nmarrowrend
[sanlayn]
Fluffy_Pillow 31.0/125 25% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
rune_mastery, unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), crimson_scourge, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:43.827Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 51.0/125 41% RP
11640009.4/12320220 94% HP
0.0/6 0% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(12), ossuary, coagulopathy(5), crimson_scourge, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:44.829Jtombstone
[sanlayn]
Deadscrew 51.0/125 41% RP
11643150.5/12320220 95% HP
0.0/6 0% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:45.781Sdeath_strike
[sanlayn]
Fluffy_Pillow 81.0/125 65% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, funhouse_lens_crit, combat_analysis(10), flask_of_alchemical_chaos_vers
4:46.734Qheart_strike
[sanlayn]
Fluffy_Pillow 49.0/125 39% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:47.689Sdeath_strike
[sanlayn]
Fluffy_Pillow 66.0/125 53% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:48.642Tblood_boil
[sanlayn]
Fluffy_Pillow 31.0/125 25% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:49.597Vheart_strike
[sanlayn]
Fluffy_Pillow 31.0/125 25% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:50.552Sdeath_strike
[sanlayn]
Fluffy_Pillow 48.0/125 38% RP
12320220.0/12320220 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:51.507Vheart_strike
[sanlayn]
Fluffy_Pillow 13.0/125 10% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:52.462Tblood_boil
[sanlayn]
Fluffy_Pillow 30.0/125 24% RP
12320220.0/12320220 100% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, tombstone, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:53.417Vheart_strike
[sanlayn]
Fluffy_Pillow 30.0/125 24% RP
11758485.4/12320220 95% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:54.371Sdeath_strike
[sanlayn]
Fluffy_Pillow 50.0/125 40% RP
11801364.7/12320220 96% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, coagulopathy(5), hemostasis, sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:55.327Vheart_strike
[sanlayn]
Fluffy_Pillow 15.0/125 12% RP
12173448.3/12320220 99% HP
2.0/6 33% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:56.282Sdeath_strike
[sanlayn]
Fluffy_Pillow 35.0/125 28% RP
12316938.2/12320220 100% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(7), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:57.2365vampiric_blood
[default]
Deadscrew 0.0/125 0% RP
12097419.7/12320220 98% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(7), ossuary, coagulopathy(5), sanguine_ground, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:57.236Tblood_boil
[sanlayn]
Fluffy_Pillow 0.0/125 0% RP
15726645.6/16016286 98% HP
1.0/6 17% rune
unholy_ground, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(7), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers
4:58.191Vheart_strike
[sanlayn]
Fluffy_Pillow 3.0/125 2% RP
15788206.2/16016286 99% HP
2.0/6 33% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(7), ossuary, coagulopathy(5), hemostasis, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers, frost_shield
4:59.192Gdeath_and_decay
[sanlayn]
Fluffy_Pillow 20.0/125 16% RP
15286456.0/16016286 95% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(7), ossuary, coagulopathy(5), hemostasis, vampiric_blood, voracious, combat_analysis(10), flask_of_alchemical_chaos_vers

Stats

Level Bonus (80) Race Bonus (mechagnome) Raid-Buffed Unbuffed Gear Amount
Strength17647-2602265949341848 (36514)
Agility14647114648146480
Stamina86452-1616011569014260933
Intellect95292981695310
Spirit00000
Health12320220113802800
Runic Power1251250
Rune660
Spell Power981695310
Crit18.34%12.50%5251
Haste27.65%22.68%14971
Versatility8.79%5.37%4190
Mitigation Versatility4.40%2.69%4190
Attack Power7577069561469
Mastery37.79%32.02%5606
Armor621376213758620
Run Speed700
Leech3.00%3.00%0
Avoidance001575
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry22.25%18.37%5251
Tank-Block0.00%0.00%0
Tank-Crit-9.00%-9.00%0

Gear

Source Slot Average Item Level: 645.00
Local Head Mechforged Helm
ilevel: 639, stats: { 7,364 Armor, +24,202 Sta, +1,098 Haste, +925 Mastery, +3,794 StrInt }
Local Neck Enkindled Locket
ilevel: 619, stats: { +10,359 Sta, +3,094 Haste, +2,188 Mastery }, gems: { +147 Haste, +49 Mastery, +147 Haste, +49 Mastery }
Local Shoulders Bootleg Wrynn Shoulderplates
ilevel: 642, stats: { 6,876 Armor, +18,896 Sta, +1,001 Haste, +537 Mastery, +2,927 StrInt }
Local Shirt Precious's Ribbon
ilevel: 1
item effects: { equip: }
Local Chest Cauldron Champion's Ribcage
ilevel: 649, stats: { 10,452 Armor, +27,597 Sta, +661 Crit, +1,454 Haste, +4,165 StrInt }
Local Waist Mechforged Girdle
ilevel: 645, stats: { 5,733 Armor, +19,646 Sta, +913 Crit, +646 Haste, +3,009 StrInt }
Local Legs Cauldron Champion's Tattered Cuisses
ilevel: 649, stats: { 9,146 Armor, +27,597 Sta, +1,439 Crit, +676 Mastery, +4,165 StrInt }, enchant: { +895 Sta, +930 StrAgi (stormbound_armor_kit_3) }
Local Feet Aqirite-Toe Boots
ilevel: 642, stats: { 6,251 Armor, +18,896 Sta, +1,033 Crit, +505 Mastery, +2,927 StrInt }, enchant: { +895 Sta (defenders_march_3) }
Local Wrists Secret-Dredger's Armplates
ilevel: 649, stats: { 5,226 Armor, +15,523 Sta, +620 Crit, +569 Haste, +2,343 StrInt, +510 Avoidance }, enchant: { +710 Avoidance (whisper_of_armored_avoidance_3) }
Local Hands Junkreaver's Gauntlets
ilevel: 645, stats: { 5,733 Armor, +19,646 Sta, +980 Vers, +579 Mastery, +3,009 StrInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, enchant: { +315 Haste (radiant_haste_3) }, singing citrines: { Stormbringer's Runed Citrine, Seabed Leviathan's Citrine, Windsinger's Runed Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Expensive Gemstone Ring
ilevel: 645, stats: { +14,735 Sta, +4,378 Haste, +2,007 Vers }, gems: { +147 Haste, +49 Mastery, +147 Haste, +49 Mastery }, enchant: { +-115 Vers, +390 Haste (cursed_haste_3) }
Local Trinket1 Siphoning Lightbrand
ilevel: 649, stats: { +3,959 StrAgi }
item effects: { equip: Siphoning Lightbrand }
Local Trinket2 Funhouse Lens
ilevel: 649, stats: { +3,959 StrAgiInt }
item effects: { use: Funhouse Lens, equip: Funhouse Lens }
Local Back Consecrated Cloak
ilevel: 645, stats: { 1,839 Armor, +14,735 Sta, +585 Crit, +585 Haste, +2,257 StrAgiInt }, enchant: { +355 Avoidance (whisper_of_silken_avoidance_3) }
item effects: { equip: Elemental Focusing Lens }
Local Main Hand Oscillating Scrapcleaver
ilevel: 655, weapon: { 8,951 - 14,920, 3.6 }, stats: { +4,404 Str, +29,862 Sta, +853 Haste, +1,318 Vers }, enchant: rune_of_sanguination, temporary_enchant: Ironclaw Sharpened Weapon

Profile

deathknight="Deadscrew"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/deadscrew"
spec=blood
level=80
race=mechagnome
role=tank
position=front
talents=CoPAtbMOTHlnKIwUyAn+DK70SjhxYmZMjZmZYYmZmmhxMzYGzAAAAAwMzMzMzMzsZmZMAAAYmZmBAAAYmllxwYGzWjltlhJbDDbAYwG

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=beledars_bounty
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats
actions.precombat+=/deaths_caress

# Executed every time the actor is available.
actions=auto_attack
actions+=/use_item,name=tome_of_lights_devotion,if=buff.inner_resilience.up
actions+=/use_items
actions+=/blood_fury,if=buff.dancing_rune_weapon.up
actions+=/berserking,if=buff.dancing_rune_weapon.up
actions+=/ancestral_call,if=buff.dancing_rune_weapon.up
actions+=/fireblood,if=buff.dancing_rune_weapon.up
actions+=/potion,if=buff.dancing_rune_weapon.up
actions+=/vampiric_blood,if=!buff.vampiric_blood.up
actions+=/raise_dead
actions+=/blood_tap,if=(rune<=2&rune.time_to_3>gcd&charges_fractional>=1.8)
actions+=/blood_tap,if=(rune<=1&rune.time_to_3>gcd)
actions+=/run_action_list,name=deathbringer,if=hero_tree.deathbringer
actions+=/run_action_list,name=sanlayn,if=hero_tree.sanlayn

actions.deathbringer=rune_tap,if=rune>2
actions.deathbringer+=/dancing_rune_weapon
actions.deathbringer+=/death_strike,if=buff.coagulopathy.remains<=gcd
actions.deathbringer+=/marrowrend,if=!buff.bone_shield.up|buff.bone_shield.remains<1.5|buff.bone_shield.stack<=1
actions.deathbringer+=/marrowrend,if=(buff.exterminate.up)&(cooldown.reapers_mark.up|cooldown.reapers_mark.remains<3)
actions.deathbringer+=/deaths_caress,if=!buff.bone_shield.up|buff.bone_shield.remains<1.5|buff.bone_shield.stack<=1
actions.deathbringer+=/blood_boil,if=dot.blood_plague.remains<3
actions.deathbringer+=/bonestorm,if=buff.bone_shield.stack>=5&(!talent.shattering_bone.enabled|death_and_decay.ticking)&!buff.dancing_rune_weapon.remains
actions.deathbringer+=/soul_reaper,if=active_enemies<=2&buff.reaper_of_souls.up&target.time_to_die>(dot.soul_reaper.remains+5)
actions.deathbringer+=/soul_reaper,if=active_enemies<=2&target.time_to_pct_35<5&target.time_to_die>(dot.soul_reaper.remains+5)
actions.deathbringer+=/death_and_decay,if=((dot.reapers_mark.ticking)&!death_and_decay.ticking)|!buff.death_and_decay.up
actions.deathbringer+=/marrowrend,if=buff.exterminate.up
actions.deathbringer+=/bonestorm,if=buff.bone_shield.stack>=5&(!talent.shattering_bone.enabled|death_and_decay.ticking)&buff.dancing_rune_weapon.remains
actions.deathbringer+=/death_strike,if=(runic_power.deficit<35|(runic_power.deficit<41&buff.dancing_rune_weapon.up))
actions.deathbringer+=/reapers_mark
actions.deathbringer+=/marrowrend,if=buff.bone_shield.stack<6&!dot.bonestorm.ticking
actions.deathbringer+=/tombstone,if=buff.bone_shield.stack>=8&(!talent.shattering_bone.enabled|death_and_decay.ticking)&cooldown.dancing_rune_weapon.remains>=25
actions.deathbringer+=/abomination_limb,if=!buff.dancing_rune_weapon.up
actions.deathbringer+=/blood_boil,if=pet.dancing_rune_weapon.active&!drw.bp_ticking
actions.deathbringer+=/any_dnd,if=!buff.death_and_decay.remains
actions.deathbringer+=/blooddrinker,if=!buff.dancing_rune_weapon.up&active_enemies<=2&buff.coagulopathy.remains>3
actions.deathbringer+=/death_strike
actions.deathbringer+=/consumption
actions.deathbringer+=/blood_boil,if=charges_fractional>=1.5
actions.deathbringer+=/heart_strike,if=rune>=1|rune.time_to_2<gcd
actions.deathbringer+=/blood_boil
actions.deathbringer+=/heart_strike
actions.deathbringer+=/soul_reaper,if=buff.reaper_of_souls.up
actions.deathbringer+=/arcane_torrent,if=runic_power.deficit>20
actions.deathbringer+=/deaths_caress,if=buff.bone_shield.stack<11

actions.sanlayn=variable,name=death_strike_dump_drw_amount,value=80
actions.sanlayn+=/variable,name=death_strike_dump_amount,value=35
actions.sanlayn+=/variable,name=death_strike_pre_essence_dump_amount,value=20
actions.sanlayn+=/variable,name=death_strike_sang_low_hp,value=40
actions.sanlayn+=/variable,name=death_strike_pre_essence_dump_amount_low_hp,value=70
actions.sanlayn+=/variable,name=bone_shield_refresh_value,value=7
actions.sanlayn+=/variable,name=heart_strike_rp_drw,value=(21+spell_targets.heart_strike*talent.heartbreaker.enabled*2)
actions.sanlayn+=/death_strike,if=buff.coagulopathy.remains<=gcd
actions.sanlayn+=/deaths_caress,if=!buff.bone_shield.up
actions.sanlayn+=/blood_boil,if=!dot.blood_plague.ticking|(dot.blood_plague.remains<10&buff.dancing_rune_weapon.up)
actions.sanlayn+=/potion,if=buff.dancing_rune_weapon.up
actions.sanlayn+=/consumption,if=pet.dancing_rune_weapon.active&pet.dancing_rune_weapon.remains<=3
actions.sanlayn+=/bonestorm,if=(buff.death_and_decay.up)&buff.bone_shield.stack>5&cooldown.dancing_rune_weapon.remains
actions.sanlayn+=/death_strike,if=runic_power>=108
actions.sanlayn+=/heart_strike,if=buff.dancing_rune_weapon.up&rune>1
actions.sanlayn+=/death_and_decay,if=!buff.death_and_decay.up
actions.sanlayn+=/heart_strike,if=buff.infliction_of_sorrow.up&buff.death_and_decay.up
actions.sanlayn+=/raise_dead
actions.sanlayn+=/abomination_limb
actions.sanlayn+=/tombstone,if=(!buff.dancing_rune_weapon.up&buff.death_and_decay.up)&buff.bone_shield.stack>5&runic_power.deficit>=30&cooldown.dancing_rune_weapon.remains>=25&buff.coagulopathy.remains>2*gcd
actions.sanlayn+=/dancing_rune_weapon,if=buff.coagulopathy.remains>=2*gcd&(!buff.essence_of_the_blood_queen.up|buff.essence_of_the_blood_queen.remains>=3*gcd)&(!buff.dancing_rune_weapon.up|buff.dancing_rune_weapon.remains>=6*gcd)
actions.sanlayn+=/death_strike,if=!buff.vampiric_strike.up&cooldown.dancing_rune_weapon.remains<=10&(target.health.pct<variable.death_strike_sang_low_hp&runic_power>variable.death_strike_pre_essence_dump_amount_low_hp)&buff.essence_of_the_blood_queen.stack>=3
actions.sanlayn+=/death_strike,if=!buff.vampiric_strike.up&cooldown.dancing_rune_weapon.remains<=10&(target.health.pct>variable.death_strike_sang_low_hp&runic_power>variable.death_strike_pre_essence_dump_amount)&buff.essence_of_the_blood_queen.stack>=3
actions.sanlayn+=/marrowrend,if=!dot.bonestorm.ticking&(buff.bone_shield.stack<variable.bone_shield_refresh_value&runic_power.deficit>20|buff.bone_shield.remains<=3)
actions.sanlayn+=/marrowrend,if=!dot.bonestorm.ticking&(buff.bone_shield.stack<variable.bone_shield_refresh_value&runic_power.deficit>20&!cooldown.dancing_rune_weapon.up|buff.bone_shield.remains<=3)
actions.sanlayn+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>(dot.soul_reaper.remains+5)
actions.sanlayn+=/death_strike,if=buff.dancing_rune_weapon.up&(buff.coagulopathy.remains<2*gcd|(target.health.pct<variable.death_strike_sang_low_hp&runic_power>50))
actions.sanlayn+=/death_strike,if=buff.dancing_rune_weapon.up&(buff.coagulopathy.remains<2*gcd|(runic_power.deficit<=variable.heart_strike_rp_drw&debuff.incite_terror.stack>=3))
actions.sanlayn+=/heart_strike,if=buff.vampiric_strike.up|buff.infliction_of_sorrow.up&((talent.consumption.enabled&buff.consumption.up)|!talent.consumption.enabled)&dot.blood_plague.ticking&dot.blood_plague.remains>20
actions.sanlayn+=/dancing_rune_weapon,if=buff.coagulopathy.up
actions.sanlayn+=/death_strike,if=runic_power.deficit<=variable.heart_strike_rp_drw|runic_power>=variable.death_strike_dump_amount
actions.sanlayn+=/blood_boil,if=charges>=2|(full_recharge_time<=gcd.max)
actions.sanlayn+=/consumption,if=cooldown.dancing_rune_weapon.remains>20
actions.sanlayn+=/heart_strike,if=rune>1
actions.sanlayn+=/bonestorm,if=buff.death_and_decay.up&buff.bone_shield.stack>5&cooldown.dancing_rune_weapon.remains
actions.sanlayn+=/tombstone,if=buff.death_and_decay.up&buff.bone_shield.stack>5&runic_power.deficit>=30&cooldown.dancing_rune_weapon.remains

head=mechforged_helm,id=233452,bonus_id=6652/12176/11964/11974/1511/10255
neck=enkindled_locket,id=219184,bonus_id=6652/10266/3198/10255/10879/10396,gems=147haste_49mastery_147haste_49mastery
shoulders=bootleg_wrynn_shoulderplates,id=232661,bonus_id=10844/6652/11966/10354/11979/1491/10255
back=consecrated_cloak,id=222817,bonus_id=10421/9633/8902/9627/12040/10520/8960/8790,enchant=whisper_of_silken_avoidance_3,crafted_stats=haste/crit
chest=cauldron_champions_ribcage,id=229256,bonus_id=11958/6652/12178/11985/1498/10255
shirt=preciouss_ribbon,id=52019
wrists=secretdredgers_armplates,id=211036,bonus_id=11985/40/12176/11964/3228/10255,enchant=whisper_of_armored_avoidance_3
hands=junkreavers_gauntlets,id=235457,bonus_id=6652/11964/11980/3328/10255
waist=mechforged_girdle,id=233449,bonus_id=6652/12176/11964/11976/1517/10255
legs=cauldron_champions_tattered_cuisses,id=229252,bonus_id=6652/11985/12178/11961/1498,enchant=stormbound_armor_kit_3
feet=aqiritetoe_boots,id=232384,bonus_id=11964/11975/3291/10255,enchant=defenders_march_3
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228638/228647/228640/0,enchant=radiant_haste_3
finger2=expensive_gemstone_ring,id=235423,bonus_id=6652/10879/10396/11980/3328/10255,gems=147haste_49mastery_147haste_49mastery,enchant=cursed_haste_3
trinket1=siphoning_lightbrand,id=225653,bonus_id=6652/11985/3178/10255
trinket2=funhouse_lens,id=234217,bonus_id=6652/11985/1521/10255
main_hand=oscillating_scrapcleaver,id=235492,bonus_id=6652/11983/9465/10255,enchant=rune_of_sanguination

# Gear Summary
# gear_ilvl=645.33
# gear_strength=41848
# gear_stamina=260933
# gear_attack_power=469
# gear_crit_rating=5251
# gear_haste_rating=14971
# gear_mastery_rating=5606
# gear_versatility_rating=4190
# gear_avoidance_rating=1575
# gear_armor=58620
# set_bonus=thewarwithin_season_2_2pc=1

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 74267510
Max Event Queue: 114
Sim Seconds: 3006661
CPU Seconds: 85.6454
Physical Seconds: 34.3546
Speed Up: 35106

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Deadscrew Deadscrew abomination_limb ticks -383269 3829411 12765 7.62 85806 171396 3.0 38.1 17.2% 0.0% 0.0% 0.0% 120.41sec 3829411 299.98sec
Deadscrew Deadscrew augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Deadscrew Deadscrew auto_attack_mh 0 14723451 49082 41.78 60708 121536 208.9 208.9 16.1% 0.0% 0.0% 0.0% 1.72sec 21033480 299.98sec
Deadscrew Deadscrew blood_beast_summon 434237 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.58sec 0 299.98sec
Deadscrew Deadscrew blood_boil 50842 9674076 32249 8.47 197545 394344 42.3 42.3 15.7% 0.0% 0.0% 0.0% 6.81sec 9674076 299.98sec
Deadscrew Deadscrew blood_draw 374606 940504 3135 0.45 360776 720802 2.2 2.2 16.5% 0.0% 0.0% 0.0% 126.56sec 940504 299.98sec
Deadscrew Deadscrew blood_plague ticks -55078 10339431 34465 23.72 75369 149328 43.4 118.6 16.0% 0.0% 0.0% 0.0% 7.10sec 10339431 299.98sec
Deadscrew Deadscrew blood_plague_heal 55078 13501457 45008 23.72 98838 193303 118.6 118.6 15.9% 0.0% 0.0% 0.0% 2.52sec 20846625 299.98sec
Deadscrew Deadscrew blood_shield 77535 63799401 212682 37.82 337376 0 90.5 189.1 0.0% 0.0% 0.0% 0.0% 3.29sec 72883378 299.98sec
Deadscrew Deadscrew bonestorm ticks -194844 5390613 17969 10.60 86602 173232 5.4 53.0 17.4% 0.0% 0.0% 0.0% 60.41sec 5390613 299.98sec
Deadscrew Deadscrew bonestorm_heal 196545 15551607 51843 10.60 293448 0 53.0 53.0 0.0% 0.0% 0.0% 0.0% 5.24sec 17209687 299.98sec
Deadscrew Deadscrew consumption 274156 1679700 5599 1.64 177236 354883 8.2 8.2 15.8% 0.0% 0.0% 0.0% 37.27sec 2399568 299.98sec
Deadscrew Deadscrew consumption_heal 274156 1560337 5202 1.64 190711 0 8.2 8.2 0.0% 0.0% 0.0% 0.0% 37.27sec 2828438 299.98sec
Deadscrew Deadscrew dancing_rune_weapon 49028 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 49.91sec 0 299.98sec
Deadscrew Deadscrew_dancing_rune_weapon auto_attack_mh 0 3430423 39309 59.97 33692 67354 87.2 87.2 16.7% 0.0% 0.0% 0.0% 3.60sec 4900600 87.27sec
Deadscrew Deadscrew_dancing_rune_weapon blood_plague ticks -55078 2345553 7819 10.18 39783 79721 5.2 50.9 15.7% 0.0% 0.0% 0.0% 72.91sec 2345553 87.27sec
Deadscrew Deadscrew_dancing_rune_weapon blood_boil 50842 654308 7498 3.56 109459 219022 5.2 5.2 15.4% 0.0% 0.0% 0.0% 73.01sec 654308 87.27sec
Deadscrew Deadscrew_dancing_rune_weapon deaths_caress 195292 29 0 0.00 36217 71422 0.0 0.0 33.3% 0.0% 0.0% 0.0% 0.00sec 29 87.27sec
Deadscrew Deadscrew_dancing_rune_weapon death_strike 49998 22909699 262521 35.08 385474 767836 51.0 51.0 16.6% 0.0% 0.0% 0.0% 10.96sec 32728109 87.27sec
Deadscrew Deadscrew_dancing_rune_weapon consumption 274156 1183705 13564 7.09 97901 194957 10.3 10.3 17.4% 0.0% 0.0% 0.0% 53.60sec 1691005 87.27sec
Deadscrew Deadscrew_dancing_rune_weapon vampiric_strike 433895 25199043 288754 87.64 169499 338364 127.5 127.5 16.7% 0.0% 0.0% 0.0% 4.42sec 25199043 87.27sec
Deadscrew Deadscrew death_and_decay ticks -43265 4243563 14145 0.00 16701 33341 20.3 0.0 15.9% 0.0% 0.0% 0.0% 15.14sec 4243563 299.98sec
Deadscrew Deadscrew death_strike 49998 123420925 411436 18.10 1178653 2332712 90.5 90.5 16.1% 0.0% 0.0% 0.0% 3.29sec 176315431 299.98sec
Deadscrew Deadscrew death_strike_heal 45470 107034879 356811 18.10 1182784 0 90.5 90.5 0.0% 0.0% 0.0% 0.0% 3.29sec 167305015 299.98sec
Deadscrew Deadscrew deaths_caress 195292 55638 185 0.21 45327 90419 0.1 1.1 14.6% 0.0% 0.0% 0.0% 82.03sec 55638 299.98sec
Deadscrew Deadscrew flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Deadscrew Deadscrew food 454149 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Deadscrew Deadscrew frost_shield 207203 5270214 17569 68.61 15365 0 208.9 343.0 0.0% 0.0% 0.0% 0.0% 1.72sec 8449253 299.98sec
Deadscrew Deadscrew funhouse_lens 1214603 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.46sec 0 299.98sec
Deadscrew Deadscrew heart_strike 206930 10618982 35399 11.16 164584 328593 144.0 55.8 15.7% 0.0% 0.0% 0.0% 2.05sec 15169960 299.98sec
Deadscrew Deadscrew vampiric_strike 433895 35516817 118399 17.63 346097 689720 88.2 88.2 16.5% 0.0% 0.0% 0.0% 3.32sec 35516817 299.98sec
Deadscrew Deadscrew infliction_of_sorrow 434144 37644728 125492 18.85 345287 674979 94.3 94.3 16.4% 0.0% 0.0% 0.0% 3.10sec 37644728 299.98sec
Deadscrew Deadscrew the_blood_is_life 434246 14765237 49221 1.66 1774803 0 8.3 8.3 0.0% 0.0% 0.0% 0.0% 31.52sec 14765237 299.98sec
Deadscrew Deadscrew_blood_beast auto_attack_mh 0 2410023 32298 103.01 16176 32377 128.1 128.1 16.3% 0.0% 0.0% 0.0% 1.95sec 3442887 74.62sec
Deadscrew Deadscrew_blood_beast corrupted_blood 434574 3330318 44632 24.29 94989 190032 30.2 30.2 16.1% 0.0% 0.0% 0.0% 8.50sec 3330318 74.62sec
Deadscrew Deadscrew leech 143924 37171960 123916 68.59 108389 0 342.9 342.9 0.0% 0.0% 0.0% 0.0% 0.87sec 61067308 299.98sec
Deadscrew Deadscrew marrowrend 195182 1881450 6272 1.69 191600 381063 8.5 8.5 16.4% 0.0% 0.0% 0.0% 37.17sec 2687782 299.98sec
Deadscrew Deadscrew potion 431932 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 303.91sec 0 299.98sec
Deadscrew Deadscrew raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.27sec 0 299.98sec
Deadscrew Deadscrew_ghoul auto_attack_mh 0 6146971 37310 52.31 36819 73669 143.7 143.7 16.2% 0.0% 0.0% 0.0% 1.97sec 8781379 164.75sec
Deadscrew Deadscrew_ghoul claw 91776 2919946 17723 27.72 32993 65959 76.1 76.1 16.3% 0.0% 0.0% 0.0% 3.77sec 4171347 164.75sec
Deadscrew Deadscrew_ghoul gnaw 91800 3773 23 1.08 1094 2167 3.0 3.0 16.3% 0.0% 0.0% 0.0% 120.24sec 5390 164.75sec
Deadscrew Deadscrew rune_of_sanguination ticks -326808 8399772 27999 1.65 1020930 0 1.0 8.2 0.0% 0.0% 0.0% 0.0% 305.67sec 12548547 299.98sec
Deadscrew Deadscrew seabed_leviathans_citrine 468990 98414 328 1.08 15622 31379 5.4 5.4 16.9% 0.0% 0.0% 0.0% 35.97sec 98414 299.98sec
Deadscrew Deadscrew shattering_bone 377642 6122814 20411 8.61 122101 246385 43.0 43.0 16.2% 0.0% 0.0% 0.0% 6.86sec 6122814 299.98sec
Deadscrew Deadscrew tombstone 219809 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 66.61sec 0 299.98sec
Deadscrew Deadscrew vampiric_blood 55233 0 0 0.00 0 0 11.4 0.0 0.0% 0.0% 0.0% 0.0% 27.72sec 0 299.98sec
Deadscrew Deadscrew vampiric_strike_heal 434422 14195134 47321 17.63 109757 419470 88.2 88.2 16.5% 0.0% 0.0% 0.0% 3.32sec 21430421 299.98sec

Fluffy_Pillow : 841,966 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
841,966.3841,966.30.0 / 0.000%0.0 / 0.0%0.7
Resource Out In Waiting APM Active
Health1,142,710.90.046.46%3.4100.0%

Scale Factors for other metrics

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Fluffy_Pillow841,966
melee_main_hand_Deadscrew 558,51066.3%77.53.75s2,159,9991,080,003Direct77.53,030,51702,159,9570.0%28.7%

Stats Details: Melee Main Hand Deadscrew

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage77.4977.490.000.000.002.00000.0000167,386,452.82441,873,730.0262.12%1,080,003.181,080,003.18
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.27%55.2336753,030,516.9405,234,8373,028,968.182,654,6173,301,250167,386,453441,873,73062.14%
parry28.73%22.269410.00000.0000000.00%

Action Details: Melee Main Hand Deadscrew

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7840000.00
  • base_dd_max:8160000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
melee_nuke_Deadscrew 100,93112.0%5.559.57s5,518,8082,753,382Direct5.55,518,87505,518,8750.0%0.0%

Stats Details: Melee Nuke Deadscrew

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.475.470.000.000.002.00450.000030,163,304.5165,589,934.9454.01%2,753,382.432,753,382.43
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%5.47465,518,875.0307,658,8655,519,546.053,738,1916,205,30830,163,30565,589,93554.01%

Action Details: Melee Nuke Deadscrew

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11760000.00
  • base_dd_max:12240000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Action Priority List

    default
    [2]:5.50
spell_dot_Deadscrew 182,52521.7%5.361.01s10,250,01810,205,550Periodic144.8378,0000378,0000.0%0.0%96.5%

Stats Details: Spell Dot Deadscrew

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.340.00144.79144.790.001.00452.000054,732,367.27115,831,343.1352.75%185,569.9310,205,550.49
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%144.79115174378,000.010764,821378,263.55305,165437,93654,732,367115,831,34352.72%

Action Details: Spell Dot Deadscrew

  • id:0
  • school:physical
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_cast_speed
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:800000.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:60.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Action Priority List

    default
    [3]:5.36
Simple Action Stats Execute Interval
Fluffy_Pillow
pause_action 4.560.01s

Stats Details: Pause Action

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.500.000.000.000.0030.00450.00000.000.000.00%0.000.00

Action Details: Pause Action

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:30.00
  • base_crit:0.00
  • target:Deadscrew
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [4]:5.00
  • if_expr:time>=30
    default
    [4]:5.00
  • if_expr:time>=30
tank_heal 60.55.00s

Stats Details: Tank Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal60.500.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Tank Heal

  • id:0
  • school:holy
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1500000.00
  • base_dd_max:1500000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle14.83.019.4s15.9s5.5s27.10%0.00%3.0 (3.0)14.5

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.6s / 184.6s
  • trigger_min/max:1.8s / 184.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.1s
  • uptime_min/max:8.05% / 50.55%

Stack Uptimes

  • brittle_1:27.10%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Incite Terror1.0143.0148.4s2.0s292.0s98.17%0.00%138.9 (138.9)0.0

Buff Details

  • buff initial source:Deadscrew
  • cooldown name:buff_incite_terror
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.3s / 301.4s
  • trigger_min/max:0.8s / 24.9s
  • trigger_pct:100.00%
  • duration_min/max:1.6s / 354.7s
  • uptime_min/max:94.21% / 98.53%

Stack Uptimes

  • incite_terror_1:0.26%
  • incite_terror_2:0.26%
  • incite_terror_3:0.26%
  • incite_terror_4:0.26%
  • incite_terror_5:97.13%

Spelldata

  • id:458478
  • name:Incite Terror
  • tooltip:Taking {$=}w1% increased Shadow damage from {$@=}auracaster.
  • description:{$@spelldesc434151=Vampiric Strike and {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] cause your targets to take {$458478s1=1}% increased Shadow damage, up to {$=}{{$458478s1=1}*{$458478=}U}% for {$458478d=15 seconds}. Vampiric Strike benefits from Incite Terror at {$s2=400}% effectiveness.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
delayed_aa_cast5.04.06.060.0s60.0s60.0s

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 299.98
Minimum 240.01
Maximum 359.96
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 841966.32
Minimum 661077.13
Maximum 998704.95
Spread ( max - min ) 337627.82
Range [ ( max - min ) / 2 * 100% ] 20.05%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 841966.32
Minimum 661077.13
Maximum 998704.95
Spread ( max - min ) 337627.82
Range [ ( max - min ) / 2 * 100% ] 20.05%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 252282124.61
Minimum 168195888.01
Maximum 332377830.59
Spread ( max - min ) 164181942.58
Range [ ( max - min ) / 2 * 100% ] 32.54%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 1172252.72
Minimum 1021941.39
Maximum 1337391.10
Spread ( max - min ) 315449.71
Range [ ( max - min ) / 2 * 100% ] 13.45%
Standard Deviation 41361.3041
5th Percentile 1105769.53
95th Percentile 1241555.00
( 95th Percentile - 5th Percentile ) 135785.47
Mean Distribution
Standard Deviation 413.6337
95.00% Confidence Interval ( 1171442.01 - 1173063.43 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4783
0.1 Scale Factor Error with Delta=300 14604010
0.05 Scale Factor Error with Delta=300 58416040
0.01 Scale Factor Error with Delta=300 1460400979
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=8000000,range=160000,attack_speed=2,aoe_tanks=1
2 5.50 melee_nuke,damage=12000000,range=240000,attack_speed=2,cooldown=30,aoe_tanks=1
3 5.36 spell_dot,damage=800000,range=16000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
4 5.00 pause_action,duration=30,cooldown=30,if=time>=30

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health02861474430
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=8000000,range=160000,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=12000000,range=240000,attack_speed=2,cooldown=30,aoe_tanks=1
actions+=/spell_dot,damage=800000,range=16000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
actions+=/pause_action,duration=30,cooldown=30,if=time>=30


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.