SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.7.58187 Live (hotfix 2024-12-19/58187, git build 10e9fb804b)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Raid Summary

Raid Event List
0 heal,name=tank_heal,amount=1500000,cooldown=5.0,duration=0,player_if=role.tank

DPS Scale Factors (dps increase per unit stat)

Profile Str Sta Crit Haste Mastery Vers Wdps wowhead
Dano 9.27 -0.03 6.96 9.76 5.69 6.14 49.42 wowhead

Dano : 522,996 dps, 625,250 dtps, 134,499 hps (62,473 aps)

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
522,995.9522,995.9451.8 / 0.086%90,677.8 / 17.3%-1.0
HPS HPS(e) HPS Error HPS Range HPR
72,025.972,025.9419.0 / 0.582%83,857.7 / 116.4%-1.0
APS APS Error APS Range APR
62,473.3911.8 / 1.459%38,594.7 / 61.8%-1.0
DTPS DTPS Error DTPS Range
625,250.0568.27 / 0.09%115,084 / 18.4%
Resource Out In Waiting APM Active
Mana0.00.00.00%72.5100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/dano
TalentCIEA5ba6OK14IUITjS1kSUVJctNjBzyYZegZMzMLbzMzYGjZMAAADAAAAAAAt1MzsYYmhxMs1CAMGYAMw2AAAgAMzsss02MjFzAAAzwYA
Set Bonus
Scale Factors for Dano Damage Per Second
Wdps Haste Str Crit Vers Mastery Sta
Scale Factors 49.42 9.76 9.27 6.96 6.14 5.69 -0.03
Normalized 5.33 1.05 1.00 0.75 0.66 0.61 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.31 0.28 0.28 0.28 0.28 0.28 0.27
Ranking
  • Wdps > Haste > Str > Crit > Vers > Mastery > Sta
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=9.27, Stamina=-0.03, CritRating=6.96, HasteRating=9.76, MasteryRating=5.69, Versatility=6.14, Dps=49.42 )

Scale Factors for other metrics

Scale Factors for Dano Priority Target Damage Per Second
Wdps Haste Str Crit Vers Mastery Sta
Scale Factors 49.42 9.76 9.27 6.96 6.14 5.69 -0.03
Normalized 5.33 1.05 1.00 0.75 0.66 0.61 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.31 0.28 0.28 0.28 0.28 0.28 0.27
Ranking
  • Wdps > Haste > Str > Crit > Vers > Mastery > Sta
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=9.27, Stamina=-0.03, CritRating=6.96, HasteRating=9.76, MasteryRating=5.69, Versatility=6.14, Dps=49.42 )
Scale Factors for Dano Damage Per Second (Effective)
Wdps Haste Str Crit Vers Mastery Sta
Scale Factors 49.42 9.76 9.27 6.96 6.14 5.69 -0.03
Normalized 5.33 1.05 1.00 0.75 0.66 0.61 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Haste > Str > Crit > Vers > Mastery > Sta
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=9.27, Stamina=-0.03, CritRating=6.96, HasteRating=9.76, MasteryRating=5.69, Versatility=6.14, Dps=49.42 )
Scale Factors for Dano Healing Per Second
Wdps Haste Str Mastery Vers Crit Sta
Scale Factors 5.01 1.91 0.69 0.28 0.24 0.09 -0.06
Normalized 7.25 2.77 1.00 0.41 0.34 0.14 -0.08
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.28 0.26 0.26 0.26 0.26 0.26 0.26
Ranking
  • Wdps > Haste > Str > Mastery ~= Vers ~= Crit ~= Sta
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=0.69, Stamina=-0.06, CritRating=0.09, HasteRating=1.91, MasteryRating=0.28, Versatility=0.24, Dps=5.01 )
Scale Factors for Dano Healing Per Second (Effective)
Wdps Haste Str Mastery Vers Crit Sta
Scale Factors 5.01 1.91 0.69 0.28 0.24 0.09 -0.06
Normalized 7.25 2.77 1.00 0.41 0.34 0.14 -0.08
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Haste > Str > Mastery > Vers > Crit > Sta
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=0.69, Stamina=-0.06, CritRating=0.09, HasteRating=1.91, MasteryRating=0.28, Versatility=0.24, Dps=5.01 )
Scale Factors for Dano Absorb Per Second
Wdps Str Mastery Haste Sta Vers Crit
Scale Factors 1.90 0.60 0.28 0.25 0.18 0.08 -0.27
Normalized 3.17 1.00 0.47 0.42 0.29 0.14 -0.44
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.52 0.55 0.54 0.53 0.56 0.53 0.51
Ranking
  • Wdps > Str ~= Mastery ~= Haste ~= Sta ~= Vers ~= Crit
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=0.60, Stamina=0.18, CritRating=-0.27, HasteRating=0.25, MasteryRating=0.28, Versatility=0.08, Dps=1.90 )
Scale Factors for Healing + Absorb per second
Wdps Haste Str Mastery Vers Sta Crit
Scale Factors 6.91 2.16 1.29 0.56 0.32 0.12 -0.17
Normalized 5.36 1.68 1.00 0.44 0.25 0.09 -0.13
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.59 0.59 0.61 0.59 0.59 0.62 0.57
Ranking
  • Wdps > Haste > Str > Mastery ~= Vers ~= Sta ~= Crit
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=1.29, Stamina=0.12, CritRating=-0.17, HasteRating=2.16, MasteryRating=0.56, Versatility=0.32, Dps=6.91 )
Scale Factors for Dano Damage Taken Per Second
Vers Crit Mastery Str Wdps Haste Sta
Scale Factors -5.27 -4.29 -4.12 -3.37 -2.47 -1.92 -0.29
Normalized 1.56 1.27 1.22 1.00 0.73 0.57 0.08
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.34 0.35 0.35 0.35 0.35 0.35 0.35
Ranking
  • Vers > Crit ~= Mastery > Str > Wdps > Haste > Sta
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=3.37, Stamina=0.29, CritRating=4.29, HasteRating=1.92, MasteryRating=4.12, Versatility=5.27, Dps=2.47 )
Scale Factors for Dano Damage Taken
Vers Crit Mastery Str Wdps Haste Sta
Scale Factors -1574.18 -1282.01 -1225.70 -991.44 -735.65 -562.22 -69.25
Normalized 1.59 1.29 1.24 1.00 0.74 0.57 0.07
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Vers > Crit > Mastery > Str > Wdps > Haste > Sta
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=991.44, Stamina=69.25, CritRating=1282.01, HasteRating=562.22, MasteryRating=1225.70, Versatility=1574.18, Dps=735.65 )
Scale Factors for Dano Healing Taken Per Second
Wdps Haste Str Mastery Vers Crit Sta
Scale Factors 4.10 1.85 0.50 0.10 -0.02 -0.04 -0.07
Normalized 8.25 3.72 1.00 0.20 -0.05 -0.07 -0.13
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Haste > Str > Mastery > Vers > Crit > Sta
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=0.50, Stamina=-0.07, CritRating=-0.04, HasteRating=1.85, MasteryRating=0.10, Versatility=-0.02, Dps=4.10 )
Scale Factors for Dano Fight Length
Sta Vers Crit Haste Str Mastery Wdps
Scale Factors 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Normalized 1.54 1.53 1.00 1.00 1.00 0.49 0.47
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Sta > Vers > Crit > Haste > Str > Mastery > Wdps
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=0.00, Stamina=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=0.00, Versatility=0.00, Dps=0.00 )
Scale Factors for Raid Damage Per Second
Wdps Haste Str Crit Vers Mastery Sta
Scale Factors 49.42 9.76 9.27 6.96 6.14 5.69 -0.03
Normalized 5.33 1.05 1.00 0.75 0.66 0.61 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.31 0.28 0.28 0.28 0.28 0.28 0.27
Ranking
  • Wdps > Haste > Str > Crit > Vers > Mastery > Sta
Pawn string ( Pawn: v1: "Dano-Protection": Class=Paladin, Spec=Protection, Strength=9.27, Stamina=-0.03, CritRating=6.96, HasteRating=9.76, MasteryRating=5.69, Versatility=6.14, Dps=49.42 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Dano522,996
Avenger's Shield 9,4921.8%20.614.15s138,395114,385Direct20.6102,440220,084138,46130.6%

Stats Details: Avengers Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage20.5720.560.000.000.001.21000.00002,847,151.562,847,151.560.00%114,384.78114,384.78
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.39%14.27524102,440.2686,320145,638102,316.6989,629115,3811,461,6191,461,6190.00%
crit30.61%6.30016220,084.41177,768291,277220,214.050276,6861,385,5331,385,5330.00%

Action Details: Avengers Shield

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=false}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Action Priority List

    standard
    [R]:20.57
  • if_expr:!talent.lights_guidance.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Blessed Hammer 0 (44,119)0.0% (8.4%)75.33.94s175,715147,169

Stats Details: Blessed Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage75.320.000.000.000.001.19400.00000.000.000.00%147,169.20147,169.20

Action Details: Blessed Hammer

  • id:204019
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:5.000
  • cooldown hasted:true
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Spelldata

  • id:204019
  • name:Blessed Hammer
  • school:holy
  • tooltip:
  • description:Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    standard
    [J]:35.12
  • if_expr:buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3&!buff.avenging_wrath.up
    standard
    [Q]:34.01
  • if_expr:(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
    standard
    [V]:6.19

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown Duration (Category)Paladin1370265SET1.000
    Blessed Hammer (_tick) 44,1198.4%0.00.00s00Periodic150.063,722139,91888,20732.1%0.0%

Stats Details: Blessed Hammer Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00150.040.000.00000.000013,235,073.2613,235,073.260.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit67.86%101.836214563,721.8318,61594,22263,693.1856,72669,7316,488,5236,488,5230.00%
crit32.14%48.222182139,918.0038,336188,445139,920.48118,314155,1696,746,5506,746,5500.00%

Action Details: Blessed Hammer Tick

  • id:204301
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:9.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:204301
  • name:Blessed Hammer
  • school:holy
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Consecration 0 (8,694)0.0% (1.7%)13.721.54s190,001168,026

Stats Details: Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.700.000.000.000.001.13080.00000.000.000.00%168,026.25168,026.25

Action Details: Consecration

  • id:26573
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:4.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=false}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=true}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Action Priority List

    standard
    [S]:12.47
  • if_expr:!consecration.up
    standard
    [X]:0.23

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    Consecration (_tick) 8,6941.7%0.00.00s00Periodic235.48,15817,55211,05930.9%0.0%

Stats Details: Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00235.430.000.00000.00002,603,734.702,603,734.700.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit69.12%162.72852428,157.586,87311,5978,153.917,5068,8001,327,4651,327,4650.00%
crit30.88%72.712813317,552.2114,15523,19317,537.1815,83919,2171,276,2701,276,2700.00%

Action Details: Consecration Tick

  • id:81297
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Divine Toll 0 (10,234)0.0% (2.0%)5.460.97s569,041477,686

Stats Details: Divine Toll

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.390.000.000.000.001.19130.00000.000.000.00%477,685.78477,685.78

Action Details: Divine Toll

  • id:375576
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:375576
  • name:Divine Toll
  • school:holy
  • tooltip:
  • description:Instantly cast {$?a137029=false}[Holy Shock]?a137028[Avenger's Shield]?a137027[Judgment][Holy Shock, Avenger's Shield, or Judgment] on up to {$s1=5} targets within {$=}A2 yds.{$?=}c3[ Divine Toll's Judgment deals {$326011s1=100}% increased damage.][]{$?=}c2[ Generates {$s5=1} Holy Power per target hit.][]

Action Priority List

    standard
    [M]:5.39
  • if_expr:(!raid_event.adds.exists|raid_event.adds.in>10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Global CooldownPaladin1370268SET1.000
    Avenger's Shield (_dt) 2,6740.5%5.460.97s148,2340Direct5.4107,055229,665148,30133.6%

Stats Details: Avengers Shield Dt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.395.390.000.000.000.00000.0000799,255.00799,255.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.35%3.5806107,054.9188,884145,517106,258.640135,601382,800382,8000.00%
crit33.65%1.8106229,664.94177,768290,021206,588.730286,083416,455416,4550.00%

Action Details: Avengers Shield Dt

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=false}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    Avenger's Shield (_dr) 7,5601.4%15.718.53s144,7480Direct15.7105,068226,596144,82532.7%

Stats Details: Avengers Shield Dr

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.6715.670.000.000.000.00000.00002,268,920.762,268,920.760.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.29%10.54217105,067.9688,884145,638104,852.8489,123121,6041,107,7841,107,7840.00%
crit32.71%5.12012226,596.47177,768291,277226,619.830270,4231,161,1371,161,1370.00%

Action Details: Avengers Shield Dr

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=false}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Eye for an Eye 3,0350.6%11.927.11s76,2910Direct11.953,393113,73776,28537.9%

Stats Details: Eye For An Eye

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage11.9111.910.000.000.000.00000.0000908,657.15908,657.150.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit62.05%7.3912253,392.6741,69867,78753,271.4641,69862,672394,611394,6110.00%
crit37.95%4.52016113,737.3083,396135,574113,559.310129,485514,047514,0470.00%

Action Details: Eye For An Eye

  • id:469311
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.350000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.34
  • base_multiplier:1.00

Spelldata

  • id:469311
  • name:Eye for an Eye
  • school:holy
  • tooltip:
  • description:{$@spelldesc469309=Melee and ranged attackers receive {$469311s1=0} Holy damage each time they strike you during {$?=}c2[Ardent Defender][Divine Protection] and Divine Shield.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Eye of Tyr 6,4161.2%4.558.61s427,316347,897Direct4.5331,887697,044427,28326.1%

Stats Details: Eye Of Tyr

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.504.500.000.000.001.22840.00001,924,567.401,924,567.400.00%347,897.22347,897.22
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.87%3.3307331,886.97304,009495,739329,984.970450,3611,104,2711,104,2710.00%
crit26.13%1.1806697,043.91608,018975,487512,516.490962,538820,297820,2970.00%

Action Details: Eye Of Tyr

  • id:387174
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:40.199
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:387174
  • name:Eye of Tyr
  • school:holy
  • tooltip:Dealing {$s1=25}% less damage to the Paladin.
  • description:Releases a blinding flash from your shield, causing {$s2=0} Holy damage to all nearby enemies within {$=}A1 yds and reducing all damage they deal to you by {$s1=25}% for {$d=6 seconds}.

Action Priority List

    standard
    [T]:4.50
  • if_expr:(talent.inmost_light.enabled&raid_event.adds.in>=45|spell_targets.shield_of_the_righteous>=3)&!talent.lights_deliverance.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Gnash 12,1022.3%42.27.05s85,9330Direct42.264,767129,33185,93732.8%

Stats Details: Gnash

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage42.2542.250.000.000.000.00000.00003,630,411.255,186,296.6030.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.22%28.40115064,767.0558,18494,21464,769.3860,40370,6741,839,2072,627,43630.00%
crit32.78%13.85332129,331.07116,367188,428129,326.95116,367154,4361,791,2052,558,86130.00%

Action Details: Gnash

  • id:455487
  • school:physical
  • range:25.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:114374.55
  • base_dd_max:114374.55
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:455487
  • name:Gnash
  • school:physical
  • tooltip:
  • description:{$@spelldesc455484=Your harmful melee abilities have a chance to Gnash your target dealing {$=}{{$=}<rolemult>*{$s1=43424}} Physical damage. Every third Gnash on the same target does additional damage based on targets missing health. Count is reset if Gnash hits a different target.}
Hammer of Wrath 46,1928.8%30.69.98s452,605388,693Direct30.6317,308657,053452,84239.9%

Stats Details: Hammer Of Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage30.5730.550.000.000.001.16450.000013,836,309.6013,836,309.600.00%388,693.14388,693.14
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit60.10%18.36530317,307.64241,245395,286317,149.03283,096345,3565,826,3875,826,3870.00%
crit39.90%12.19226657,052.93482,490790,571657,196.85567,772717,2598,009,9238,009,9230.00%

Action Details: Hammer Of Wrath

  • id:24275
  • school:holy
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$=}<damage> {$?s403664=false}[Holystrike][Holy] damage. Only usable on enemies that have less than 20% health{$?s326730=true}[, or during Avenging Wrath][]. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    standard
    [L]:30.57

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Global CooldownProtection Paladin1370285SET1.000
Spell Direct AmountProtection Paladin13702818PCT68.0%
Hasted Cooldown Duration (Category)Paladin1370266SET1.000
Holy Shield 2,8750.5%39.87.30s21,6400Direct39.815,66033,68621,64833.2%

Stats Details: Holy Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage39.8139.800.000.000.000.00000.0000861,567.41861,567.410.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.78%26.5884715,659.7813,17421,58615,650.7413,73517,533416,201416,2010.00%
crit33.22%13.2223133,685.6426,34843,17133,695.0226,79139,182445,366445,3660.00%

Action Details: Holy Shield

  • id:157122
  • school:holy
  • range:100.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:157122
  • name:Holy Shield
  • school:holy
  • tooltip:
  • description:{$@spelldesc152261=Your block chance is increased by {$s1=20}%, you are able to block spells, and your successful blocks deal {$157122s1=0} Holy damage to your attacker.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Judgment 100,442 (130,682)19.2% (25.0%)87.83.44s446,008375,422Direct87.8 (116.8)248,489533,963342,95333.1% (34.0%)

Stats Details: Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage87.8387.790.000.000.001.18800.000030,108,148.9830,108,148.980.00%375,422.41375,422.41
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit66.91%58.743687248,489.47208,463342,790248,421.50231,149264,18514,595,91114,595,9110.00%
crit33.09%29.051153533,963.41413,091685,580534,144.22486,004588,02515,512,23815,512,2380.00%

Action Details: Judgment

  • id:275779
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:11.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:0.450
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.237500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15
  • base_multiplier:1.65

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275779
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target, dealing {$s1=0} Holy damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability][].{$?a315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Action Priority List

    standard
    [H]:12.41
  • target_if_expr:charges>=2|full_recharge_time<=gcd.max
    standard
    [N]:36.20
  • if_expr:(buff.avenging_wrath.up&talent.hammer_and_anvil.enabled)
  • target_if_expr:debuff.judgment.remains
    standard
    [P]:39.21
  • target_if_expr:debuff.judgment.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Modify Recharge Time% (Category)Protection Paladin1370283SET-0.550
Hasted Global CooldownProtection Paladin1370285SET1.000
Hasted Cooldown Duration (Category)Protection Paladin1370286SET1.000
Spell Direct AmountProtection Paladin13702811PCT-14.0%
    Hammer and Anvil 30,2395.8%29.110.15s311,9800Direct29.1220,829468,870311,95236.7%

Stats Details: Hammer And Anvil

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage29.0529.050.000.000.000.00000.00009,063,425.369,063,425.360.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit63.25%18.38539220,828.77174,685289,915220,861.74188,801250,9964,057,6634,057,6630.00%
crit36.75%10.68125468,869.55353,873579,830469,126.30365,420538,9665,005,7635,005,7630.00%

Action Details: Hammer And Anvil

  • id:433717
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:433717
  • name:Hammer and Anvil
  • school:holy
  • tooltip:
  • description:{$@spelldesc433718=Judgment critical strikes cause a shockwave around the target, dealing {$?=}c1[{$433722s1=0}][{$433717s1=0}] {$?=}c1[healing][damage] at the target's location.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
melee 25,2314.8%178.92.01s42,28220,989Direct178.931,01365,50342,28132.7%

Stats Details: Melee

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage178.88178.880.000.000.002.01450.00007,563,416.6310,804,870.1030.00%20,988.5620,988.56
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.33%120.437516731,012.5226,43640,70531,012.5129,84232,1423,734,9625,335,65530.00%
crit32.67%58.45279365,502.7854,41081,41065,530.6661,58270,5303,828,4545,469,21530.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Refining Fire 37,5177.2%41.67.18s270,2870Periodic230.835,51175,83948,74132.8%58.7%

Stats Details: Refining Fire

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage41.620.00230.80230.8017.480.00000.762511,249,369.2311,249,369.230.00%63,918.320.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit67.20%155.099721335,511.293888,01435,534.2830,37741,0215,507,4805,507,4800.00%
crit32.80%75.713611675,838.9886176,02875,881.0061,87991,2615,741,8905,741,8900.00%

Action Details: Refining Fire

  • id:469882
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.225000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.34
  • base_multiplier:1.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:469882
  • name:Refining Fire
  • school:holyfire
  • tooltip:Suffering {$=}w1 Radiant damage every $t sec.
  • description:Enemies struck by Avenger's Shield burn with holy fire, suffering {$=}o1 Radiant damage over {$d=5 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Sacred Weapon (_proc_damage) 86,05016.5%35.48.15s729,6230Direct35.4518,2271,082,974729,62637.4%

Stats Details: Sacred Weapon Proc Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage35.3635.360.000.000.000.00000.000025,800,718.8825,800,718.880.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit62.57%22.13746518,226.77184,0141,839,459517,342.50400,869734,84311,466,44111,466,4410.00%
crit37.43%13.243321,082,973.89368,0283,730,5521,081,562.69720,5491,732,52514,334,27714,334,2770.00%

Action Details: Sacred Weapon Proc Damage

  • id:432616
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:432616
  • name:Sacred Weapon
  • school:holy
  • tooltip:
  • description:{$@spelldesc432502=While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Shield of the Righteous 62,895 (100,356)12.0% (19.2%)95.53.14s315,0120Direct95.5 (130.6)143,255297,044197,49035.3% (37.6%)

Stats Details: Shield Of The Righteous

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage95.4795.470.000.000.000.00000.000018,855,160.4118,855,160.410.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.74%61.813693143,255.3566,174312,748143,304.05130,661156,3158,854,3988,854,3980.00%
crit35.26%33.671457297,043.67132,349622,971297,264.15259,833352,31610,000,76310,000,7630.00%

Action Details: Shield Of The Righteous

  • id:53600
  • school:holy
  • range:5.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53600
  • name:Shield of the Righteous
  • school:holy
  • tooltip:
  • description:Slams enemies in front of you with your shield, causing {$s1=0} Holy damage, and increasing your Armor by {$?=}c1[{$=}{{$132403s1=160}*{$=}INT/100}][{$=}{{$132403s1=160}*{$=}STR/100}] for {$132403d=4.500 seconds}.{$?a386568=false}[ {$@spelldesc386568=When Shield of the Righteous expires, gain {$386556s1=10}% block chance and deal {$386553s1=0} Holy damage to all attackers for {$386556d=4 seconds}.}][]{$?a280373=true}[ {$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}][]

Action Priority List

    standard
    [I]:95.48
  • if_expr:(!talent.righteous_protector.enabled|cooldown.righteous_protector_icd.remains=0)&!buff.hammer_of_light_ready.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Hasted Global CooldownProtection Paladin1370285SET1.000
Spell Direct AmountPaladin Protection 11.0 Class Set 2pc4536571PCT10.0%
    Forge's Reckoning 37,4617.2%35.18.09s319,5730Direct35.1221,914443,730319,78444.1%

Stats Details: Forges Reckoning

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage35.1135.090.000.000.000.00000.000011,220,572.6611,220,572.660.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit55.89%19.61536221,913.69206,464256,285221,798.64212,219233,5094,351,8404,351,8400.00%
crit44.11%15.48330443,729.84412,928512,569443,605.69426,323468,1896,868,7326,868,7320.00%

Action Details: Forges Reckoning

  • id:447258
  • school:holy
  • range:100.0
  • travel_speed:30.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:447258
  • name:Forge's Reckoning
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} damage to enemy targets. Reduced above {$s2=5} targets.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Spell Direct AmountProtection Paladin13702826PCT-15.0%
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Dano 134499
blessed_hammer_absorb 10,4017.7%0.00.00s00Direct124.325,099025,0990.0%

Stats Details: Blessed Hammer Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.00124.310.000.000.000.00000.00003,120,056.580.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%124.319115925,098.5123,66427,87025,098.0724,72825,7153,120,05700.00%
bulwark_of_order_absorb 11,8028.7%0.00.00s00Direct39.489,733089,7330.0%

Stats Details: Bulwark Of Order Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0039.450.000.000.000.00000.00003,539,536.580.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%39.45275289,732.9251,792349,53289,771.8069,858112,3703,539,53700.00%
holy_bulwark_absorb 40,08829.8%0.00.00s00Direct44.4272,0800272,0800.0%

Stats Details: Holy Bulwark Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0044.370.000.000.000.00000.000012,070,297.640.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%44.372097272,079.5882,397,810272,408.26238,171361,01412,070,29800.00%
Sacred Weapon (_proc_heal) 8200.6%0.354.84s721,8060Direct0.3577,0211,152,474723,31125.3%

Stats Details: Sacred Weapon Proc Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal0.340.340.000.000.000.00000.0000247,460.01278,341.4311.09%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit74.68%0.2604577,020.5301,488,068129,798.0401,488,068147,699162,2411.72%
crit25.32%0.09031,152,474.0703,457,54695,300.7402,941,96499,761116,1000.99%

Action Details: Sacred Weapon Proc Heal

  • id:441590
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dano
  • aoe:5
  • split_aoe_damage:false
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441590
  • name:Sacred Weapon
  • school:holy
  • tooltip:
  • description:{$@spelldesc432502=While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.}
Word of Glory 71,024 (71,206)52.9% (53.0%)7.124.62s3,045,2152,444,001Direct7.1 (7.3)2,461,5004,918,9063,037,63623.5% (24.1%)

Stats Details: Word Of Glory

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal7.067.060.000.000.001.24610.000021,433,971.8621,633,263.300.92%2,444,001.372,444,001.37
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit76.54%5.400132,461,500.3104,977,5242,470,828.0904,036,82213,293,56113,350,1330.50%
crit23.46%1.66084,918,906.2409,879,9884,068,480.3309,867,3388,140,4118,283,1311.78%

Action Details: Word Of Glory

  • id:85673
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dano
  • aoe:0
  • harmful:false

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.465000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10
  • base_multiplier:1.00

Spelldata

  • id:85673
  • name:Word of Glory
  • school:holy
  • tooltip:
  • description:Calls down the Light to heal a friendly target for $130551s1{$?a378405=false}[ and an additional {$378405s1=20}% over {$378412d=10 seconds}][].{$?a379043=true}[ Your block chance is increased by {$379043s1=5}% for {$379041d=6 seconds}.][]{$?a315921=true}&!a315924[ |cFFFFFFFFProtection:|r If cast on yourself, healing increased by up to {$315921s1=300}% based on your missing health.][]{$?a315924=false}[ |cFFFFFFFFProtection:|r Healing increased by up to {$315921s1=300}% based on your missing health, or up to {$315924s1=100}% if cast on another target.][]

Action Priority List

    standard
    [W]:7.06
  • if_expr:buff.shining_light_free.up&(talent.blessed_assurance.enabled|(talent.lights_guidance.enabled&cooldown.hammerfall_icd.remains=0))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin13702817PCT110.0%
    Sacred Word 1820.1%0.297.66s217,3390Direct0.2152,812304,690217,37742.6%

Stats Details: Sacred Word

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal0.250.250.000.000.000.00000.000053,688.1563,975.2816.08%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit57.45%0.1402152,812.10-0200,66120,934.59-0200,66121,67325,7772.19%
crit42.55%0.1102304,689.96-0401,60130,981.33-0401,60132,01538,1981.69%

Action Details: Sacred Word

  • id:447246
  • school:holy
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dano
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:447246
  • name:Sacred Word
  • school:holy
  • tooltip:
  • description:Heals the target for {$s1=0}.
Simple Action Stats Execute Interval
Dano
Ardent Defender 6.551.58s

Stats Details: Ardent Defender

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.490.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Ardent Defender

  • id:31850
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:84.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:31850
  • name:Ardent Defender
  • school:physical
  • tooltip:Damage taken reduced by {$=}w1%. The next attack that would otherwise kill you will instead bring you to {$=}w2% of your maximum health.{$?a469439=true}[ Healing taken increased by {$=}w4%.][]
  • description:Reduces all damage you take by {$s1=20}% for {$d=8 seconds}. While Ardent Defender is active, the next attack that would otherwise kill you will instead bring you to {$s2=20}% of your maximum health.

Action Priority List

    defensives
    [G]:6.49
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dano
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Avenging Wrath 4.381.73s

Stats Details: Avenging Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.310.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Avenging Wrath

  • id:454351
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:454351
  • name:Avenging Wrath
  • school:holy
  • tooltip:{$?=}{$=}w2>0&{$=}w3>0[Damage, healing and critical strike chance increased by {$=}w2%.]?{$=}w3==0&{$=}w2>0[Damage and healing increased by {$=}w2%.]?{$=}w2==0&{$=}w3>0[Critical strike chance increased by {$=}w3%.][]{$?a53376=true}[ ][]{$?a53376=true}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=true}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]{$?s384442=false}&s384376[increasing your damage, healing and critical strike chance by {$s2=20}% for {$d=8 seconds}.]?!s384442&s384376[increasing your damage and healing by {$s1=20}% for {$d=8 seconds}.]?!s384376&s384442[increasing your critical strike chance by {$s3=20}% for {$d=8 seconds}.][and activating all the effects learned for Avenging Wrath for {$d=8 seconds}.]

Action Priority List

    cooldowns
    [E]:4.30
Devotion Aura 1.00.00s

Stats Details: Devotion Aura

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Devotion Aura

  • id:465
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:465
  • name:Devotion Aura
  • school:holy
  • tooltip:Damage taken reduced by {$=}w1%.
  • description:Party and raid members within {$=}a1 yds are bolstered by their devotion, reducing damage taken by {$s1=3}%.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dano
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Dano
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Holy Bulwark (Holy Armaments) 6.045.03s

Stats Details: Holy Armaments

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.010.000.000.000.001.19580.00000.000.000.00%0.000.00

Action Details: Holy Armaments

  • id:432459
  • school:holy
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:432459
  • name:Holy Bulwark
  • school:holy
  • tooltip:
  • description:Will the Light to coalesce and become manifest as a Holy Armament, wielded by your friendly target. {$@=}spellicon432496 {$@=}spellname432496: {$@spelldesc432496=While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.} Becomes Sacred Weapon after use.

Action Priority List

    standard
    [K]:3.47
  • if_expr:next_armament=sacred_weapon&(!buff.sacred_weapon.up|(buff.sacred_weapon.remains<6&!buff.avenging_wrath.up&cooldown.avenging_wrath.remains<=30))
    standard
    [O]:0.18
  • if_expr:next_armament=holy_bulwark&charges=2
    standard
    [U]:2.36
  • if_expr:next_armament=holy_bulwark
holy_bulwark 4.458.39s

Stats Details: Holy Bulwark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.410.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Holy Bulwark

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.30.00s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.320.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [F]:1.32
  • if_expr:buff.avenging_wrath.up
Rite of Sanctification 1.00.00s

Stats Details: Rite Of Sanctification

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Rite Of Sanctification

  • id:433568
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Dano
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:433568
  • name:Rite of Sanctification
  • school:holy
  • tooltip:
  • description:Imbue your weapon with the power of the Light, increasing your armor by {$433550s2=5}% and your primary stat by {$433550s1=2}%. Lasts {$433550d=3600 seconds}.
sacred_weapon 9.633.60s

Stats Details: Sacred Weapon

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.630.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sacred Weapon

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ardent Defender6.50.049.9s51.6s2.1s4.50%4.61%0.0 (0.0)1.1

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_ardent_defender
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:32.0s / 60.0s
  • trigger_min/max:36.4s / 60.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:2.53% / 11.50%

Stack Uptimes

  • ardent_defender_1:4.50%

Spelldata

  • id:31850
  • name:Ardent Defender
  • tooltip:Damage taken reduced by {$=}w1%. The next attack that would otherwise kill you will instead bring you to {$=}w2% of your maximum health.{$?a469439=true}[ Healing taken increased by {$=}w4%.][]
  • description:Reduces all damage you take by {$s1=20}% for {$d=8 seconds}. While Ardent Defender is active, the next attack that would otherwise kill you will instead bring you to {$s2=20}% of your maximum health.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Avenging Wrath4.30.080.0s81.8s31.3s45.00%46.59%0.0 (0.0)3.8

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:65.3s / 90.1s
  • trigger_min/max:70.8s / 90.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.5s
  • uptime_min/max:39.10% / 52.85%

Stack Uptimes

  • avenging_wrath_1:45.00%

Spelldata

  • id:31884
  • name:Avenging Wrath
  • tooltip:Damage, healing, and critical strike chance increased by {$=}w2%. {$?a53376=true}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=true}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]increasing your damage, healing, and critical strike chance by {$s2=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Barricade of Faith17.72.916.5s14.1s11.1s65.28%59.09%2.9 (2.9)17.1

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_barricade_of_faith
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 68.0s
  • trigger_min/max:2.5s / 55.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.4s
  • uptime_min/max:48.21% / 79.15%

Stack Uptimes

  • barricade_of_faith_1:65.28%

Spelldata

  • id:385726
  • name:Barricade of Faith
  • tooltip:
  • description:When you use Avenger's Shield, your block chance is increased by {$385724s1=10}% for {$385724d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Blessed Assurance69.732.94.3s2.9s2.4s56.30%91.75%32.9 (32.9)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_blessed_assurance
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 17.9s
  • trigger_min/max:0.0s / 10.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.9s
  • uptime_min/max:42.97% / 69.26%

Stack Uptimes

  • blessed_assurance_1:56.30%

Spelldata

  • id:433019
  • name:Blessed Assurance
  • tooltip:Damage and healing of your next {$?s204019=true}[Blessed Hammer]?s53595[Hammer of the Righteous][Crusader Strike] increased by {$=}w1%.
  • description:{$@spelldesc433015=Casting a Holy Power ability increases the damage and healing of your next {$?s204019=true}[Blessed Hammer]?s53595[Hammer of the Righteous][Crusader Strike] by {$433019s1=200}%.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Blessed Hammer (_absorb)124.30.02.4s2.4s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_blessed_hammer_absorb
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 12.0s
  • trigger_min/max:0.0s / 12.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:204301
  • name:Blessed Hammer
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of Dawn64.20.04.7s4.7s2.0s26.31%62.56%0.0 (0.0)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_blessing_of_dawn
  • max_stacks:2
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 10.5s
  • trigger_min/max:2.7s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.9s
  • uptime_min/max:9.14% / 44.85%

Stack Uptimes

  • blessing_of_dawn_1:26.31%

Spelldata

  • id:385127
  • name:Blessing of Dawn
  • tooltip:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing.
  • description:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing. This effect stacks.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blessing of Dusk1.562.4107.0s4.7s194.3s98.94%99.91%62.4 (62.4)0.5

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_blessing_of_dusk
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.6s / 353.9s
  • trigger_min/max:1.0s / 13.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.2s
  • uptime_min/max:96.27% / 99.23%

Stack Uptimes

  • blessing_of_dusk_1:98.94%

Spelldata

  • id:385126
  • name:Blessing of Dusk
  • tooltip:Damage taken reduced by {$=}w1%{$?s385129=false}[, armor increased by {$=}w2%, and Holy Power generating abilities cool down {$=}w3% faster.][.]
  • description:Damage taken reduced by {$s1=4}%{$?s385129=false}&c2[, armor increased by {$s2=10}%, and Holy Power generating abilities cool down {$s3=10}% faster]?s385129[ and your Holy Power generating abilities also grant an absorb shield for {$s9=10}% of damage or healing dealt.][] For {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of the Forge4.30.080.0s81.8s19.3s27.71%34.51%0.0 (0.0)4.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_blessing_of_the_forge
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • blessing_of_the_forge_1:27.71%

Spelldata

  • id:434132
  • name:Blessing of the Forge
  • tooltip:Assisted by a Sacred Weapon.
  • description:{$@spelldesc433011=Avenging Wrath summons an additional Sacred Weapon, and during Avenging Wrath your Sacred Weapon casts spells on your target and echoes the effects of your Holy Power abilities.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bulwark of Order39.62.17.6s7.2s0.9s12.29%51.22%2.1 (2.1)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_bulwark_of_order
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 39.6s
  • trigger_min/max:0.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.9s
  • uptime_min/max:6.72% / 18.29%

Stack Uptimes

  • bulwark_of_order_1:12.29%

Spelldata

  • id:209389
  • name:Bulwark of Order
  • tooltip:
  • description:Avenger's Shield also shields you for {$209388d=8 seconds}, absorbing {$s1=60}% as much damage as it dealt, up to {$s2=50}% of your maximum health.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Bulwark of Righteous Fury34.86.88.6s7.2s2.3s26.27%36.30%0.0 (0.0)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_bulwark_of_righteous_fury
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.3s / 43.6s
  • trigger_min/max:0.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.0s
  • uptime_min/max:16.80% / 36.64%

Stack Uptimes

  • bulwark_of_righteous_fury_1:22.40%
  • bulwark_of_righteous_fury_2:3.63%
  • bulwark_of_righteous_fury_3:0.24%
  • bulwark_of_righteous_fury_4:0.00%

Spelldata

  • id:386652
  • name:Bulwark of Righteous Fury
  • tooltip:Increases your next Shield of the Righteous' damage by {$=}w1% and radius by {$s3=6}~ yds.
  • description:{$@spelldesc386653=Avenger's Shield increases the damage of your next Shield of the Righteous by {$386652s1=20}% for each target hit by Avenger's Shield, stacking up to {$386652u=5} times, and increases its radius by {$386652s3=6} yds.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Purpose15.40.018.3s18.3s1.0s5.37%14.83%0.0 (0.0)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 294.6s
  • trigger_min/max:0.1s / 294.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.3s
  • uptime_min/max:0.72% / 11.28%

Stack Uptimes

  • divine_purpose_1:5.37%

Spelldata

  • id:223819
  • name:Divine Purpose
  • tooltip:Your next Holy Power spending ability is free and deals {$s2=15}% increased damage and healing.
  • description:{$@spelldesc223817=Holy Power spending abilities have a {$s1=15}% chance to make your next Holy Power spending ability free and deal {$223819s2=15}% increased damage and healing.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Resonance5.40.061.0s61.0s14.7s26.36%0.00%10.5 (10.5)5.1

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_divine_resonance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:60.0s / 74.1s
  • trigger_min/max:60.0s / 74.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:23.74% / 29.12%

Stack Uptimes

  • divine_resonance_1:26.36%

Spelldata

  • id:355455
  • name:Divine Resonance
  • tooltip:Casting {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$t1=5} sec for {$s2=15} sec.
  • description:{$@spelldesc355098=After casting Divine Toll, you instantly cast {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$355455t1=5} sec. This effect lasts {$355455s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Faith in the Light5.61.431.8s24.5s6.9s12.89%17.79%1.4 (1.4)5.6

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_faith_in_the_light
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 173.0s
  • trigger_min/max:1.2s / 173.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.6s
  • uptime_min/max:0.00% / 25.10%

Stack Uptimes

  • faith_in_the_light_1:12.89%

Spelldata

  • id:379041
  • name:Faith in the Light
  • tooltip:Block chance increased by {$=}w1%.
  • description:Casting Word of Glory grants you an additional {$379043s1=5}% block chance for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Faith's Armor23.472.112.7s3.1s11.7s91.25%74.36%72.1 (72.1)22.4

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_faiths_armor
  • max_stacks:1
  • base duration:4.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.5s / 76.7s
  • trigger_min/max:1.0s / 10.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 75.2s
  • uptime_min/max:87.19% / 95.09%

Stack Uptimes

  • faiths_armor_1:91.25%

Spelldata

  • id:379017
  • name:Faith's Armor
  • tooltip:Armor increased by {$=}w1%.
  • description:{$?=}c2[Shield of the Righteous][Word of Glory] grants {$s1=20}% bonus armor for {$d=4.500 seconds}.
  • max_stacks:0
  • duration:4.50
  • cooldown:0.00
  • default_chance:0.00%
fake_solidarity14.00.028.0s21.6s25.5s71.20%93.67%0.0 (0.0)7.8

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_fake_solidarity
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 166.0s
  • trigger_min/max:0.1s / 84.7s
  • trigger_pct:99.63%
  • duration_min/max:0.0s / 139.3s
  • uptime_min/max:52.32% / 95.00%

Stack Uptimes

  • fake_solidarity_1:54.10%
  • fake_solidarity_2:14.96%
  • fake_solidarity_3:1.97%
  • fake_solidarity_4:0.17%
  • fake_solidarity_5:0.02%
  • fake_solidarity_6:0.00%
Flask of Alchemical Chaos (Crit)2.10.6111.3s76.4s35.2s24.84%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 346.2s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 77.09%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.84%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6111.3s75.9s35.3s25.12%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 331.7s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 233.2s
  • uptime_min/max:0.00% / 84.58%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.12%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.7s76.7s35.3s24.99%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 344.3s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 184.2s
  • uptime_min/max:0.00% / 81.15%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.99%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6112.9s77.0s35.2s25.05%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 352.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 228.5s
  • uptime_min/max:0.00% / 87.77%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.05%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Heightened Wrath4.30.080.0s81.8s28.4s40.74%42.09%0.0 (0.0)3.8

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_heightened_wrath
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • heightened_wrath_1:40.74%

Spelldata

  • id:456759
  • name:Heightened Wrath
  • tooltip:Damage and healing increased by {$=}{{$=}w1}.1%.
  • description:{$@spelldesc453662=Casting a Holy Power ability increases the damage and healing you deal during your next Avenging Wrath by {$=}{{$456700s1=500}/1000}.1%. This effect stacks.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Holy Bulwark3.80.672.2s59.4s21.8s27.39%36.49%38.0 (38.0)3.5

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_holy_bulwark
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:20.0s / 189.0s
  • trigger_min/max:0.2s / 177.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.1s
  • uptime_min/max:13.29% / 56.47%

Stack Uptimes

  • holy_bulwark_1:27.39%

Spelldata

  • id:432496
  • name:Holy Bulwark
  • tooltip:Wielding a Holy Bulwark.{$?=}{$=}w3<0[ Duration of Fear effects reduced by {$s3=0}%.][]
  • description:While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Holy Bulwark (_absorb)37.67.56.0s5.0s1.3s15.79%57.99%7.5 (7.5)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_holy_bulwark_absorb
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 157.1s
  • trigger_min/max:0.0s / 157.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s
  • uptime_min/max:2.46% / 36.75%

Stack Uptimes

  • holy_bulwark_absorb_1:15.79%

Spelldata

  • id:432607
  • name:Holy Bulwark
  • tooltip:Absorbing the next {$=}w1 damage you take.
  • description:{$@spelldesc432496=While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Redoubt1.094.5204.0s3.1s299.0s99.68%98.95%92.5 (92.5)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_redoubt
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:204.0s / 204.0s
  • trigger_min/max:1.0s / 10.1s
  • trigger_pct:100.00%
  • duration_min/max:96.4s / 359.1s
  • uptime_min/max:99.60% / 99.74%

Stack Uptimes

  • redoubt_1:0.60%
  • redoubt_2:0.56%
  • redoubt_3:98.52%

Spelldata

  • id:280375
  • name:Redoubt
  • tooltip:Strength and Stamina increased by {$=}w1%.
  • description:{$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Relentless Inquisitor1.0101.50.0s2.9s299.0s99.68%84.89%99.5 (99.5)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_relentless_inquisitor
  • max_stacks:3
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 10.1s
  • trigger_pct:100.00%
  • duration_min/max:239.1s / 359.1s
  • uptime_min/max:99.60% / 99.74%

Stack Uptimes

  • relentless_inquisitor_1:0.60%
  • relentless_inquisitor_2:0.56%
  • relentless_inquisitor_3:98.52%

Spelldata

  • id:383389
  • name:Relentless Inquisitor
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc383388=Spending Holy Power grants you {$s1=1}% haste per finisher for {$383389d=12 seconds}, stacking up to {$=}{{$s2=0}+{$s3=3}} times.}
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Rising Wrath4.398.280.0s0.0s68.8s98.40%76.47%0.0 (0.0)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_rising_wrath
  • max_stacks:99
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • rising_wrath_1:3.44%
  • rising_wrath_2:3.36%
  • rising_wrath_3:3.25%
  • rising_wrath_4:3.37%
  • rising_wrath_5:3.43%
  • rising_wrath_6:3.36%
  • rising_wrath_7:3.34%
  • rising_wrath_8:3.31%
  • rising_wrath_9:3.26%
  • rising_wrath_10:3.36%
  • rising_wrath_11:3.57%
  • rising_wrath_12:3.80%
  • rising_wrath_13:3.96%
  • rising_wrath_14:3.97%
  • rising_wrath_15:3.92%
  • rising_wrath_16:3.88%
  • rising_wrath_17:3.89%
  • rising_wrath_18:3.95%
  • rising_wrath_19:4.01%
  • rising_wrath_20:4.04%
  • rising_wrath_21:4.02%
  • rising_wrath_22:3.95%
  • rising_wrath_23:3.84%
  • rising_wrath_24:3.52%
  • rising_wrath_25:2.99%
  • rising_wrath_26:2.36%
  • rising_wrath_27:1.80%
  • rising_wrath_28:1.31%
  • rising_wrath_29:0.91%
  • rising_wrath_30:0.59%
  • rising_wrath_31:0.34%
  • rising_wrath_32:0.17%
  • rising_wrath_33:0.07%
  • rising_wrath_34:0.03%
  • rising_wrath_35:0.01%
  • rising_wrath_36:0.00%
  • rising_wrath_37:0.00%

Spelldata

  • id:456700
  • name:Rising Wrath
  • tooltip:Damage and healing increased by {$=}{{$s1=500}/1000}.1% during your next Avenging Wrath
  • description:{$@spelldesc453662=Casting a Holy Power ability increases the damage and healing you deal during your next Avenging Wrath by {$=}{{$456700s1=500}/1000}.1%. This effect stacks.}
  • max_stacks:99
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Sacred Weapon7.81.840.1s33.9s22.5s58.61%58.55%1.8 (1.8)7.2

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_sacred_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:8.00
  • modifier:1.00

Stack Uptimes

  • sacred_weapon_1:58.61%

Spelldata

  • id:432502
  • name:Sacred Weapon
  • tooltip:Your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets.{$?=}{$=}w3<0[ Duration of Fear effects reduced by {$s3=0}%.][]
  • description:While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Shield of the Righteous1.094.50.0s3.1s299.0s99.68%100.00%94.5 (94.5)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_shield_of_the_righteous
  • max_stacks:1
  • base duration:4.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:1.0s / 10.1s
  • trigger_pct:100.00%
  • duration_min/max:239.1s / 359.1s
  • uptime_min/max:99.60% / 99.74%

Stack Uptimes

  • shield_of_the_righteous_1:99.68%

Spelldata

  • id:132403
  • name:Shield of the Righteous
  • tooltip:Armor increased by {$?=}c1[{$=}{{$=}W1*{$=}INT/100}][{$=}{{$=}W1*{$=}STR/100}].{$?=}{$=}W3<0[ Damage taken reduced by {$=}w3%.][]
  • description:{$@spelldesc53600=Slams enemies in front of you with your shield, causing {$s1=0} Holy damage, and increasing your Armor by {$?=}c1[{$=}{{$132403s1=160}*{$=}INT/100}][{$=}{{$132403s1=160}*{$=}STR/100}] for {$132403d=4.500 seconds}.{$?a386568=false}[ {$@spelldesc386568=When Shield of the Righteous expires, gain {$386556s1=10}% block chance and deal {$386553s1=0} Holy damage to all attackers for {$386556d=4 seconds}.}][]{$?a280373=true}[ {$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}][] }
  • max_stacks:0
  • duration:4.50
  • cooldown:0.00
  • default_chance:0.00%
Shining Light (_free)2.742.192.5s6.7s108.5s96.11%100.00%35.7 (35.7)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_shining_light_free
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 290.1s
  • trigger_min/max:0.0s / 21.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.9s
  • uptime_min/max:82.15% / 99.72%

Stack Uptimes

  • shining_light_free_1:12.94%
  • shining_light_free_2:83.17%

Spelldata

  • id:327510
  • name:Shining Light
  • tooltip:Your next Word of Glory costs no Holy Power.
  • description:{$@spelldesc321136=Every {$s1=3} Shields of the Righteous make your next Word of Glory cost no Holy Power. Maximum {$327510=}U stacks.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Shining Light (_stacks)32.231.89.4s4.7s6.2s66.69%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_shining_light_stacks
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 21.7s
  • trigger_min/max:1.0s / 15.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.7s
  • uptime_min/max:57.38% / 75.44%

Stack Uptimes

  • shining_light_stacks_1:33.46%
  • shining_light_stacks_2:33.24%

Spelldata

  • id:182104
  • name:Shining Light
  • tooltip:After {$=}{{$321136s1=3}~-{$=}w1} {$?=}{$=}w1<{$=}w2[Shields][Shield] of the Righteous, your next Word of Glory is free.
  • description:{$@spelldesc321136=Every {$s1=3} Shields of the Righteous make your next Word of Glory cost no Holy Power. Maximum {$327510=}U stacks.}
  • max_stacks:4
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Skarmorak Shard3.70.092.9s94.3s14.7s18.33%0.00%0.0 (0.0)3.6

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_skarmorak_shard
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:5607.69

Trigger Details

  • interval_min/max:90.0s / 143.9s
  • trigger_min/max:90.0s / 143.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:13.92% / 20.98%

Stack Uptimes

  • skarmorak_shard_1:18.33%

Spelldata

  • id:443407
  • name:Skarmorak Shard
  • tooltip:Mastery increased by {$s1=8731}.
  • description:Grasp the shard tightly to enrich yourself with crystalline energy, increasing your Mastery by {$s1=8731} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:0.00%
Strength in Adversity41.60.07.2s7.2s7.2s99.35%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_strength_in_adversity
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 39.6s
  • trigger_min/max:0.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.6s
  • uptime_min/max:99.19% / 99.49%

Stack Uptimes

  • strength_in_adversity_1:99.35%

Spelldata

  • id:393071
  • name:Strength in Adversity
  • tooltip:
  • description:For each target hit by Avenger's Shield, gain {$s1=5}% parry for {$393038d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Tempered Potion1.30.0320.3s0.0s27.2s11.87%0.00%0.0 (0.0)1.1

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.3s / 337.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:8.98% / 17.80%

Stack Uptimes

  • tempered_potion_1:11.87%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devotion Aura

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_devotion_aura
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:465
  • name:Devotion Aura
  • tooltip:Damage taken reduced by {$=}w1%.
  • description:Party and raid members within {$=}a1 yds are bolstered by their devotion, reducing damage taken by {$s1=3}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rite of Sanctification

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_rite_of_sanctification
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:433550
  • name:Rite of Sanctification
  • tooltip:Primary stat increased by {$=}w1%. Armor increased by {$=}w2%.
  • description:{$@spelldesc433568=Imbue your weapon with the power of the Light, increasing your armor by {$433550s2=5}% and your primary stat by {$433550s1=2}%. Lasts {$433550d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)29.911.051.09.8s0.9s103.3s
parry_haste15.53.033.018.2s2.0s236.0s
Divine Purpose15.42.037.018.3s0.1s294.6s
Avenger's Shield: Grand Crusader8.71.020.030.0s2.0s303.4s
Avenger's Shield: Grand Crusader wasted5.10.016.046.9s0.0s327.6s
Divine Inspiration3.70.012.060.3s0.2s292.6s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Avenger's Shield (_dt)40.4851.84261.971237.424192.922290.316
Avenger's Shield (_dr)11.2370.00051.746188.361152.994230.675
Consecration17.2330.00098.419252.327192.389317.277
Avenging Wrath0.4600.0001.2671.9840.0005.048
Divine Toll1.1540.00014.1026.2661.84720.513
Judgment0.0170.0001.4991.4660.0009.317
Eye of Tyr24.1150.000112.573127.39539.075233.955
Shield of the Righteous2.3480.1619.231225.310171.340279.683
Avenger's Shield5.1650.00047.190109.38831.923196.285
Blessed Hammer0.0900.0008.5716.7634.55922.756
Holy Bulwark (Holy Armaments)3.8910.00061.52323.40320.00062.741
Hammer of Wrath4.1060.00057.556125.51779.342164.745

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Dano
Blessed HammerHoly Power75.3275.3031.17%1.000.020.02%
Blessed Hammer (_absorb)Health124.313,120,018.0312.55%25,098.510.000.00%
Divine TollHoly Power5.395.392.23%1.000.000.00%
Hammer of WrathHoly Power30.5730.5612.65%1.000.010.03%
JudgmentHoly Power87.83130.3153.95%1.480.040.03%
Sacred Weapon (_proc_heal)Health0.34248,103.661.00%723,310.9330,807.4811.05%
Sacred WordHealth0.2553,720.740.22%217,377.0510,262.4916.04%
Word of GloryHealth7.0621,441,651.9786.24%3,037,635.55198,928.100.92%
Usage Type Count Total Tot% Avg RPE APR
Dano
Shield of the RighteousHoly Power95.48240.50100.00%2.522.52125,055.26
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Health7,540,280.0561,637.02625,149.272,458,191.4-10,466,083.5-34,460,026.34,585,642.0
Holy Power0.00.810.800.11.10.05.0

Statistics & Data Analysis

Fight Length
Dano Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Dano Damage Per Second
Count 9999
Mean 522995.91
Minimum 448677.84
Maximum 639414.22
Spread ( max - min ) 190736.38
Range [ ( max - min ) / 2 * 100% ] 18.23%
Standard Deviation 23052.5078
5th Percentile 486099.68
95th Percentile 562529.15
( 95th Percentile - 5th Percentile ) 76429.47
Mean Distribution
Standard Deviation 230.5366
95.00% Confidence Interval ( 522544.07 - 523447.76 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7464
0.1 Scale Factor Error with Delta=300 4536491
0.05 Scale Factor Error with Delta=300 18145963
0.01 Scale Factor Error with Delta=300 453649068
Priority Target DPS
Dano Priority Target Damage Per Second
Count 9999
Mean 522995.91
Minimum 448677.84
Maximum 639414.22
Spread ( max - min ) 190736.38
Range [ ( max - min ) / 2 * 100% ] 18.23%
Standard Deviation 23052.5078
5th Percentile 486099.68
95th Percentile 562529.15
( 95th Percentile - 5th Percentile ) 76429.47
Mean Distribution
Standard Deviation 230.5366
95.00% Confidence Interval ( 522544.07 - 523447.76 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7464
0.1 Scale Factor Error with Delta=300 4536491
0.05 Scale Factor Error with Delta=300 18145963
0.01 Scale Factor Error with Delta=300 453649068
DPS(e)
Dano Damage Per Second (Effective)
Count 9999
Mean 522995.91
Minimum 448677.84
Maximum 639414.22
Spread ( max - min ) 190736.38
Range [ ( max - min ) / 2 * 100% ] 18.23%
Damage
Dano Damage
Count 9999
Mean 156776460.26
Minimum 112008066.55
Maximum 212932230.25
Spread ( max - min ) 100924163.70
Range [ ( max - min ) / 2 * 100% ] 32.19%
DTPS
Dano Damage Taken Per Second
Count 9999
Mean 625250.02
Minimum 503780.52
Maximum 729677.90
Spread ( max - min ) 225897.39
Range [ ( max - min ) / 2 * 100% ] 18.06%
Standard Deviation 28992.3585
5th Percentile 577340.38
95th Percentile 673776.68
( 95th Percentile - 5th Percentile ) 96436.31
Mean Distribution
Standard Deviation 289.9381
95.00% Confidence Interval ( 624681.75 - 625818.29 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 83
0.1% Error 8260
0.1 Scale Factor Error with Delta=300 7175477
0.05 Scale Factor Error with Delta=300 28701907
0.01 Scale Factor Error with Delta=300 717547674
HPS
Dano Healing Per Second
Count 9999
Mean 72025.95
Minimum 0.00
Maximum 152863.98
Spread ( max - min ) 152863.98
Range [ ( max - min ) / 2 * 100% ] 106.12%
Standard Deviation 21378.8707
5th Percentile 36377.16
95th Percentile 106984.04
( 95th Percentile - 5th Percentile ) 70606.88
Mean Distribution
Standard Deviation 213.7994
95.00% Confidence Interval ( 71606.91 - 72444.98 )
Normalized 95.00% Confidence Interval ( 99.42% - 100.58% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 3385
0.1% Error 338445
0.1 Scale Factor Error with Delta=300 3901694
0.05 Scale Factor Error with Delta=300 15606776
0.01 Scale Factor Error with Delta=300 390169386
HPS(e)
Dano Healing Per Second (Effective)
Count 9999
Mean 72025.95
Minimum 0.00
Maximum 152863.98
Spread ( max - min ) 152863.98
Range [ ( max - min ) / 2 * 100% ] 106.12%
Heal
Dano Heal
Count 9999
Mean 21735120.03
Minimum 0.00
Maximum 51479516.14
Spread ( max - min ) 51479516.14
Range [ ( max - min ) / 2 * 100% ] 118.42%
HTPS
Dano Healing Taken Per Second
Count 9999
Mean 367156.76
Minimum 296115.85
Maximum 448141.04
Spread ( max - min ) 152025.19
Range [ ( max - min ) / 2 * 100% ] 20.70%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 rite_of_sanctification
1 0.00 rite_of_adjuration
2 0.00 snapshot_stats
3 0.00 devotion_aura
4 0.00 lights_judgment
5 0.00 arcane_torrent
6 0.00 consecration
7 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_cooldown&trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)|!trinket.2.has_cooldown
8 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_cooldown&trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)|!trinket.1.has_cooldown
Default action list Executed every time the actor is available.
# count action,conditions
9 1.00 auto_attack
A 0.00 call_action_list,name=cooldowns
B 0.00 call_action_list,name=defensives
C 0.00 call_action_list,name=trinkets
D 0.00 call_action_list,name=standard
actions.cooldowns
# count action,conditions
0.00 lights_judgment,if=spell_targets.lights_judgment>=2|!raid_event.adds.exists|raid_event.adds.in>75|raid_event.adds.up
E 4.30 avenging_wrath
F 1.32 potion,if=buff.avenging_wrath.up
0.00 moment_of_glory,if=(buff.avenging_wrath.remains<15|(time>10))
0.00 divine_toll,if=spell_targets.shield_of_the_righteous>=3
0.00 bastion_of_light,if=buff.avenging_wrath.up|cooldown.avenging_wrath.remains<=30
0.00 invoke_external_buff,name=power_infusion,if=buff.avenging_wrath.up
0.00 fireblood,if=buff.avenging_wrath.remains>8
actions.defensives
# count action,conditions
G 6.49 ardent_defender
actions.standard
# count action,conditions
H 12.41 judgment,target_if=charges>=2|full_recharge_time<=gcd.max
0.00 hammer_of_light,if=buff.hammer_of_light_free.remains<2|buff.shake_the_heavens.remains<1|!buff.shake_the_heavens.up|cooldown.eye_of_tyr.remains<1.5|fight_remains<2
0.00 eye_of_tyr,if=(hpg_to_2dawn=5|!talent.of_dusk_and_dawn.enabled)&talent.lights_guidance.enabled
0.00 eye_of_tyr,if=(hpg_to_2dawn=1|buff.blessing_of_dawn.stack>0)&talent.lights_guidance.enabled
I 95.48 shield_of_the_righteous,if=(!talent.righteous_protector.enabled|cooldown.righteous_protector_icd.remains=0)&!buff.hammer_of_light_ready.up
0.00 judgment,target_if=min:debuff.judgment.remains,if=spell_targets.shield_of_the_righteous>3&buff.bulwark_of_righteous_fury.stack>=3&holy_power<3
0.00 avengers_shield,if=!buff.bulwark_of_righteous_fury.up&talent.bulwark_of_righteous_fury.enabled&spell_targets.shield_of_the_righteous>=3
0.00 hammer_of_the_righteous,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3&!buff.avenging_wrath.up
J 35.12 blessed_hammer,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3&!buff.avenging_wrath.up
0.00 crusader_strike,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<2&!buff.avenging_wrath.up
0.00 judgment,target_if=min:debuff.judgment.remains,if=charges>=2|full_recharge_time<=gcd.max
0.00 consecration,if=buff.divine_guidance.stack=5
K 3.47 holy_armaments,if=next_armament=sacred_weapon&(!buff.sacred_weapon.up|(buff.sacred_weapon.remains<6&!buff.avenging_wrath.up&cooldown.avenging_wrath.remains<=30))
L 30.57 hammer_of_wrath
M 5.39 divine_toll,if=(!raid_event.adds.exists|raid_event.adds.in>10)
0.00 avengers_shield,if=talent.refining_fire.enabled&talent.lights_guidance.enabled
N 36.20 judgment,target_if=min:debuff.judgment.remains,if=(buff.avenging_wrath.up&talent.hammer_and_anvil.enabled)
O 0.18 holy_armaments,if=next_armament=holy_bulwark&charges=2
P 39.21 judgment,target_if=min:debuff.judgment.remains
0.00 avengers_shield,if=!buff.shake_the_heavens.up&talent.shake_the_heavens.enabled
0.00 hammer_of_the_righteous,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
Q 34.01 blessed_hammer,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
0.00 crusader_strike,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<2)|buff.shake_the_heavens.up
R 20.57 avengers_shield,if=!talent.lights_guidance.enabled
S 12.47 consecration,if=!consecration.up
T 4.50 eye_of_tyr,if=(talent.inmost_light.enabled&raid_event.adds.in>=45|spell_targets.shield_of_the_righteous>=3)&!talent.lights_deliverance.enabled
U 2.36 holy_armaments,if=next_armament=holy_bulwark
V 6.19 blessed_hammer
0.00 hammer_of_the_righteous
0.00 crusader_strike
W 7.06 word_of_glory,if=buff.shining_light_free.up&(talent.blessed_assurance.enabled|(talent.lights_guidance.enabled&cooldown.hammerfall_icd.remains=0))
0.00 avengers_shield
0.00 eye_of_tyr,if=!talent.lights_deliverance.enabled
0.00 word_of_glory,if=buff.shining_light_free.up
0.00 arcane_torrent,if=holy_power<5
X 0.23 consecration
actions.trinkets
# count action,conditions
0.00 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.avenging_wrath.up|fight_remains<=40)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready|!buff.avenging_wrath.up))|!variable.trinket_sync_slot)
Y 3.73 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.avenging_wrath.up|fight_remains<=40)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready|!buff.avenging_wrath.up))|!variable.trinket_sync_slot)

Sample Sequence

03689EFGYHLIMHINQILINIQIQNILQINQIQLNIQIRNIKLNIQNINILQHINIQLNIQRNILQIJPSTPIGJRPUVIJPVIWIPSJPIIRJHMIJHPIRJHPIJRPELIQNISQLNIIQRNILQIIYHNIGQLINQIRNLIIKQNIQSPTRPIJVPIJWWPJIMPJIRPJSPIJUPVIWPJRPIGSJWPJIITPJELIHNIQRLINQINQILNIQNIIRLNIQSYNIILQMINQILJHIPJRGPIJKPSTPIJVPIRJWIPJIWPSJPIRJPWJIWPWJPIRJPELIQSNIULNIMQGNILQINQIQLNIRQNILQINSQILPRYJIPLJIPTJLIPRJPILJPIKJLPIRJPLI

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0rite_of_sanctification
[precombat]
Dano 7540280.0/7540280 100% HP
0.0/5 0% HoPo
Pre3devotion_aura
[precombat]
Fluffy_Pillow 7540280.0/7540280 100% HP
0.0/5 0% HoPo
Pre6consecration
[precombat]
Fluffy_Pillow 7540280.0/7540280 100% HP
0.0/5 0% HoPo
Pre8trinket_sync_slot
[precombat]
Dano 7540280.0/7540280 100% HP
0.0/5 0% HoPo
0:00.0009auto_attack
[default]
Fluffy_Pillow 7540280.0/7540280 100% HP
0.0/5 0% HoPo
0:00.000Eavenging_wrath
[cooldowns]
Fluffy_Pillow 7540280.0/7540280 100% HP
0.0/5 0% HoPo
bloodlust
0:00.000Fpotion
[cooldowns]
Fluffy_Pillow 7540280.0/7540280 100% HP
0.0/5 0% HoPo
bloodlust, avenging_wrath, sacred_weapon, blessing_of_the_forge, heightened_wrath
0:00.000Gardent_defender
[defensives]
Fluffy_Pillow 7540280.0/7540280 100% HP
0.0/5 0% HoPo
bloodlust, avenging_wrath, sacred_weapon, blessing_of_the_forge, heightened_wrath, tempered_potion
0:00.000Yuse_items
[trinkets]
Fluffy_Pillow 7540280.0/7540280 100% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, avenging_wrath, sacred_weapon, blessing_of_the_forge, heightened_wrath, tempered_potion
0:00.000Hjudgment
[standard]
Fluffy_Pillow 7540280.0/7540280 100% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, avenging_wrath, sacred_weapon, blessing_of_the_forge, heightened_wrath, skarmorak_shard, tempered_potion
0:00.968Lhammer_of_wrath
[standard]
Fluffy_Pillow 7540280.0/7540280 100% HP
2.0/5 40% HoPo
bloodlust, ardent_defender, avenging_wrath, sacred_weapon, blessing_of_the_forge, fake_solidarity, heightened_wrath, skarmorak_shard, tempered_potion
0:00.968Ishield_of_the_righteous
[standard]
Fluffy_Pillow 7540280.0/7540280 100% HP
3.0/5 60% HoPo
bloodlust, ardent_defender, avenging_wrath, sacred_weapon, blessing_of_the_forge, fake_solidarity, heightened_wrath, skarmorak_shard, tempered_potion
0:01.938Mdivine_toll
[standard]
Fluffy_Pillow 7691080.0/7691080 100% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, redoubt, shield_of_the_righteous, shining_light_stacks, avenging_wrath, faiths_armor, relentless_inquisitor, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath, heightened_wrath, skarmorak_shard, tempered_potion
0:02.897Hjudgment
[standard]
Fluffy_Pillow 7691080.0/7691080 100% HP
1.0/5 20% HoPo
bloodlust, ardent_defender, bulwark_of_order, redoubt, shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, avenging_wrath, strength_in_adversity, faiths_armor, relentless_inquisitor, divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath, heightened_wrath, skarmorak_shard, tempered_potion
0:02.897Ishield_of_the_righteous
[standard]
Fluffy_Pillow 7691080.0/7691080 100% HP
3.0/5 60% HoPo
bloodlust, ardent_defender, bulwark_of_order, redoubt, shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, avenging_wrath, strength_in_adversity, blessing_of_dawn, faiths_armor, relentless_inquisitor, divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath, heightened_wrath, skarmorak_shard, tempered_potion
0:03.855Njudgment
[standard]
Fluffy_Pillow 7841880.0/7841880 100% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, bulwark_of_order, redoubt(2), shield_of_the_righteous, shining_light_stacks(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(2), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(2), heightened_wrath, skarmorak_shard, tempered_potion
0:04.806Qblessed_hammer
[standard]
Fluffy_Pillow 6538042.9/7841880 83% HP
2.0/5 40% HoPo
bloodlust, ardent_defender, redoubt(2), shield_of_the_righteous, shining_light_stacks(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(2), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(2), heightened_wrath, skarmorak_shard, tempered_potion
0:04.806Ishield_of_the_righteous
[standard]
Fluffy_Pillow 6538042.9/7841880 83% HP
3.0/5 60% HoPo
bloodlust, ardent_defender, redoubt(2), shield_of_the_righteous, shining_light_stacks(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(2), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(2), heightened_wrath, skarmorak_shard, tempered_potion
0:05.757Lhammer_of_wrath
[standard]
Fluffy_Pillow 7992700.0/7992700 100% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(3), heightened_wrath, skarmorak_shard, tempered_potion
0:05.856Ishield_of_the_righteous
[standard]
Fluffy_Pillow 7992700.0/7992700 100% HP
1.0/5 20% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(3), heightened_wrath, skarmorak_shard, tempered_potion
0:06.700Njudgment
[standard]
Fluffy_Pillow 7992700.0/7992700 100% HP
1.0/5 20% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(4), heightened_wrath, skarmorak_shard, tempered_potion
0:06.901Ishield_of_the_righteous
[standard]
Fluffy_Pillow 7992700.0/7992700 100% HP
3.0/5 60% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(4), heightened_wrath, skarmorak_shard, tempered_potion
0:07.640Qblessed_hammer
[standard]
Fluffy_Pillow 7613234.9/7992700 95% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(5), heightened_wrath, skarmorak_shard, tempered_potion
0:07.964Ishield_of_the_righteous
[standard]
Fluffy_Pillow 7613234.9/7992700 95% HP
1.0/5 20% HoPo
bloodlust, ardent_defender, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(5), heightened_wrath, skarmorak_shard, tempered_potion
0:08.580Qblessed_hammer
[standard]
Fluffy_Pillow 7613234.9/7992700 95% HP
1.0/5 20% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(6), heightened_wrath, skarmorak_shard, tempered_potion
0:09.520Njudgment
[standard]
Fluffy_Pillow 7212810.6/7992700 90% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(6), heightened_wrath, skarmorak_shard, tempered_potion
0:09.520Ishield_of_the_righteous
[standard]
Fluffy_Pillow 7212810.6/7992700 90% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(6), heightened_wrath, skarmorak_shard, tempered_potion
0:10.460Lhammer_of_wrath
[standard]
Fluffy_Pillow 7992700.0/7992700 100% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(7), heightened_wrath, skarmorak_shard, tempered_potion
0:11.401Qblessed_hammer
[standard]
Fluffy_Pillow 7333984.6/7992700 92% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(7), heightened_wrath, skarmorak_shard, tempered_potion
0:11.401Ishield_of_the_righteous
[standard]
Fluffy_Pillow 7333984.6/7992700 92% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(7), heightened_wrath, skarmorak_shard, tempered_potion
0:12.342Njudgment
[standard]
Fluffy_Pillow 7333984.6/7992700 92% HP
0.0/5 0% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(8), heightened_wrath, skarmorak_shard, tempered_potion
0:13.381Qblessed_hammer
[standard]
Fluffy_Pillow 6751555.4/7992700 84% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(8), heightened_wrath, skarmorak_shard, tempered_potion
0:13.381Ishield_of_the_righteous
[standard]
Fluffy_Pillow 6751555.4/7992700 84% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(8), heightened_wrath, skarmorak_shard, tempered_potion
0:14.322Qblessed_hammer
[standard]
Fluffy_Pillow 6751555.4/7992700 84% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(9), heightened_wrath, skarmorak_shard, tempered_potion
0:15.261Lhammer_of_wrath
[standard]
Fluffy_Pillow 7333984.6/7992700 92% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(9), heightened_wrath, tempered_potion
0:16.202Njudgment
[standard]
Fluffy_Pillow 4919834.0/7992700 62% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(9), heightened_wrath, tempered_potion
0:16.202Ishield_of_the_righteous
[standard]
Fluffy_Pillow 4919834.0/7992700 62% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(9), heightened_wrath, tempered_potion
0:17.143Qblessed_hammer
[standard]
Fluffy_Pillow 4259517.8/7992700 53% HP
1.0/5 20% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(10), heightened_wrath, tempered_potion
0:17.287Ishield_of_the_righteous
[standard]
Fluffy_Pillow 4259517.8/7992700 53% HP
2.0/5 40% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(10), heightened_wrath, tempered_potion
0:18.229Ravengers_shield
[standard]
Fluffy_Pillow 2747026.8/7992700 34% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(11), heightened_wrath, tempered_potion
0:19.168Njudgment
[standard]
Fluffy_Pillow 2204917.7/7992700 28% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(11), heightened_wrath, tempered_potion
0:19.168Ishield_of_the_righteous
[standard]
Fluffy_Pillow 2204917.7/7992700 28% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(11), heightened_wrath, tempered_potion
0:20.109Kholy_armaments
[standard]
Fluffy_Pillow 2138585.1/7992700 27% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(12), heightened_wrath, tempered_potion
0:21.050Lhammer_of_wrath
[standard]
Fluffy_Pillow 1452990.0/7992700 18% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(12), heightened_wrath, tempered_potion
0:21.991Njudgment
[standard]
Fluffy_Pillow 1452990.0/7992700 18% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(12), heightened_wrath, tempered_potion
0:21.991Ishield_of_the_righteous
[standard]
Fluffy_Pillow 1452990.0/7992700 18% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(12), heightened_wrath, tempered_potion
0:22.931Qblessed_hammer
[standard]
Fluffy_Pillow -168835.3/7992700 -2% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(13), heightened_wrath, tempered_potion
0:23.872Njudgment
[standard]
Fluffy_Pillow -829151.5/7992700 -10% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(13), heightened_wrath, tempered_potion
0:23.872Ishield_of_the_righteous
[standard]
Fluffy_Pillow -829151.5/7992700 -10% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(13), heightened_wrath, tempered_potion
0:24.813Njudgment
[standard]
Fluffy_Pillow -829151.5/7992700 -10% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(14), heightened_wrath, tempered_potion
0:24.885Ishield_of_the_righteous
[standard]
Fluffy_Pillow -829151.5/7992700 -10% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(14), heightened_wrath, tempered_potion
0:25.826Lhammer_of_wrath
[standard]
Fluffy_Pillow -14746.6/7992700 -0% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(15), heightened_wrath, tempered_potion
0:26.766Qblessed_hammer
[standard]
Fluffy_Pillow -2436312.3/7992700 -30% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(15), heightened_wrath, tempered_potion
0:27.705Hjudgment
[standard]
Fluffy_Pillow -3096628.5/7992700 -39% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(15), heightened_wrath, tempered_potion
0:27.705Ishield_of_the_righteous
[standard]
Fluffy_Pillow -3096628.5/7992700 -39% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(15), heightened_wrath, tempered_potion
0:28.645Njudgment
[standard]
Fluffy_Pillow -4699165.0/7992700 -59% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(16), heightened_wrath, tempered_potion
0:28.760Ishield_of_the_righteous
[standard]
Fluffy_Pillow -4699165.0/7992700 -59% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(16), heightened_wrath, tempered_potion
0:29.585Qblessed_hammer
[standard]
Fluffy_Pillow -5384760.1/7992700 -67% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(17), heightened_wrath, tempered_potion
0:30.525Lhammer_of_wrath
[standard]
Fluffy_Pillow -5466801.6/7992700 -68% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(17)
0:31.497Njudgment
[standard]
Fluffy_Pillow -6164633.6/7992700 -77% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(17)
0:31.497Ishield_of_the_righteous
[standard]
Fluffy_Pillow -6164633.6/7992700 -77% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(17)
0:32.469Qblessed_hammer
[standard]
Fluffy_Pillow -6164633.6/7992700 -77% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(18)
0:33.441Ravengers_shield
[standard]
Fluffy_Pillow -6837933.7/7992700 -86% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(18)
0:34.414Njudgment
[standard]
Fluffy_Pillow -6837933.7/7992700 -86% HP
2.0/5 40% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(18)
0:34.414Ishield_of_the_righteous
[standard]
Fluffy_Pillow -6837933.7/7992700 -86% HP
4.0/5 80% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(18)
0:35.387Lhammer_of_wrath
[standard]
Fluffy_Pillow -5943810.9/7992700 -74% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(19)
0:36.360Qblessed_hammer
[standard]
Fluffy_Pillow -5943810.9/7992700 -74% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(19)
0:36.360Ishield_of_the_righteous
[standard]
Fluffy_Pillow -5943810.9/7992700 -74% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(19)
0:37.332Jblessed_hammer
[standard]
Fluffy_Pillow -6617111.0/7992700 -83% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(20)
0:38.305Pjudgment
[standard]
Fluffy_Pillow -6617111.0/7992700 -83% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(20)
0:39.277Sconsecration
[standard]
Fluffy_Pillow -7290411.1/7992700 -91% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(20)
0:40.250Teye_of_tyr
[standard]
Fluffy_Pillow -5790411.1/7992700 -72% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), rising_wrath(20)
0:41.514Pjudgment
[standard]
Fluffy_Pillow -6230857.0/7992700 -78% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(20)
0:41.514Ishield_of_the_righteous
[standard]
Fluffy_Pillow -6230857.0/7992700 -78% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(20)
0:42.000Gardent_defender
[defensives]
Fluffy_Pillow -6230857.0/7992700 -78% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(21)
0:42.777Jblessed_hammer
[standard]
Fluffy_Pillow -6230857.0/7992700 -78% HP
0.0/5 0% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(21)
0:44.041Ravengers_shield
[standard]
Fluffy_Pillow 1598540.0/7992700 20% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), rising_wrath(21)
0:45.333Pjudgment
[standard]
Fluffy_Pillow 2689748.1/7992700 34% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), rising_wrath(21)
0:46.597Uholy_armaments
[standard]
Fluffy_Pillow 2689748.1/7992700 34% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(21), flask_of_alchemical_chaos_haste
0:47.800Vblessed_hammer
[standard]
Fluffy_Pillow 2689748.1/7992700 34% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, rising_wrath(21), flask_of_alchemical_chaos_haste
0:47.800Ishield_of_the_righteous
[standard]
Fluffy_Pillow 2689748.1/7992700 34% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, rising_wrath(21), flask_of_alchemical_chaos_haste
0:49.005Jblessed_hammer
[standard]
Fluffy_Pillow 2689748.1/7992700 34% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(22), flask_of_alchemical_chaos_haste
0:50.207Pjudgment
[standard]
Fluffy_Pillow 4189748.1/7992700 52% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, rising_wrath(22), flask_of_alchemical_chaos_haste
0:51.410Vblessed_hammer
[standard]
Fluffy_Pillow 4004819.5/7992700 50% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, rising_wrath(22), flask_of_alchemical_chaos_haste
0:51.614Ishield_of_the_righteous
[standard]
Fluffy_Pillow 4004819.5/7992700 50% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, rising_wrath(22), flask_of_alchemical_chaos_haste
0:52.819Wword_of_glory
[standard]
Dano 4004819.5/7992700 50% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(23), flask_of_alchemical_chaos_haste
0:53.903Ishield_of_the_righteous
[standard]
Fluffy_Pillow 5066527.6/7992700 63% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, barricade_of_faith, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, rising_wrath(24), flask_of_alchemical_chaos_haste
0:54.023Pjudgment
[standard]
Fluffy_Pillow 5066527.6/7992700 63% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, rising_wrath(25), flask_of_alchemical_chaos_haste
0:55.226Sconsecration
[standard]
Fluffy_Pillow 6054346.9/7992700 76% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, rising_wrath(25), flask_of_alchemical_chaos_haste
0:56.431Jblessed_hammer
[standard]
Fluffy_Pillow 6054346.9/7992700 76% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, rising_wrath(25), flask_of_alchemical_chaos_haste
0:57.632Pjudgment
[standard]
Fluffy_Pillow 5625371.0/7992700 70% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, rising_wrath(25), flask_of_alchemical_chaos_haste
0:57.632Ishield_of_the_righteous
[standard]
Fluffy_Pillow 5625371.0/7992700 70% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, rising_wrath(25), flask_of_alchemical_chaos_haste
0:58.646Ishield_of_the_righteous
[standard]
Fluffy_Pillow 5625371.0/7992700 70% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), faith_in_the_light, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(26), flask_of_alchemical_chaos_haste
0:58.836Ravengers_shield
[standard]
Fluffy_Pillow 5625371.0/7992700 70% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(27), flask_of_alchemical_chaos_haste
1:00.038Jblessed_hammer
[standard]
Fluffy_Pillow 6808791.3/7992700 85% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, rising_wrath(27), flask_of_alchemical_chaos_haste
1:01.241Hjudgment
[standard]
Fluffy_Pillow 6379815.4/7992700 80% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, rising_wrath(27), flask_of_alchemical_chaos_haste
1:02.445Mdivine_toll
[standard]
Fluffy_Pillow 2747220.2/7992700 34% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, rising_wrath(27), flask_of_alchemical_chaos_haste
1:02.445Ishield_of_the_righteous
[standard]
Fluffy_Pillow 2747220.2/7992700 34% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, rising_wrath(27), flask_of_alchemical_chaos_haste
1:03.648Jblessed_hammer
[standard]
Fluffy_Pillow 2425288.3/7992700 30% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, blessed_assurance, fake_solidarity, rising_wrath(28), flask_of_alchemical_chaos_haste
1:04.853Hjudgment
[standard]
Fluffy_Pillow 2425288.3/7992700 30% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, holy_bulwark_absorb, fake_solidarity, rising_wrath(28), flask_of_alchemical_chaos_haste
1:06.057Pjudgment
[standard]
Fluffy_Pillow 2071358.3/7992700 26% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, rising_wrath(28), flask_of_alchemical_chaos_haste
1:06.057Ishield_of_the_righteous
[standard]
Fluffy_Pillow 2071358.3/7992700 26% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, rising_wrath(28), flask_of_alchemical_chaos_haste
1:07.260Ravengers_shield
[standard]
Fluffy_Pillow 2071358.3/7992700 26% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark_absorb, blessed_assurance, rising_wrath(29), flask_of_alchemical_chaos_haste
1:08.464Jblessed_hammer
[standard]
Fluffy_Pillow 299984.4/7992700 4% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, rising_wrath(29), flask_of_alchemical_chaos_haste
1:09.668Hjudgment
[standard]
Fluffy_Pillow 299984.4/7992700 4% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, rising_wrath(29), flask_of_alchemical_chaos_haste
1:10.873Pjudgment
[standard]
Fluffy_Pillow -551774.8/7992700 -7% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, rising_wrath(29), flask_of_alchemical_chaos_haste
1:10.873Ishield_of_the_righteous
[standard]
Fluffy_Pillow -551774.8/7992700 -7% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, rising_wrath(29), flask_of_alchemical_chaos_haste
1:12.077Jblessed_hammer
[standard]
Fluffy_Pillow -2883580.3/7992700 -36% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, rising_wrath(30), flask_of_alchemical_chaos_haste
1:13.281Ravengers_shield
[standard]
Fluffy_Pillow -2883580.3/7992700 -36% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, rising_wrath(30), flask_of_alchemical_chaos_haste
1:14.483Pjudgment
[standard]
Fluffy_Pillow -5895011.6/7992700 -74% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, fake_solidarity, rising_wrath(30), flask_of_alchemical_chaos_haste
1:15.685Eavenging_wrath
[cooldowns]
Fluffy_Pillow -4395011.6/7992700 -55% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, sacred_weapon, fake_solidarity, rising_wrath(30), flask_of_alchemical_chaos_haste
1:15.685Lhammer_of_wrath
[standard]
Fluffy_Pillow -4395011.6/7992700 -55% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, heightened_wrath, flask_of_alchemical_chaos_haste
1:15.685Ishield_of_the_righteous
[standard]
Fluffy_Pillow -4395011.6/7992700 -55% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, heightened_wrath, flask_of_alchemical_chaos_haste
1:16.890Qblessed_hammer
[standard]
Fluffy_Pillow -6694663.4/7992700 -84% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath, heightened_wrath, flask_of_alchemical_chaos_mastery
1:18.155Njudgment
[standard]
Fluffy_Pillow -9814398.6/7992700 -123% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath, heightened_wrath, flask_of_alchemical_chaos_mastery
1:18.155Ishield_of_the_righteous
[standard]
Fluffy_Pillow -9814398.6/7992700 -123% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath, heightened_wrath, flask_of_alchemical_chaos_mastery
1:19.417Sconsecration
[standard]
Fluffy_Pillow -9814398.6/7992700 -123% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_mastery
1:20.681Qblessed_hammer
[standard]
Fluffy_Pillow -8892637.5/7992700 -111% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_mastery
1:21.944Lhammer_of_wrath
[standard]
Fluffy_Pillow -8892637.5/7992700 -111% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_mastery
1:23.208Njudgment
[standard]
Fluffy_Pillow -10887659.2/7992700 -136% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_mastery
1:23.208Ishield_of_the_righteous
[standard]
Fluffy_Pillow -10887659.2/7992700 -136% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_mastery
1:24.306Ishield_of_the_righteous
[standard]
Fluffy_Pillow -13623249.2/7992700 -170% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(3), heightened_wrath, flask_of_alchemical_chaos_mastery
1:24.472Qblessed_hammer
[standard]
Fluffy_Pillow -13623249.2/7992700 -170% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(4), heightened_wrath, flask_of_alchemical_chaos_mastery
1:25.734Ravengers_shield
[standard]
Fluffy_Pillow -12123249.2/7992700 -152% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(4), heightened_wrath, flask_of_alchemical_chaos_mastery
1:26.998Njudgment
[standard]
Fluffy_Pillow -14032398.8/7992700 -176% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(4), heightened_wrath, flask_of_alchemical_chaos_mastery
1:26.998Ishield_of_the_righteous
[standard]
Fluffy_Pillow -14032398.8/7992700 -176% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(4), heightened_wrath, flask_of_alchemical_chaos_mastery
1:28.261Lhammer_of_wrath
[standard]
Fluffy_Pillow -16044062.0/7992700 -201% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(5), heightened_wrath, flask_of_alchemical_chaos_mastery
1:29.525Qblessed_hammer
[standard]
Fluffy_Pillow -16044062.0/7992700 -201% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(5), heightened_wrath, flask_of_alchemical_chaos_mastery
1:29.525Ishield_of_the_righteous
[standard]
Fluffy_Pillow -16044062.0/7992700 -201% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(5), heightened_wrath, flask_of_alchemical_chaos_mastery
1:30.618Ishield_of_the_righteous
[standard]
Fluffy_Pillow -16564022.5/7992700 -207% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(6), heightened_wrath, flask_of_alchemical_chaos_mastery
1:30.787Yuse_items
[trinkets]
Fluffy_Pillow -16564022.5/7992700 -207% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(7), heightened_wrath, flask_of_alchemical_chaos_mastery
1:30.787Hjudgment
[standard]
Fluffy_Pillow -16564022.5/7992700 -207% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(7), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:32.051Njudgment
[standard]
Fluffy_Pillow -17151820.4/7992700 -215% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(7), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:32.051Ishield_of_the_righteous
[standard]
Fluffy_Pillow -17151820.4/7992700 -215% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(7), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:32.051Gardent_defender
[defensives]
Fluffy_Pillow -17151820.4/7992700 -215% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(8), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:33.313Qblessed_hammer
[standard]
Fluffy_Pillow -17151820.4/7992700 -215% HP
1.0/5 20% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(8), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:34.577Lhammer_of_wrath
[standard]
Fluffy_Pillow -1166420.4/7992700 -15% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(8), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:34.577Ishield_of_the_righteous
[standard]
Fluffy_Pillow -1166420.4/7992700 -15% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath(8), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:35.839Njudgment
[standard]
Fluffy_Pillow 333579.6/7992700 4% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, rising_wrath(9), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:37.102Qblessed_hammer
[standard]
Fluffy_Pillow -337129.4/7992700 -4% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, rising_wrath(9), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:37.102Ishield_of_the_righteous
[standard]
Fluffy_Pillow -337129.4/7992700 -4% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, rising_wrath(9), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:38.366Ravengers_shield
[standard]
Fluffy_Pillow -1007838.4/7992700 -13% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, rising_wrath(10), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:39.629Njudgment
[standard]
Fluffy_Pillow -1007838.4/7992700 -13% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, rising_wrath(10), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:40.942Lhammer_of_wrath
[standard]
Fluffy_Pillow -96903.7/7992700 -1% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, rising_wrath(10), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:40.942Ishield_of_the_righteous
[standard]
Fluffy_Pillow -96903.7/7992700 -1% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, rising_wrath(10), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:42.044Ishield_of_the_righteous
[standard]
Fluffy_Pillow -801931.4/7992700 -10% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(11), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:42.205Kholy_armaments
[standard]
Fluffy_Pillow -801931.4/7992700 -10% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(12), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:43.471Qblessed_hammer
[standard]
Fluffy_Pillow -801931.4/7992700 -10% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(12), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:44.734Njudgment
[standard]
Fluffy_Pillow -1472640.4/7992700 -18% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(12), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:44.734Ishield_of_the_righteous
[standard]
Fluffy_Pillow -1472640.4/7992700 -18% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(12), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_mastery
1:45.996Qblessed_hammer
[standard]
Fluffy_Pillow 27359.6/7992700 0% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(13), flask_of_alchemical_chaos_mastery
1:47.260Sconsecration
[standard]
Fluffy_Pillow -644949.9/7992700 -8% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(13), flask_of_alchemical_chaos_vers
1:48.523Pjudgment
[standard]
Fluffy_Pillow -1243937.8/7992700 -16% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(13), flask_of_alchemical_chaos_vers
1:49.787Teye_of_tyr
[standard]
Fluffy_Pillow -1243937.8/7992700 -16% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(13), flask_of_alchemical_chaos_vers
1:51.051Ravengers_shield
[standard]
Fluffy_Pillow -168729.3/7992700 -2% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), strength_in_adversity, blessing_of_dawn, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(13), flask_of_alchemical_chaos_vers
1:52.314Pjudgment
[standard]
Fluffy_Pillow -580858.5/7992700 -7% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(13), flask_of_alchemical_chaos_vers
1:52.314Ishield_of_the_righteous
[standard]
Fluffy_Pillow -580858.5/7992700 -7% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(13), flask_of_alchemical_chaos_vers
1:53.577Jblessed_hammer
[standard]
Fluffy_Pillow -580858.5/7992700 -7% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(14), flask_of_alchemical_chaos_vers
1:54.840Vblessed_hammer
[standard]
Fluffy_Pillow -1005650.1/7992700 -13% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(14), flask_of_alchemical_chaos_vers
1:56.103Pjudgment
[standard]
Fluffy_Pillow -80188.5/7992700 -1% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(14), flask_of_alchemical_chaos_vers
1:56.303Ishield_of_the_righteous
[standard]
Fluffy_Pillow -80188.5/7992700 -1% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(14), flask_of_alchemical_chaos_vers
1:57.565Jblessed_hammer
[standard]
Fluffy_Pillow -80188.5/7992700 -1% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(15), flask_of_alchemical_chaos_vers
1:58.830Wword_of_glory
[standard]
Dano -654727.0/7992700 -8% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(15), flask_of_alchemical_chaos_vers
2:00.093Wword_of_glory
[standard]
Dano 3665494.1/7992700 46% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(16), flask_of_alchemical_chaos_vers
2:01.355Pjudgment
[standard]
Fluffy_Pillow 5391000.7/7992700 67% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), faith_in_the_light, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(17), flask_of_alchemical_chaos_vers
2:02.617Jblessed_hammer
[standard]
Fluffy_Pillow -898811.4/7992700 -11% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), blessed_assurance, rising_wrath(17), flask_of_alchemical_chaos_vers
2:02.617Ishield_of_the_righteous
[standard]
Fluffy_Pillow -898811.4/7992700 -11% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(17), flask_of_alchemical_chaos_vers
2:03.882Mdivine_toll
[standard]
Fluffy_Pillow -898811.4/7992700 -11% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(18), flask_of_alchemical_chaos_vers
2:05.146Pjudgment
[standard]
Fluffy_Pillow -2549728.2/7992700 -32% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, rising_wrath(18), flask_of_alchemical_chaos_vers
2:06.410Jblessed_hammer
[standard]
Fluffy_Pillow -5652947.7/7992700 -71% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, rising_wrath(18), flask_of_alchemical_chaos_vers
2:06.410Ishield_of_the_righteous
[standard]
Fluffy_Pillow -5652947.7/7992700 -71% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, rising_wrath(18), flask_of_alchemical_chaos_vers
2:07.674Ravengers_shield
[standard]
Fluffy_Pillow -5652947.7/7992700 -71% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, rising_wrath(19), flask_of_alchemical_chaos_vers
2:08.937Pjudgment
[standard]
Fluffy_Pillow -8063650.5/7992700 -101% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, rising_wrath(19), flask_of_alchemical_chaos_vers
2:10.200Jblessed_hammer
[standard]
Fluffy_Pillow -8783013.0/7992700 -110% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, rising_wrath(19), flask_of_alchemical_chaos_vers
2:11.463Sconsecration
[standard]
Fluffy_Pillow -9445831.7/7992700 -118% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, rising_wrath(19), flask_of_alchemical_chaos_vers
2:12.726Pjudgment
[standard]
Fluffy_Pillow -10933982.3/7992700 -137% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, rising_wrath(19), flask_of_alchemical_chaos_vers
2:12.927Ishield_of_the_righteous
[standard]
Fluffy_Pillow -10933982.3/7992700 -137% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, rising_wrath(19), flask_of_alchemical_chaos_vers
2:14.190Jblessed_hammer
[standard]
Fluffy_Pillow -12950034.1/7992700 -162% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, rising_wrath(20), flask_of_alchemical_chaos_vers
2:15.590Uholy_armaments
[standard]
Fluffy_Pillow -11919088.9/7992700 -149% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, rising_wrath(20), flask_of_alchemical_chaos_vers
2:16.850Pjudgment
[standard]
Fluffy_Pillow -11979389.4/7992700 -150% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, rising_wrath(20), flask_of_alchemical_chaos_crit
2:18.348Vblessed_hammer
[standard]
Fluffy_Pillow -12568500.2/7992700 -157% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, holy_bulwark, holy_bulwark_absorb, fake_solidarity, rising_wrath(20), flask_of_alchemical_chaos_crit
2:18.526Ishield_of_the_righteous
[standard]
Fluffy_Pillow -12568500.2/7992700 -157% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, holy_bulwark, holy_bulwark_absorb, fake_solidarity, rising_wrath(20), flask_of_alchemical_chaos_crit
2:19.790Wword_of_glory
[standard]
Dano -12997757.1/7992700 -163% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(21), flask_of_alchemical_chaos_crit
2:21.054Pjudgment
[standard]
Fluffy_Pillow -10774801.3/7992700 -135% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, rising_wrath(22), flask_of_alchemical_chaos_crit
2:22.503Jblessed_hammer
[standard]
Fluffy_Pillow -12739108.0/7992700 -159% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, rising_wrath(22), flask_of_alchemical_chaos_crit
2:23.986Ravengers_shield
[standard]
Fluffy_Pillow -13328218.9/7992700 -167% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, rising_wrath(22), flask_of_alchemical_chaos_crit
2:25.249Pjudgment
[standard]
Fluffy_Pillow -14684074.7/7992700 -184% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, fake_solidarity, rising_wrath(22), flask_of_alchemical_chaos_crit
2:25.395Ishield_of_the_righteous
[standard]
Fluffy_Pillow -14684074.7/7992700 -184% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, fake_solidarity, rising_wrath(22), flask_of_alchemical_chaos_crit
2:26.051Gardent_defender
[defensives]
Fluffy_Pillow -14684074.7/7992700 -184% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(23), flask_of_alchemical_chaos_crit
2:26.659Sconsecration
[standard]
Fluffy_Pillow -14684074.7/7992700 -184% HP
0.0/5 0% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(23), flask_of_alchemical_chaos_crit
2:27.921Jblessed_hammer
[standard]
Fluffy_Pillow 1301325.3/7992700 16% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(23), flask_of_alchemical_chaos_crit
2:29.185Wword_of_glory
[standard]
Dano -386155.7/7992700 -5% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, rising_wrath(23), flask_of_alchemical_chaos_crit
2:30.448Pjudgment
[standard]
Fluffy_Pillow 2227008.3/7992700 28% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, rising_wrath(24), flask_of_alchemical_chaos_crit
2:31.710Jblessed_hammer
[standard]
Fluffy_Pillow 1637897.5/7992700 20% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(24), flask_of_alchemical_chaos_crit
2:31.710Ishield_of_the_righteous
[standard]
Fluffy_Pillow 1637897.5/7992700 20% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, rising_wrath(24), flask_of_alchemical_chaos_crit
2:32.789Ishield_of_the_righteous
[standard]
Fluffy_Pillow 1637897.5/7992700 20% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), faith_in_the_light, barricade_of_faith, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(25), flask_of_alchemical_chaos_crit
2:32.972Teye_of_tyr
[standard]
Fluffy_Pillow 1637897.5/7992700 20% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(26), flask_of_alchemical_chaos_crit
2:34.235Pjudgment
[standard]
Fluffy_Pillow 1362051.3/7992700 17% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, rising_wrath(26), flask_of_alchemical_chaos_crit
2:35.500Jblessed_hammer
[standard]
Fluffy_Pillow 2862051.3/7992700 36% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity(2), rising_wrath(26), flask_of_alchemical_chaos_crit
2:36.762Eavenging_wrath
[cooldowns]
Fluffy_Pillow 2862051.3/7992700 36% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, rising_wrath(26), flask_of_alchemical_chaos_crit
2:36.762Lhammer_of_wrath
[standard]
Fluffy_Pillow 2862051.3/7992700 36% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessing_of_the_forge, fake_solidarity, heightened_wrath, flask_of_alchemical_chaos_crit
2:36.762Ishield_of_the_righteous
[standard]
Fluffy_Pillow 2862051.3/7992700 36% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessing_of_the_forge, fake_solidarity, heightened_wrath, flask_of_alchemical_chaos_crit
2:38.025Hjudgment
[standard]
Fluffy_Pillow 2862051.3/7992700 36% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath, heightened_wrath, flask_of_alchemical_chaos_crit
2:39.289Njudgment
[standard]
Fluffy_Pillow 2862051.3/7992700 36% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath, heightened_wrath, flask_of_alchemical_chaos_crit
2:39.289Ishield_of_the_righteous
[standard]
Fluffy_Pillow 2862051.3/7992700 36% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath, heightened_wrath, flask_of_alchemical_chaos_crit
2:40.551Qblessed_hammer
[standard]
Fluffy_Pillow 4362051.3/7992700 55% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_crit
2:41.814Ravengers_shield
[standard]
Fluffy_Pillow 4124907.7/7992700 52% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_crit
2:43.078Lhammer_of_wrath
[standard]
Fluffy_Pillow 3732049.5/7992700 47% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_crit
2:43.078Ishield_of_the_righteous
[standard]
Fluffy_Pillow 3732049.5/7992700 47% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_crit
2:44.342Njudgment
[standard]
Fluffy_Pillow 3732049.5/7992700 47% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(3), heightened_wrath, flask_of_alchemical_chaos_crit
2:45.605Qblessed_hammer
[standard]
Fluffy_Pillow 4718603.4/7992700 59% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(3), heightened_wrath, flask_of_alchemical_chaos_crit
2:45.605Ishield_of_the_righteous
[standard]
Fluffy_Pillow 4718603.4/7992700 59% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(3), heightened_wrath, flask_of_alchemical_chaos_crit
2:46.868Njudgment
[standard]
Fluffy_Pillow 4718603.4/7992700 59% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(4), heightened_wrath, flask_of_alchemical_chaos_crit
2:48.125Qblessed_hammer
[standard]
Fluffy_Pillow 4205157.3/7992700 53% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(4), heightened_wrath, flask_of_alchemical_chaos_crit
2:48.125Ishield_of_the_righteous
[standard]
Fluffy_Pillow 4205157.3/7992700 53% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(4), heightened_wrath, flask_of_alchemical_chaos_crit
2:49.383Lhammer_of_wrath
[standard]
Fluffy_Pillow 3691628.7/7992700 46% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(5), heightened_wrath, flask_of_alchemical_chaos_crit
2:50.641Njudgment
[standard]
Fluffy_Pillow 5191628.7/7992700 65% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(5), heightened_wrath, flask_of_alchemical_chaos_crit
2:50.641Ishield_of_the_righteous
[standard]
Fluffy_Pillow 5191628.7/7992700 65% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(5), heightened_wrath, flask_of_alchemical_chaos_crit
2:51.900Qblessed_hammer
[standard]
Fluffy_Pillow 4678100.0/7992700 59% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(3), rising_wrath(6), heightened_wrath, flask_of_alchemical_chaos_crit
2:53.345Njudgment
[standard]
Fluffy_Pillow 4164571.4/7992700 52% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessing_of_the_forge, fake_solidarity(3), rising_wrath(6), heightened_wrath, flask_of_alchemical_chaos_crit
2:53.345Ishield_of_the_righteous
[standard]
Fluffy_Pillow 4164571.4/7992700 52% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessing_of_the_forge, fake_solidarity(3), rising_wrath(6), heightened_wrath, flask_of_alchemical_chaos_crit
2:54.372Ishield_of_the_righteous
[standard]
Fluffy_Pillow 4164571.4/7992700 52% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(7), heightened_wrath, flask_of_alchemical_chaos_crit
2:54.604Ravengers_shield
[standard]
Fluffy_Pillow 4164571.4/7992700 52% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(8), heightened_wrath, flask_of_alchemical_chaos_crit
2:55.863Lhammer_of_wrath
[standard]
Fluffy_Pillow 5295674.6/7992700 66% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(8), heightened_wrath, flask_of_alchemical_chaos_crit
2:57.120Njudgment
[standard]
Fluffy_Pillow 4597842.6/7992700 58% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(8), heightened_wrath, flask_of_alchemical_chaos_crit
2:57.120Ishield_of_the_righteous
[standard]
Fluffy_Pillow 4597842.6/7992700 58% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(8), heightened_wrath, flask_of_alchemical_chaos_crit
2:58.378Qblessed_hammer
[standard]
Fluffy_Pillow 4597842.6/7992700 58% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(9), heightened_wrath, flask_of_alchemical_chaos_crit
2:59.637Sconsecration
[standard]
Fluffy_Pillow 3924460.0/7992700 49% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(9), heightened_wrath, flask_of_alchemical_chaos_crit
3:00.893Yuse_items
[trinkets]
Fluffy_Pillow 5424460.0/7992700 68% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(9), heightened_wrath, flask_of_alchemical_chaos_crit
3:00.893Njudgment
[standard]
Fluffy_Pillow 5424460.0/7992700 68% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(9), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_crit
3:00.899Ishield_of_the_righteous
[standard]
Fluffy_Pillow 5424460.0/7992700 68% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(9), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_crit
3:01.921Ishield_of_the_righteous
[standard]
Fluffy_Pillow 4850409.6/7992700 61% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(10), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_crit
3:02.157Lhammer_of_wrath
[standard]
Fluffy_Pillow 1397162.0/7992700 17% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(11), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_crit
3:03.416Qblessed_hammer
[standard]
Fluffy_Pillow 798662.2/7992700 10% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(11), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_crit
3:04.676Mdivine_toll
[standard]
Fluffy_Pillow -595282.2/7992700 -7% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(11), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_crit
3:04.676Ishield_of_the_righteous
[standard]
Fluffy_Pillow -595282.2/7992700 -7% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, fake_solidarity, rising_wrath(11), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_crit
3:05.935Njudgment
[standard]
Fluffy_Pillow 460319.5/7992700 6% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(12), heightened_wrath, skarmorak_shard, flask_of_alchemical_chaos_crit
3:07.194Qblessed_hammer
[standard]
Fluffy_Pillow -1537896.2/7992700 -19% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(12), skarmorak_shard, flask_of_alchemical_chaos_crit
3:07.194Ishield_of_the_righteous
[standard]
Fluffy_Pillow -1537896.2/7992700 -19% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, fake_solidarity, rising_wrath(12), skarmorak_shard, flask_of_alchemical_chaos_crit
3:08.454Lhammer_of_wrath
[standard]
Fluffy_Pillow -3650110.4/7992700 -46% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(13), skarmorak_shard, flask_of_alchemical_chaos_crit
3:09.714Jblessed_hammer
[standard]
Fluffy_Pillow -3650110.4/7992700 -46% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(13), skarmorak_shard, flask_of_alchemical_chaos_crit
3:10.974Hjudgment
[standard]
Fluffy_Pillow -3985563.8/7992700 -50% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, rising_wrath(13), skarmorak_shard, flask_of_alchemical_chaos_crit
3:10.974Ishield_of_the_righteous
[standard]
Fluffy_Pillow -3985563.8/7992700 -50% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, rising_wrath(13), skarmorak_shard, flask_of_alchemical_chaos_crit
3:12.231Pjudgment
[standard]
Fluffy_Pillow -6743619.1/7992700 -84% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, rising_wrath(14), skarmorak_shard, flask_of_alchemical_chaos_crit
3:13.490Jblessed_hammer
[standard]
Fluffy_Pillow -6743619.1/7992700 -84% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, rising_wrath(14), skarmorak_shard, flask_of_alchemical_chaos_crit
3:14.749Ravengers_shield
[standard]
Fluffy_Pillow -9057106.2/7992700 -113% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, rising_wrath(14), skarmorak_shard, flask_of_alchemical_chaos_crit
3:16.008Gardent_defender
[defensives]
Fluffy_Pillow -10038997.6/7992700 -126% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, sacred_weapon, rising_wrath(14), flask_of_alchemical_chaos_crit
3:16.051Pjudgment
[standard]
Fluffy_Pillow -10736829.6/7992700 -134% HP
2.0/5 40% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, sacred_weapon, rising_wrath(14), flask_of_alchemical_chaos_crit
3:16.051Ishield_of_the_righteous
[standard]
Fluffy_Pillow -10736829.6/7992700 -134% HP
3.0/5 60% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, sacred_weapon, rising_wrath(14), flask_of_alchemical_chaos_crit
3:17.310Jblessed_hammer
[standard]
Fluffy_Pillow -10736829.6/7992700 -134% HP
0.0/5 0% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, rising_wrath(15), flask_of_alchemical_chaos_haste
3:18.514Kholy_armaments
[standard]
Fluffy_Pillow 894874.2/7992700 11% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, rising_wrath(15), flask_of_alchemical_chaos_haste
3:19.716Pjudgment
[standard]
Fluffy_Pillow 894874.2/7992700 11% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(15), flask_of_alchemical_chaos_haste
3:20.922Sconsecration
[standard]
Fluffy_Pillow 154113.4/7992700 2% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(15), flask_of_alchemical_chaos_haste
3:22.126Teye_of_tyr
[standard]
Fluffy_Pillow -459165.9/7992700 -6% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(15), flask_of_alchemical_chaos_haste
3:23.330Pjudgment
[standard]
Fluffy_Pillow -459165.9/7992700 -6% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(15), flask_of_alchemical_chaos_haste
3:23.330Ishield_of_the_righteous
[standard]
Fluffy_Pillow -459165.9/7992700 -6% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(15), flask_of_alchemical_chaos_haste
3:24.534Jblessed_hammer
[standard]
Fluffy_Pillow -2558080.3/7992700 -32% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(16), flask_of_alchemical_chaos_haste
3:25.737Vblessed_hammer
[standard]
Fluffy_Pillow -1058080.3/7992700 -13% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(16), flask_of_alchemical_chaos_haste
3:26.940Pjudgment
[standard]
Fluffy_Pillow -1493590.4/7992700 -19% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(16), flask_of_alchemical_chaos_haste
3:27.050Ishield_of_the_righteous
[standard]
Fluffy_Pillow -1493590.4/7992700 -19% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(16), flask_of_alchemical_chaos_haste
3:28.253Ravengers_shield
[standard]
Fluffy_Pillow -3026942.0/7992700 -38% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(17), flask_of_alchemical_chaos_haste
3:29.456Jblessed_hammer
[standard]
Fluffy_Pillow -3026942.0/7992700 -38% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(17), flask_of_alchemical_chaos_haste
3:30.660Wword_of_glory
[standard]
Dano -4257385.8/7992700 -53% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(17), flask_of_alchemical_chaos_haste
3:31.735Ishield_of_the_righteous
[standard]
Fluffy_Pillow -1735957.6/7992700 -22% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, faith_in_the_light, barricade_of_faith, divine_purpose, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(18), flask_of_alchemical_chaos_haste
3:31.863Pjudgment
[standard]
Fluffy_Pillow -1735957.6/7992700 -22% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(19), flask_of_alchemical_chaos_haste
3:33.067Jblessed_hammer
[standard]
Fluffy_Pillow -2324787.5/7992700 -29% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(19), flask_of_alchemical_chaos_haste
3:33.142Ishield_of_the_righteous
[standard]
Fluffy_Pillow -2324787.5/7992700 -29% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(19), flask_of_alchemical_chaos_haste
3:34.346Wword_of_glory
[standard]
Dano -2913617.4/7992700 -36% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(20), flask_of_alchemical_chaos_haste
3:35.549Pjudgment
[standard]
Fluffy_Pillow 1107810.8/7992700 14% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(21), flask_of_alchemical_chaos_haste
3:36.753Sconsecration
[standard]
Fluffy_Pillow 435776.2/7992700 5% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(21), flask_of_alchemical_chaos_haste
3:37.955Jblessed_hammer
[standard]
Fluffy_Pillow 435776.2/7992700 5% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(21), flask_of_alchemical_chaos_haste
3:39.160Pjudgment
[standard]
Fluffy_Pillow -153053.7/7992700 -2% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), faith_in_the_light, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(21), flask_of_alchemical_chaos_haste
3:39.160Ishield_of_the_righteous
[standard]
Fluffy_Pillow -153053.7/7992700 -2% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), faith_in_the_light, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(21), flask_of_alchemical_chaos_haste
3:40.363Ravengers_shield
[standard]
Fluffy_Pillow 727343.2/7992700 9% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(22), flask_of_alchemical_chaos_haste
3:41.566Jblessed_hammer
[standard]
Fluffy_Pillow 727343.2/7992700 9% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(22), flask_of_alchemical_chaos_haste
3:42.769Pjudgment
[standard]
Fluffy_Pillow 239233.5/7992700 3% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), rising_wrath(22), flask_of_alchemical_chaos_haste
3:44.083Wword_of_glory
[standard]
Dano -380369.6/7992700 -5% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(22), flask_of_alchemical_chaos_haste
3:45.286Jblessed_hammer
[standard]
Fluffy_Pillow 3641058.6/7992700 46% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), blessed_assurance, rising_wrath(23), flask_of_alchemical_chaos_haste
3:45.286Ishield_of_the_righteous
[standard]
Fluffy_Pillow 3641058.6/7992700 46% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(23), flask_of_alchemical_chaos_haste
3:46.488Wword_of_glory
[standard]
Dano 3045905.0/7992700 38% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(24), flask_of_alchemical_chaos_haste
3:47.689Pjudgment
[standard]
Fluffy_Pillow 4846672.7/7992700 61% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(25), flask_of_alchemical_chaos_vers
3:48.952Wword_of_glory
[standard]
Dano 4266851.3/7992700 53% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(25), flask_of_alchemical_chaos_vers
3:50.215Jblessed_hammer
[standard]
Fluffy_Pillow 6744914.3/7992700 84% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), blessed_assurance, rising_wrath(26), flask_of_alchemical_chaos_vers
3:51.479Pjudgment
[standard]
Fluffy_Pillow 6744914.3/7992700 84% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, faith_in_the_light, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(26), flask_of_alchemical_chaos_vers
3:51.479Ishield_of_the_righteous
[standard]
Fluffy_Pillow 6744914.3/7992700 84% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, faith_in_the_light, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(26), flask_of_alchemical_chaos_vers
3:52.743Ravengers_shield
[standard]
Fluffy_Pillow 6082178.1/7992700 76% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(27), flask_of_alchemical_chaos_vers
3:54.007Jblessed_hammer
[standard]
Fluffy_Pillow 6082178.1/7992700 76% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(27), flask_of_alchemical_chaos_vers
3:55.269Pjudgment
[standard]
Fluffy_Pillow 6975460.4/7992700 87% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), rising_wrath(27), flask_of_alchemical_chaos_vers
3:56.532Eavenging_wrath
[cooldowns]
Fluffy_Pillow 6288192.3/7992700 79% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(27), flask_of_alchemical_chaos_vers
3:56.532Lhammer_of_wrath
[standard]
Fluffy_Pillow 6288192.3/7992700 79% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, heightened_wrath, flask_of_alchemical_chaos_vers
3:56.532Ishield_of_the_righteous
[standard]
Fluffy_Pillow 6288192.3/7992700 79% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, heightened_wrath, flask_of_alchemical_chaos_vers
3:57.794Qblessed_hammer
[standard]
Fluffy_Pillow 6288192.3/7992700 79% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath, heightened_wrath, flask_of_alchemical_chaos_vers
3:59.058Sconsecration
[standard]
Fluffy_Pillow 5632470.5/7992700 70% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath, heightened_wrath, flask_of_alchemical_chaos_vers
4:00.323Njudgment
[standard]
Fluffy_Pillow 6534285.3/7992700 82% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath, heightened_wrath, flask_of_alchemical_chaos_vers
4:00.323Ishield_of_the_righteous
[standard]
Fluffy_Pillow 6534285.3/7992700 82% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, rising_wrath, heightened_wrath, flask_of_alchemical_chaos_vers
4:01.586Uholy_armaments
[standard]
Fluffy_Pillow 6534285.3/7992700 82% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_vers
4:02.848Lhammer_of_wrath
[standard]
Fluffy_Pillow 4052103.3/7992700 51% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_vers
4:04.113Njudgment
[standard]
Fluffy_Pillow 2231904.1/7992700 28% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_vers
4:04.113Ishield_of_the_righteous
[standard]
Fluffy_Pillow 2231904.1/7992700 28% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(2), heightened_wrath, flask_of_alchemical_chaos_vers
4:05.376Mdivine_toll
[standard]
Fluffy_Pillow 3731904.1/7992700 47% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(3), heightened_wrath, flask_of_alchemical_chaos_vers
4:06.640Qblessed_hammer
[standard]
Fluffy_Pillow 3369870.0/7992700 42% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(3), heightened_wrath, flask_of_alchemical_chaos_vers
4:07.904Gardent_defender
[defensives]
Fluffy_Pillow 3369870.0/7992700 42% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(3), heightened_wrath, flask_of_alchemical_chaos_vers
4:08.051Njudgment
[standard]
Fluffy_Pillow 797720.7/7992700 10% HP
2.0/5 40% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(3), heightened_wrath, flask_of_alchemical_chaos_vers
4:08.051Ishield_of_the_righteous
[standard]
Fluffy_Pillow 797720.7/7992700 10% HP
4.0/5 80% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(3), heightened_wrath, flask_of_alchemical_chaos_vers
4:09.314Lhammer_of_wrath
[standard]
Fluffy_Pillow 797720.7/7992700 10% HP
1.0/5 20% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(4), heightened_wrath, flask_of_alchemical_chaos_vers
4:10.577Qblessed_hammer
[standard]
Fluffy_Pillow 988317.5/7992700 12% HP
2.0/5 40% HoPo
ardent_defender, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(4), heightened_wrath, flask_of_alchemical_chaos_vers
4:10.577Ishield_of_the_righteous
[standard]
Fluffy_Pillow 988317.5/7992700 12% HP
3.0/5 60% HoPo
ardent_defender, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(4), heightened_wrath, flask_of_alchemical_chaos_vers
4:11.840Njudgment
[standard]
Fluffy_Pillow 746714.0/7992700 9% HP
0.0/5 0% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(5), heightened_wrath, flask_of_alchemical_chaos_vers
4:13.104Qblessed_hammer
[standard]
Fluffy_Pillow 1078140.3/7992700 13% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(5), heightened_wrath, flask_of_alchemical_chaos_vers
4:13.104Ishield_of_the_righteous
[standard]
Fluffy_Pillow 1078140.3/7992700 13% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(5), heightened_wrath, flask_of_alchemical_chaos_vers
4:14.367Qblessed_hammer
[standard]
Fluffy_Pillow -304086.6/7992700 -4% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), rising_wrath(6), heightened_wrath, flask_of_alchemical_chaos_vers
4:15.715Lhammer_of_wrath
[standard]
Fluffy_Pillow 540191.6/7992700 7% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), rising_wrath(6), heightened_wrath, flask_of_alchemical_chaos_vers
4:16.980Njudgment
[standard]
Fluffy_Pillow -691443.6/7992700 -9% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, rising_wrath(6), heightened_wrath, flask_of_alchemical_chaos_crit
4:16.980Ishield_of_the_righteous
[standard]
Fluffy_Pillow -691443.6/7992700 -9% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, rising_wrath(6), heightened_wrath, flask_of_alchemical_chaos_crit
4:18.238Ravengers_shield
[standard]
Fluffy_Pillow -3698057.3/7992700 -46% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, blessed_assurance, fake_solidarity, rising_wrath(7), heightened_wrath, flask_of_alchemical_chaos_crit
4:19.496Qblessed_hammer
[standard]
Fluffy_Pillow -4250617.6/7992700 -53% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, blessed_assurance, fake_solidarity, rising_wrath(7), heightened_wrath, flask_of_alchemical_chaos_crit
4:20.754Njudgment
[standard]
Fluffy_Pillow -4171948.3/7992700 -52% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, rising_wrath(7), heightened_wrath, flask_of_alchemical_chaos_crit
4:20.754Ishield_of_the_righteous
[standard]
Fluffy_Pillow -4171948.3/7992700 -52% HP
4.0/5 80% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, rising_wrath(7), heightened_wrath, flask_of_alchemical_chaos_crit
4:22.010Lhammer_of_wrath
[standard]
Fluffy_Pillow -7143690.5/7992700 -89% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(8), heightened_wrath, flask_of_alchemical_chaos_crit
4:23.269Qblessed_hammer
[standard]
Fluffy_Pillow -7848718.2/7992700 -98% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(8), heightened_wrath, flask_of_alchemical_chaos_crit
4:23.269Ishield_of_the_righteous
[standard]
Fluffy_Pillow -7848718.2/7992700 -98% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), rising_wrath(8), heightened_wrath, flask_of_alchemical_chaos_crit
4:24.527Njudgment
[standard]
Fluffy_Pillow -9443412.6/7992700 -118% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(9), heightened_wrath, flask_of_alchemical_chaos_crit
4:25.786Sconsecration
[standard]
Fluffy_Pillow -8648440.3/7992700 -108% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(9), heightened_wrath, flask_of_alchemical_chaos_crit
4:27.046Qblessed_hammer
[standard]
Fluffy_Pillow -10070159.0/7992700 -126% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(9), flask_of_alchemical_chaos_crit
4:27.046Ishield_of_the_righteous
[standard]
Fluffy_Pillow -10070159.0/7992700 -126% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), rising_wrath(9), flask_of_alchemical_chaos_crit
4:28.305Lhammer_of_wrath
[standard]
Fluffy_Pillow -10666511.9/7992700 -133% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(10), flask_of_alchemical_chaos_crit
4:29.564Pjudgment
[standard]
Fluffy_Pillow -11287314.1/7992700 -141% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(10), flask_of_alchemical_chaos_crit
4:30.821Ravengers_shield
[standard]
Fluffy_Pillow -9787314.1/7992700 -122% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(10), flask_of_alchemical_chaos_crit
4:32.078Yuse_items
[trinkets]
Fluffy_Pillow -10330336.6/7992700 -129% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), blessed_assurance, rising_wrath(10), flask_of_alchemical_chaos_crit
4:32.078Jblessed_hammer
[standard]
Fluffy_Pillow -10330336.6/7992700 -129% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), blessed_assurance, rising_wrath(10), skarmorak_shard, flask_of_alchemical_chaos_crit
4:32.078Ishield_of_the_righteous
[standard]
Fluffy_Pillow -10330336.6/7992700 -129% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(10), skarmorak_shard, flask_of_alchemical_chaos_crit
4:33.336Pjudgment
[standard]
Fluffy_Pillow -10908957.6/7992700 -136% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(11), skarmorak_shard, flask_of_alchemical_chaos_crit
4:34.595Lhammer_of_wrath
[standard]
Fluffy_Pillow -10908957.6/7992700 -136% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(11), skarmorak_shard, flask_of_alchemical_chaos_crit
4:35.852Jblessed_hammer
[standard]
Fluffy_Pillow -9987578.6/7992700 -125% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(11), skarmorak_shard, flask_of_alchemical_chaos_crit
4:35.852Ishield_of_the_righteous
[standard]
Fluffy_Pillow -9987578.6/7992700 -125% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), rising_wrath(11), skarmorak_shard, flask_of_alchemical_chaos_crit
4:37.112Pjudgment
[standard]
Fluffy_Pillow -10566199.6/7992700 -132% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(12), skarmorak_shard, flask_of_alchemical_chaos_crit
4:38.369Teye_of_tyr
[standard]
Fluffy_Pillow -10566199.6/7992700 -132% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(12), skarmorak_shard, flask_of_alchemical_chaos_crit
4:39.627Jblessed_hammer
[standard]
Fluffy_Pillow -10993652.8/7992700 -138% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(12), skarmorak_shard, flask_of_alchemical_chaos_crit
4:40.886Lhammer_of_wrath
[standard]
Fluffy_Pillow -9493652.8/7992700 -119% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(12), skarmorak_shard, flask_of_alchemical_chaos_crit
4:40.886Ishield_of_the_righteous
[standard]
Fluffy_Pillow -9493652.8/7992700 -119% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(12), skarmorak_shard, flask_of_alchemical_chaos_crit
4:42.146Pjudgment
[standard]
Fluffy_Pillow -9996373.4/7992700 -125% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(13), skarmorak_shard, flask_of_alchemical_chaos_crit
4:43.404Ravengers_shield
[standard]
Fluffy_Pillow -10499093.9/7992700 -131% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(13), skarmorak_shard, flask_of_alchemical_chaos_crit
4:44.665Jblessed_hammer
[standard]
Fluffy_Pillow -10499093.9/7992700 -131% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(13), skarmorak_shard, flask_of_alchemical_chaos_crit
4:45.923Pjudgment
[standard]
Fluffy_Pillow -9564427.2/7992700 -120% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(13), skarmorak_shard, flask_of_alchemical_chaos_crit
4:45.923Ishield_of_the_righteous
[standard]
Fluffy_Pillow -9564427.2/7992700 -120% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), rising_wrath(13), skarmorak_shard, flask_of_alchemical_chaos_crit
4:47.182Lhammer_of_wrath
[standard]
Fluffy_Pillow -10251695.3/7992700 -128% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(14), flask_of_alchemical_chaos_vers
4:48.445Jblessed_hammer
[standard]
Fluffy_Pillow -10251695.3/7992700 -128% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(14), flask_of_alchemical_chaos_vers
4:49.707Pjudgment
[standard]
Fluffy_Pillow -10914514.0/7992700 -137% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), rising_wrath(14), flask_of_alchemical_chaos_vers
4:49.707Ishield_of_the_righteous
[standard]
Fluffy_Pillow -10914514.0/7992700 -137% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), rising_wrath(14), flask_of_alchemical_chaos_vers
4:50.969Kholy_armaments
[standard]
Fluffy_Pillow -9414514.0/7992700 -118% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, rising_wrath(15), flask_of_alchemical_chaos_vers
4:52.233Jblessed_hammer
[standard]
Fluffy_Pillow -10070318.3/7992700 -126% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(15), flask_of_alchemical_chaos_vers
4:53.498Lhammer_of_wrath
[standard]
Fluffy_Pillow -10726122.7/7992700 -134% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(15), flask_of_alchemical_chaos_vers
4:54.760Pjudgment
[standard]
Fluffy_Pillow -10726122.7/7992700 -134% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(15), flask_of_alchemical_chaos_vers
4:54.760Ishield_of_the_righteous
[standard]
Fluffy_Pillow -10726122.7/7992700 -134% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(15), flask_of_alchemical_chaos_vers
4:56.024Ravengers_shield
[standard]
Fluffy_Pillow -9881927.0/7992700 -124% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(16), flask_of_alchemical_chaos_vers
4:57.289Jblessed_hammer
[standard]
Fluffy_Pillow -10506350.6/7992700 -131% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, rising_wrath(16), flask_of_alchemical_chaos_vers
4:58.554Pjudgment
[standard]
Fluffy_Pillow -10506350.6/7992700 -131% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, rising_wrath(16), flask_of_alchemical_chaos_vers
4:59.818Lhammer_of_wrath
[standard]
Fluffy_Pillow -10506350.6/7992700 -131% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, fake_solidarity(2), rising_wrath(16), flask_of_alchemical_chaos_vers
4:59.818Ishield_of_the_righteous
[standard]
Fluffy_Pillow -10506350.6/7992700 -131% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, sacred_weapon, fake_solidarity(2), rising_wrath(16), flask_of_alchemical_chaos_vers

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength176470499414773728254 (22670)
Agility61760617661760
Stamina864520377014359061152683
Intellect17647018176176470
Spirit00000
Health754028071812200
Holy Power550
Spell Power18176709300
Crit26.75%21.69%8886
Haste15.61%16.06%10597
Versatility5.24%2.24%1750
Mitigation Versatility2.62%1.12%1750
Attack Power65447588260
Mastery24.81%23.23%7861
Armor11345910805672153
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry23.70%20.28%8886
Tank-Block50.17%49.05%0
Tank-Crit-6.00%-6.00%0

Gear

Source Slot Average Item Level: 607.00
Local Head Entombed Seraph's Casque
ilevel: 610, stats: { 6,211 Armor, +16,198 Sta, +581 Crit, +1,177 Mastery, +2,896 StrInt }
Local Neck Locket of Broken Memories
ilevel: 606, stats: { +8,601 Sta, +3,784 Crit, +946 Haste }
Local Shoulders Entombed Seraph's Plumes
ilevel: 619, stats: { 5,991 Armor, +13,812 Sta, +943 Vers, +437 Mastery, +2,362 StrInt }
Local Chest Everforged Breastplate
ilevel: 606, stats: { 8,100 Armor, +15,291 Sta, +861 Mastery, +861 Haste, +2,790 StrInt }
Local Waist Belt of the Forgemaster
ilevel: 597, stats: { 4,340 Armor, +10,027 Sta, +616 Crit, +614 Haste, +1,924 StrInt }
Local Legs Entombed Seraph's Greaves
ilevel: 606, stats: { 7,087 Armor, +15,291 Sta, +1,205 Crit, +517 Haste, +2,790 StrInt }
Local Feet Ichor-Stained Sollerets
ilevel: 597, stats: { 4,822 Armor, +10,027 Sta, +457 Haste, +773 Vers, +1,924 StrInt }
Local Wrists Everforged Vambraces
ilevel: 606, stats: { 4,050 Armor, +8,601 Sta, +484 Mastery, +484 Haste, +1,569 StrInt }
item effects: { equip: Elemental Focusing Lens }
Local Hands Entombed Seraph's Castigation
ilevel: 606, stats: { 4,556 Armor, +11,469 Sta, +385 Crit, +906 Haste, +2,093 StrInt }
Local Finger1 Band of the Roving Scalawag
ilevel: 600, stats: { +7,875 Sta, +1,790 Crit, +2,685 Mastery }
Local Finger2 Key to the Unseeming
ilevel: 619, stats: { +10,359 Sta, +4,150 Haste, +1,132 Mastery }
Local Trinket1 Detachable Fang
ilevel: 610, stats: { +2,753 StrAgi }
item effects: { equip: Detachable Fang }
Local Trinket2 Skarmorak Shard
ilevel: 606, stats: { +2,652 Str }
item effects: { use: Skarmorak Shard, equip: Skarmorak Shard }
Local Back Anvilhide Cape
ilevel: 606, stats: { 1,462 Armor, +8,601 Sta, +360 Haste, +609 Mastery, +1,569 StrAgiInt }
Local Main Hand Shipwrecker's Bludgeon
ilevel: 603, weapon: { 3,508 - 4,511, 2.6 }, stats: { +1,357 Str, +7,323 Sta, +351 Crit, +496 Haste }
Local Off Hand Old-Blood Hielaman
ilevel: 619, stats: { 25,534 Armor, +1,575 Str, +4,830 Int, +9,208 Sta, +598 Haste, +322 Mastery }
Local Tabard Dream Wardens Tabard
ilevel: 1

Talents

Talent Tables

Paladin Talents [31]
1
2
3
4
5
6
7
8
9
10
Protection Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

paladin="Dano"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/dano"
spec=protection
level=80
race=human
role=tank
position=front
talents=CIEA5ba6OK14IUITjS1kSUVJctNjBzyYZegZMzMLbzMzYGjZMAAADAAAAAAAt1MzsYYmhxMs1CAMGYAMw2AAAgAMzsss02MjFzAAAzwYA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:algari_mana_oil_3,if=!(talent.rite_of_adjuration.enabled|talent.rite_of_sanctification.enabled)

head=entombed_seraphs_casque,id=211993,bonus_id=10371/10265/10390/6652/10876/1511/10255
neck=locket_of_broken_memories,id=212448,bonus_id=6652/10394/10392/10354/10270/1507/10255
shoulders=entombed_seraphs_plumes,id=211991,bonus_id=10369/10390/6652/10262/1520/10255
back=anvilhide_cape,id=221088,bonus_id=10390/6652/10377/10383/10270/1641/10255
chest=everforged_breastplate,id=222430,bonus_id=10421/9633/8902/9627/8793/10222,crafted_stats=crit/mastery
tabard=dream_wardens_tabard,id=210501
wrists=everforged_vambraces,id=222435,bonus_id=10421/9633/8902/9627/8793/10222/10520/8960/10876,crafted_stats=crit/vers
hands=entombed_seraphs_castigation,id=211994,bonus_id=10354/10372/6652/10270/1507/10255
waist=belt_of_the_forgemaster,id=133289,bonus_id=10273/10390/6652/10877/10377/10383/10027/10255
legs=entombed_seraphs_greaves,id=211992,bonus_id=10354/10370/6652/10270/1507/10255
feet=ichorstained_sollerets,id=221178,bonus_id=6652/10377/10383/11215/10277/1632/10255
finger1=band_of_the_roving_scalawag,id=162541,bonus_id=10272/10390/6652/10394/10392/10383/10008/10255
finger2=key_to_the_unseeming,id=212447,bonus_id=6652/10394/10393/10355/10262/1520/10255
trinket1=detachable_fang,id=225657,bonus_id=6652/10265/3139/10255
trinket2=skarmorak_shard,id=219300,bonus_id=10390/6652/10383/10270/1641/10255
main_hand=shipwreckers_bludgeon,id=221145,bonus_id=10271/10390/6652/10384/1638/10255
off_hand=oldblood_hielaman,id=221177,bonus_id=10390/6652/10383/10266/1654/10255

# Gear Summary
# gear_ilvl=607.25
# gear_strength=28254
# gear_stamina=152683
# gear_crit_rating=8712
# gear_haste_rating=10389
# gear_mastery_rating=7707
# gear_versatility_rating=1716
# gear_armor=72153
# set_bonus=thewarwithin_season_1_2pc=1
# set_bonus=thewarwithin_season_1_4pc=1

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 77697724
Max Event Queue: 128
Sim Seconds: 3006787
CPU Seconds: 63.5083
Physical Seconds: 21.1478
Speed Up: 47345

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Dano Dano ardent_defender 31850 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 51.58sec 0 299.99sec
Dano Dano augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Dano Dano avengers_shield 31935 2847152 9491 4.11 102440 220084 20.6 20.6 30.6% 0.0% 0.0% 0.0% 14.15sec 2847152 299.99sec
Dano Dano avenging_wrath 454351 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 81.73sec 0 299.99sec
Dano Dano blessed_hammer 204019 0 0 0.00 0 0 75.3 0.0 0.0% 0.0% 0.0% 0.0% 3.94sec 0 299.99sec
Dano Dano blessed_hammer_tick ticks -204301 13235073 44117 0.00 63722 139918 0.0 0.0 32.1% 0.0% 0.0% 0.0% 0.00sec 13235073 299.99sec
Dano Dano blessed_hammer_absorb 0 3120057 10401 24.86 25099 0 0.0 124.3 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Dano Dano bulwark_of_order_absorb 0 3539537 11799 7.89 89733 0 0.0 39.4 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Dano Dano consecration 26573 0 0 0.00 0 0 13.7 0.0 0.0% 0.0% 0.0% 0.0% 21.54sec 0 299.99sec
Dano Dano consecration_tick ticks -81297 2603735 8679 0.00 8158 17552 0.0 0.0 30.9% 0.0% 0.0% 0.0% 0.00sec 2603735 299.99sec
Dano Dano devotion_aura 465 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Dano Dano divine_toll 375576 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.97sec 0 299.99sec
Dano Dano avengers_shield_dt 31935 799255 2664 1.08 107055 229665 5.4 5.4 33.6% 0.0% 0.0% 0.0% 60.97sec 799255 299.99sec
Dano Dano avengers_shield_dr 31935 2268921 7563 3.13 105068 226596 15.7 15.7 32.7% 0.0% 0.0% 0.0% 18.53sec 2268921 299.99sec
Dano Dano eye_for_an_eye 469311 908657 3029 2.38 53393 113737 11.9 11.9 37.9% 0.0% 0.0% 0.0% 27.11sec 908657 299.99sec
Dano Dano eye_of_tyr 387174 1924567 6415 0.90 331887 697044 4.5 4.5 26.1% 0.0% 0.0% 0.0% 58.61sec 1924567 299.99sec
Dano Dano flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Dano Dano food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Dano Dano gnash 455487 3630411 12102 8.45 64767 129331 42.2 42.2 32.8% 0.0% 0.0% 0.0% 7.05sec 5186297 299.99sec
Dano Dano hammer_of_wrath 24275 13836310 46123 6.11 317308 657053 30.6 30.6 39.9% 0.0% 0.0% 0.0% 9.98sec 13836310 299.99sec
Dano Dano holy_armaments 432459 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 45.03sec 0 299.99sec
Dano Dano holy_bulwark 0 0 0 0.00 0 0 4.4 0.0 0.0% 0.0% 0.0% 0.0% 58.39sec 0 299.99sec
Dano Dano holy_bulwark_absorb 0 12070298 40236 8.87 272080 0 0.0 44.4 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Dano Dano holy_shield 157122 861567 2872 7.96 15660 33686 39.8 39.8 33.2% 0.0% 0.0% 0.0% 7.30sec 861567 299.99sec
Dano Dano judgment 275779 30108149 100364 17.56 248489 533963 87.8 87.8 33.1% 0.0% 0.0% 0.0% 3.44sec 30108149 299.99sec
Dano Dano hammer_and_anvil 433717 9063425 30213 5.81 220829 468870 29.1 29.1 36.7% 0.0% 0.0% 0.0% 10.15sec 9063425 299.99sec
Dano Dano melee 0 7563417 25212 35.78 31013 65503 178.9 178.9 32.7% 0.0% 0.0% 0.0% 2.01sec 10804870 299.99sec
Dano Dano potion 431932 0 0 0.00 0 0 1.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Dano Dano refining_fire ticks -469882 11249369 37498 46.16 35511 75839 41.6 230.8 32.8% 0.0% 0.0% 0.0% 7.18sec 11249369 299.99sec
Dano Dano rite_of_sanctification 433568 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
Dano Dano sacred_weapon 0 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 33.60sec 0 299.99sec
Dano Dano sacred_weapon_proc_damage 432616 25800719 86006 7.07 518227 1082974 35.4 35.4 37.4% 0.0% 0.0% 0.0% 8.15sec 25800719 299.99sec
Dano Dano sacred_weapon_proc_heal 441590 247460 825 0.07 577021 1152474 0.3 0.3 25.3% 0.0% 0.0% 0.0% 54.84sec 278341 299.99sec
Dano Dano shield_of_the_righteous 53600 18855160 62853 19.10 143255 297044 95.5 95.5 35.3% 0.0% 0.0% 0.0% 3.14sec 18855160 299.99sec
Dano Dano forges_reckoning 447258 11220573 37403 7.02 221914 443730 35.1 35.1 44.1% 0.0% 0.0% 0.0% 8.09sec 11220573 299.99sec
Dano Dano word_of_glory 85673 21433972 71449 1.41 2461500 4918906 7.1 7.1 23.5% 0.0% 0.0% 0.0% 24.62sec 21633263 299.99sec
Dano Dano sacred_word 447246 53688 179 0.05 152812 304690 0.2 0.2 42.6% 0.0% 0.0% 0.0% 97.66sec 63975 299.99sec

Fluffy_Pillow : 625,250 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
625,250.0625,250.00.0 / 0.000%0.0 / 0.0%1.2
Resource Out In Waiting APM Active
Health506,614.40.046.46%3.4100.0%

Scale Factors for other metrics

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Fluffy_Pillow625,250
melee_main_hand_Dano 328,90352.6%77.53.75s1,273,408636,707Direct77.51,641,45501,273,4370.0%22.4%47.0%

Stats Details: Melee Main Hand Dano

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage77.5077.500.000.000.002.00000.000098,685,200.90480,952,020.5079.48%636,707.47636,707.47
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit30.58%23.706442,096,895.6002,776,6362,096,245.101,621,8022,433,88549,693,128189,582,63473.80%
hit (blocked)47.00%36.4215601,345,139.3501,826,7811,344,944.381,113,2911,528,93148,992,072291,369,38783.19%
parry22.42%17.384340.00000.0000000.00%

Action Details: Melee Main Hand Dano

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Dano
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7840000.00
  • base_dd_max:8160000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
melee_nuke_Dano 43,9847.0%5.559.57s2,405,8521,200,235Direct5.52,405,75202,405,7520.0%0.0%62.1%

Stats Details: Melee Nuke Dano

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.475.470.000.000.002.00450.000013,149,778.3165,586,524.8679.95%1,200,235.331,200,235.33
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit37.94%2.07063,043,443.1404,114,9642,809,470.9104,095,1086,310,94324,881,56269.01%
hit (blocked)62.06%3.39062,016,129.4102,703,9582,006,309.8902,659,9156,838,83640,704,96382.75%

Action Details: Melee Nuke Dano

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Dano
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11760000.00
  • base_dd_max:12240000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Action Priority List

    default
    [2]:5.50
spell_dot_Dano 252,36340.4%5.361.01s14,175,73514,112,927Periodic144.8522,8070522,8070.0%0.0%0.0%96.5%

Stats Details: Spell Dot Dano

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.340.00144.80144.800.001.00452.000075,701,742.43115,838,223.8234.65%256,651.7514,112,927.37
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%144.80115174522,806.700734,404522,979.41456,023575,16475,701,742115,838,22434.63%

Action Details: Spell Dot Dano

  • id:0
  • school:physical
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_cast_speed
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Dano
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:800000.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:60.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Action Priority List

    default
    [3]:5.36
Simple Action Stats Execute Interval
Fluffy_Pillow
pause_action 4.560.01s

Stats Details: Pause Action

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.500.000.000.000.0030.00450.00000.000.000.00%0.000.00

Action Details: Pause Action

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:30.00
  • base_crit:0.00
  • target:Dano
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [4]:5.00
  • if_expr:time>=30
    default
    [4]:5.00
  • if_expr:time>=30
tank_heal 60.55.00s

Stats Details: Tank Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal60.500.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Tank Heal

  • id:0
  • school:holy
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1500000.00
  • base_dd_max:1500000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blessed Hammer124.725.32.4s2.0s1.0s39.64%59.33%25.3 (25.3)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_blessed_hammer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 11.8s
  • trigger_min/max:0.0s / 11.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s
  • uptime_min/max:32.73% / 50.34%

Stack Uptimes

  • blessed_hammer_1:39.64%

Spelldata

  • id:204301
  • name:Blessed Hammer
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Eye of Tyr4.50.059.2s59.2s6.0s8.95%8.32%0.0 (0.0)4.4

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_eye_of_tyr
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:39.0s / 147.5s
  • trigger_min/max:40.2s / 147.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:4.71% / 14.13%

Stack Uptimes

  • eye_of_tyr_1:8.95%

Spelldata

  • id:387174
  • name:Eye of Tyr
  • tooltip:Dealing {$s1=25}% less damage to the Paladin.
  • description:Releases a blinding flash from your shield, causing {$s2=0} Holy damage to all nearby enemies within {$=}A1 yds and reducing all damage they deal to you by {$s1=25}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment87.80.06.0s3.4s3.9s76.51%81.71%0.0 (0.0)0.0

Buff Details

  • buff initial source:Dano
  • cooldown name:buff_judgment
  • max_stacks:20
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 33.0s
  • trigger_min/max:0.9s / 8.1s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 31.4s
  • uptime_min/max:63.28% / 89.10%

Stack Uptimes

  • judgment_1:54.30%
  • judgment_2:19.35%
  • judgment_3:2.75%
  • judgment_4:0.11%
  • judgment_5:0.00%

Spelldata

  • id:197277
  • name:Judgment
  • tooltip:Taking {$=}w1% increased damage from {$@=}auracaster's next Holy Power ability.
  • description:{$@spelldesc20271=Judges the target, dealing {$s1=0} {$?s403664=false}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]}
  • max_stacks:20
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
delayed_aa_cast5.04.06.060.0s60.0s60.0s

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 299.99
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 625250.02
Minimum 503780.52
Maximum 729677.90
Spread ( max - min ) 225897.39
Range [ ( max - min ) / 2 * 100% ] 18.06%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 625250.02
Minimum 503780.52
Maximum 729677.90
Spread ( max - min ) 225897.39
Range [ ( max - min ) / 2 * 100% ] 18.06%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 187536721.65
Minimum 122760228.63
Maximum 243882510.08
Spread ( max - min ) 121122281.45
Range [ ( max - min ) / 2 * 100% ] 32.29%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 522995.91
Minimum 448677.84
Maximum 639414.22
Spread ( max - min ) 190736.38
Range [ ( max - min ) / 2 * 100% ] 18.23%
Standard Deviation 23052.5078
5th Percentile 486099.68
95th Percentile 562529.15
( 95th Percentile - 5th Percentile ) 76429.47
Mean Distribution
Standard Deviation 230.5366
95.00% Confidence Interval ( 522544.07 - 523447.76 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7464
0.1 Scale Factor Error with Delta=300 4536491
0.05 Scale Factor Error with Delta=300 18145963
0.01 Scale Factor Error with Delta=300 453649068
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=8000000,range=160000,attack_speed=2,aoe_tanks=1
2 5.50 melee_nuke,damage=12000000,range=240000,attack_speed=2,cooldown=30,aoe_tanks=1
3 5.36 spell_dot,damage=800000,range=16000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
4 5.00 pause_action,duration=30,cooldown=30,if=time>=30

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health01248893060
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=8000000,range=160000,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=12000000,range=240000,attack_speed=2,cooldown=30,aoe_tanks=1
actions+=/spell_dot,damage=800000,range=16000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
actions+=/pause_action,duration=30,cooldown=30,if=time>=30


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.