SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.7.58187 Live (hotfix 2024-12-19/58187, git build 10e9fb804b)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Raid Summary

Raid Event List
0 heal,name=tank_heal,amount=1500000,cooldown=5.0,duration=0,player_if=role.tank

DPS Scale Factors (dps increase per unit stat)

Profile Str Sta Crit Haste Mastery Vers Wdps wowhead
Bòfròst 7.45 -0.01 4.52 5.45 3.60 3.58 39.93 wowhead

Bòfròst : 305,817 dps, 828,084 dtps, 94,245 hps (38,706 aps)

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
305,816.8305,816.8244.2 / 0.080%48,389.2 / 15.8%-1.0
HPS HPS(e) HPS Error HPS Range HPR
55,539.055,539.0324.3 / 0.584%64,882.2 / 116.8%-1.0
APS APS Error APS Range APR
38,705.7241.9 / 0.625%9,111.7 / 23.5%-1.0
DTPS DTPS Error DTPS Range
828,084.4607.18 / 0.07%120,723 / 14.6%
Resource Out In Waiting APM Active
Mana0.00.00.00%70.6100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/b%C3%B2fr%C3%B2st
TalentCIEA5ba6OK14IUITjS1kSUVJctNjBzyYZegZMzMLbzMzYGjZMAAADAAAAAAAt1MzwgZYMjZrNAYMwAYgtBAAABYmZbbptZGLmBDAMMMG
Scale Factors for Bòfròst Damage Per Second
Wdps Str Haste Crit Mastery Vers Sta
Scale Factors 39.93 7.45 5.45 4.52 3.60 3.58 -0.01
Normalized 5.36 1.00 0.73 0.61 0.48 0.48 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.17 0.15 0.15 0.15 0.15 0.15 0.15
Ranking
  • Wdps > Str > Haste > Crit > Mastery ~= Vers > Sta
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=7.45, Stamina=-0.01, CritRating=4.52, HasteRating=5.45, MasteryRating=3.60, Versatility=3.58, Dps=39.93 )

Scale Factors for other metrics

Scale Factors for Bòfròst Priority Target Damage Per Second
Wdps Str Haste Crit Mastery Vers Sta
Scale Factors 39.93 7.45 5.45 4.52 3.60 3.58 -0.01
Normalized 5.36 1.00 0.73 0.61 0.48 0.48 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.17 0.15 0.15 0.15 0.15 0.15 0.15
Ranking
  • Wdps > Str > Haste > Crit > Mastery ~= Vers > Sta
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=7.45, Stamina=-0.01, CritRating=4.52, HasteRating=5.45, MasteryRating=3.60, Versatility=3.58, Dps=39.93 )
Scale Factors for Bòfròst Damage Per Second (Effective)
Wdps Str Haste Crit Mastery Vers Sta
Scale Factors 39.93 7.45 5.45 4.52 3.60 3.58 -0.01
Normalized 5.36 1.00 0.73 0.61 0.48 0.48 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Str > Haste > Crit > Mastery > Vers > Sta
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=7.45, Stamina=-0.01, CritRating=4.52, HasteRating=5.45, MasteryRating=3.60, Versatility=3.58, Dps=39.93 )
Scale Factors for Bòfròst Healing Per Second
Wdps Str Mastery Vers Crit Haste Sta
Scale Factors 7.03 1.24 0.66 0.65 0.13 -0.06 -0.08
Normalized 5.67 1.00 0.53 0.52 0.10 -0.05 -0.06
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.23 0.20 0.20 0.20 0.20 0.20 0.20
Ranking
  • Wdps > Str > Mastery ~= Vers > Crit ~= Haste ~= Sta
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=1.24, Stamina=-0.08, CritRating=0.13, HasteRating=-0.06, MasteryRating=0.66, Versatility=0.65, Dps=7.03 )
Scale Factors for Bòfròst Healing Per Second (Effective)
Wdps Str Mastery Vers Crit Haste Sta
Scale Factors 7.03 1.24 0.66 0.65 0.13 -0.06 -0.08
Normalized 5.67 1.00 0.53 0.52 0.10 -0.05 -0.06
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Str > Mastery > Vers > Crit > Haste > Sta
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=1.24, Stamina=-0.08, CritRating=0.13, HasteRating=-0.06, MasteryRating=0.66, Versatility=0.65, Dps=7.03 )
Scale Factors for Bòfròst Absorb Per Second
Wdps Str Vers Sta Mastery Haste Crit
Scale Factors 2.05 0.44 0.34 0.27 0.25 0.21 0.14
Normalized 4.63 1.00 0.77 0.61 0.57 0.48 0.33
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.14 0.14 0.14 0.15 0.15 0.15 0.14
Ranking
  • Wdps > Str ~= Vers ~= Sta ~= Mastery ~= Haste ~= Crit
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=0.44, Stamina=0.27, CritRating=0.14, HasteRating=0.21, MasteryRating=0.25, Versatility=0.34, Dps=2.05 )
Scale Factors for Healing + Absorb per second
Wdps Str Vers Mastery Crit Sta Haste
Scale Factors 9.07 1.68 0.99 0.91 0.27 0.19 0.15
Normalized 5.39 1.00 0.59 0.54 0.16 0.11 0.09
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.27 0.25 0.25 0.25 0.25 0.25 0.25
Ranking
  • Wdps > Str > Vers ~= Mastery > Crit ~= Sta ~= Haste
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=1.68, Stamina=0.19, CritRating=0.27, HasteRating=0.15, MasteryRating=0.91, Versatility=0.99, Dps=9.07 )
Scale Factors for Bòfròst Damage Taken Per Second
Crit Vers Str Mastery Wdps Sta Haste
Scale Factors -6.15 -6.06 -4.81 -3.95 -1.62 -0.08 0.22
Normalized 1.28 1.26 1.00 0.82 0.34 0.02 -0.05
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.38 0.37 0.37 0.37 0.37 0.37 0.37
Ranking
  • Crit ~= Vers > Str > Mastery > Wdps > Sta ~= Haste
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=4.81, Stamina=0.08, CritRating=6.15, HasteRating=-0.22, MasteryRating=3.95, Versatility=6.06, Dps=1.62 )
Scale Factors for Bòfròst Damage Taken
Crit Vers Str Mastery Wdps Sta Haste
Scale Factors -1829.07 -1807.37 -1435.63 -1189.34 -476.15 -9.20 77.37
Normalized 1.27 1.26 1.00 0.83 0.33 0.01 -0.05
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Crit > Vers > Str > Mastery > Wdps > Sta > Haste
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=1435.63, Stamina=9.20, CritRating=1829.07, HasteRating=-77.37, MasteryRating=1189.34, Versatility=1807.37, Dps=476.15 )
Scale Factors for Bòfròst Healing Taken Per Second
Wdps Str Mastery Vers Crit Haste Sta
Scale Factors 7.01 1.23 0.66 0.64 0.12 -0.07 -0.08
Normalized 5.69 1.00 0.53 0.52 0.10 -0.06 -0.07
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Str > Mastery > Vers > Crit > Haste > Sta
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=1.23, Stamina=-0.08, CritRating=0.12, HasteRating=-0.07, MasteryRating=0.66, Versatility=0.64, Dps=7.01 )
Scale Factors for Bòfròst Fight Length
Crit Vers Str Wdps Sta Haste Mastery
Scale Factors 0.00 0.00 0.00 0.00 0.00 0.00 -0.00
Normalized 1.32 1.31 1.00 1.00 0.99 0.64 -0.32
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Crit > Vers > Str > Wdps > Sta > Haste > Mastery
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=0.00, Stamina=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=-0.00, Versatility=0.00, Dps=0.00 )
Scale Factors for Raid Damage Per Second
Wdps Str Haste Crit Mastery Vers Sta
Scale Factors 39.93 7.45 5.45 4.52 3.60 3.58 -0.01
Normalized 5.36 1.00 0.73 0.61 0.48 0.48 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.17 0.15 0.15 0.15 0.15 0.15 0.15
Ranking
  • Wdps > Str > Haste > Crit > Mastery ~= Vers > Sta
Pawn string ( Pawn: v1: "Bòfròst-Protection": Class=Paladin, Spec=Protection, Strength=7.45, Stamina=-0.01, CritRating=4.52, HasteRating=5.45, MasteryRating=3.60, Versatility=3.58, Dps=39.93 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Bòfròst305,817
Avenger's Shield 6,1992.0%20.414.18s90,94874,213Direct20.474,704159,23190,98419.3%

Stats Details: Avengers Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage20.4420.440.000.000.001.22550.00001,859,400.431,859,400.430.00%74,212.7574,212.75
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.75%16.5072674,704.1865,18598,79874,652.9567,89880,3211,232,8081,232,8080.00%
crit19.25%3.93013159,230.88130,760195,788157,416.940190,865626,592626,5920.00%

Action Details: Avengers Shield

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=false}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Action Priority List

    standard
    [R]:20.44
  • if_expr:!talent.lights_guidance.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Blessed Hammer 0 (28,416)0.0% (9.3%)74.24.00s114,88594,963

Stats Details: Blessed Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage74.170.000.000.000.001.20980.00000.000.000.00%94,962.8394,962.83

Action Details: Blessed Hammer

  • id:204019
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:5.000
  • cooldown hasted:true
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Spelldata

  • id:204019
  • name:Blessed Hammer
  • school:holy
  • tooltip:
  • description:Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    standard
    [J]:34.68
  • if_expr:buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3&!buff.avenging_wrath.up
    standard
    [Q]:33.41
  • if_expr:(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
    standard
    [V]:6.08

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown Duration (Category)Paladin1370265SET1.000
    Blessed Hammer (_tick) 28,4169.3%0.00.00s00Periodic147.846,267101,44657,66820.7%0.0%

Stats Details: Blessed Hammer Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00147.770.000.00000.00008,521,489.378,521,489.370.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit79.34%117.238115446,267.0513,82664,13046,260.8542,69650,0605,424,0985,424,0980.00%
crit20.66%30.531056101,445.6428,199128,260101,489.0983,115112,3973,097,3923,097,3920.00%

Action Details: Blessed Hammer Tick

  • id:204301
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:9.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:204301
  • name:Blessed Hammer
  • school:holy
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Consecration 0 (5,767)0.0% (1.9%)13.821.51s124,811109,060

Stats Details: Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage13.830.000.000.000.001.14440.00000.000.000.00%109,060.27109,060.27

Action Details: Consecration

  • id:26573
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:4.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=false}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=true}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Action Priority List

    standard
    [S]:12.72
  • if_expr:!consecration.up
    standard
    [X]:0.11

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    Consecration (_tick) 5,7671.9%0.00.00s00Periodic237.85,95612,7167,25919.3%0.0%

Stats Details: Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00237.830.000.00000.00001,726,533.161,726,533.160.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit80.72%191.971032775,955.785,0867,8675,954.155,6356,3291,143,3511,143,3510.00%
crit19.28%45.86128112,715.8410,41215,73412,707.6411,50414,018583,183583,1830.00%

Action Details: Consecration Tick

  • id:81297
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Divine Toll 0 (6,680)0.0% (2.2%)5.461.09s371,667307,920

Stats Details: Divine Toll

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.390.000.000.000.001.20700.00000.000.000.00%307,920.07307,920.07

Action Details: Divine Toll

  • id:375576
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:375576
  • name:Divine Toll
  • school:holy
  • tooltip:
  • description:Instantly cast {$?a137029=false}[Holy Shock]?a137028[Avenger's Shield]?a137027[Judgment][Holy Shock, Avenger's Shield, or Judgment] on up to {$s1=5} targets within {$=}A2 yds.{$?=}c3[ Divine Toll's Judgment deals {$326011s1=100}% increased damage.][]{$?=}c2[ Generates {$s5=1} Holy Power per target hit.][]

Action Priority List

    standard
    [M]:5.38
  • if_expr:(!raid_event.adds.exists|raid_event.adds.in>10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Global CooldownPaladin1370268SET1.000
    Avenger's Shield (_dt) 1,7190.6%5.461.09s95,3990Direct5.476,342161,87495,44622.3%

Stats Details: Avengers Shield Dt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.395.380.000.000.000.00000.0000513,736.25513,736.250.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.67%4.180676,342.0165,38094,40476,104.47091,117319,145319,1450.00%
crit22.33%1.2005161,873.57130,760186,497121,987.030186,497194,591194,5910.00%

Action Details: Avengers Shield Dt

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=false}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    Avenger's Shield (_dr) 4,9611.6%15.718.47s94,9770Direct15.776,208163,17495,01821.6%

Stats Details: Avengers Shield Dr

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.6615.660.000.000.000.00000.00001,487,744.181,487,744.180.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit78.37%12.2751876,207.8965,38097,81476,140.7967,60182,461935,171935,1710.00%
crit21.63%3.39011163,173.75130,760195,031160,297.590190,865552,574552,5740.00%

Action Details: Avengers Shield Dr

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=false}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Eye for an Eye 1,7520.6%10.730.86s48,8210Direct10.737,78379,90348,82226.2%

Stats Details: Eye For An Eye

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.6910.690.000.000.000.00000.0000522,136.08522,136.080.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.79%7.8911437,782.8930,47445,19837,748.0532,09442,549298,181298,1810.00%
crit26.21%2.800979,902.9061,34389,54077,414.18089,055223,955223,9550.00%

Action Details: Eye For An Eye

  • id:469311
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.350000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.34
  • base_multiplier:1.00

Spelldata

  • id:469311
  • name:Eye for an Eye
  • school:holy
  • tooltip:
  • description:{$@spelldesc469309=Melee and ranged attackers receive {$469311s1=0} Holy damage each time they strike you during {$?=}c2[Ardent Defender][Divine Protection] and Divine Shield.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Eye of Tyr 4,5161.5%4.657.83s291,071235,972Direct4.6248,179522,137291,07615.7%

Stats Details: Eye Of Tyr

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.654.650.000.000.001.23370.00001,353,060.751,353,060.750.00%235,971.53235,971.53
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit84.34%3.9207248,178.98223,618337,919247,723.660304,634973,068973,0680.00%
crit15.66%0.7304522,136.71447,236675,246283,597.030675,246379,993379,9930.00%

Action Details: Eye Of Tyr

  • id:387174
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:40.199
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:387174
  • name:Eye of Tyr
  • school:holy
  • tooltip:Dealing {$s1=25}% less damage to the Paladin.
  • description:Releases a blinding flash from your shield, causing {$s2=0} Holy damage to all nearby enemies within {$=}A1 yds and reducing all damage they deal to you by {$s1=25}% for {$d=6 seconds}.

Action Priority List

    standard
    [T]:4.65
  • if_expr:(talent.inmost_light.enabled&raid_event.adds.in>=45|spell_targets.shield_of_the_righteous>=3)&!talent.lights_deliverance.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hammer of Wrath 28,3039.2%29.510.39s287,259243,236Direct29.5221,012456,660287,45728.2%

Stats Details: Hammer Of Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage29.5129.490.000.000.001.18100.00008,476,044.628,476,044.620.00%243,235.99243,235.99
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.80%21.171034221,011.64177,451269,040220,959.22205,002234,7414,679,3464,679,3460.00%
crit28.20%8.31019456,659.87354,902536,307456,843.180504,2493,796,6993,796,6990.00%

Action Details: Hammer Of Wrath

  • id:24275
  • school:holy
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$=}<damage> {$?s403664=false}[Holystrike][Holy] damage. Only usable on enemies that have less than 20% health{$?s326730=true}[, or during Avenging Wrath][]. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    standard
    [L]:29.50

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Global CooldownProtection Paladin1370285SET1.000
Spell Direct AmountProtection Paladin13702818PCT68.0%
Hasted Cooldown Duration (Category)Paladin1370266SET1.000
Holy Shield 1,9530.6%41.67.00s14,0720Direct41.611,30924,16414,07921.5%

Stats Details: Holy Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage41.6041.580.000.000.000.00000.0000585,362.35585,362.350.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit78.46%32.62145611,308.949,69014,69211,304.9910,45812,164368,896368,8960.00%
crit21.54%8.9612224,164.4419,38029,38324,179.2219,90027,468216,467216,4670.00%

Action Details: Holy Shield

  • id:157122
  • school:holy
  • range:100.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:157122
  • name:Holy Shield
  • school:holy
  • tooltip:
  • description:{$@spelldesc152261=Your block chance is increased by {$s1=20}%, you are able to block spells, and your successful blocks deal {$157122s1=0} Holy damage to your attacker.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Judgment 63,836 (76,546)20.9% (25.0%)85.83.53s267,385222,143Direct85.8 (104.1)179,581382,600223,10521.4% (22.4%)

Stats Details: Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage85.7985.750.000.000.001.20370.000019,132,040.4419,132,040.440.00%222,142.57222,142.57
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit78.56%67.364294179,580.67150,327233,311179,560.16170,076188,70212,097,46912,097,4690.00%
crit21.44%18.39435382,599.62307,768464,675382,832.91339,000422,4557,034,5727,034,5720.00%

Action Details: Judgment

  • id:275779
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:11.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:0.450
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.237500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15
  • base_multiplier:1.65

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275779
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target, dealing {$s1=0} Holy damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability][].{$?a315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Action Priority List

    standard
    [H]:11.52
  • target_if_expr:charges>=2|full_recharge_time<=gcd.max
    standard
    [N]:35.14
  • if_expr:(buff.avenging_wrath.up&talent.hammer_and_anvil.enabled)
  • target_if_expr:debuff.judgment.remains
    standard
    [P]:39.14
  • target_if_expr:debuff.judgment.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Modify Recharge Time% (Category)Protection Paladin1370283SET-0.550
Hasted Global CooldownProtection Paladin1370285SET1.000
Hasted Cooldown Duration (Category)Protection Paladin1370286SET1.000
Spell Direct AmountProtection Paladin13702811PCT-14.0%
    Hammer and Anvil 12,7104.2%18.416.09s207,0610Direct18.4160,008334,038207,07027.0%

Stats Details: Hammer And Anvil

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage18.3918.390.000.000.000.00000.00003,807,067.453,807,067.450.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.96%13.42229160,008.04130,148197,163160,097.16140,863179,5612,146,5412,146,5410.00%
crit27.04%4.97015334,037.73260,296393,000331,590.770384,8401,660,5271,660,5270.00%

Action Details: Hammer And Anvil

  • id:433717
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:433717
  • name:Hammer and Anvil
  • school:holy
  • tooltip:
  • description:{$@spelldesc433718=Judgment critical strikes cause a shockwave around the target, dealing {$?=}c1[{$433722s1=0}][{$433717s1=0}] {$?=}c1[healing][damage] at the target's location.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
melee 16,7985.5%174.62.06s28,83614,005Direct174.623,28749,63128,83621.1%

Stats Details: Melee

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage174.64174.640.000.000.002.05910.00005,035,960.217,194,221.6730.00%14,004.5314,004.53
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit78.93%137.859718323,286.8219,63430,35723,286.2122,26124,3793,210,1414,585,91130.00%
crit21.07%36.79127049,630.7840,01260,71449,648.3245,82853,3371,825,8192,608,31130.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Refining Fire 24,1687.9%41.57.21s174,6530Periodic227.725,67554,77231,81121.1%58.6%

Stats Details: Refining Fire

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage41.480.00227.73227.7317.500.00000.77137,244,228.587,244,228.580.00%41,242.880.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit78.91%179.7011924525,674.612560,47725,695.2222,07329,0724,613,7244,613,7240.00%
crit21.09%48.03218254,771.5964120,95454,823.7545,39067,8852,630,5042,630,5040.00%

Action Details: Refining Fire

  • id:469882
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.225000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.34
  • base_multiplier:1.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:469882
  • name:Refining Fire
  • school:holyfire
  • tooltip:Suffering {$=}w1 Radiant damage every $t sec.
  • description:Enemies struck by Avenger's Shield burn with holy fire, suffering {$=}o1 Radiant damage over {$d=5 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Sacred Weapon (_proc_damage) 44,45214.5%29.09.75s458,7360Direct29.0351,651726,070458,72228.6%

Stats Details: Sacred Weapon Proc Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage29.0329.030.000.000.000.00000.000013,317,750.3513,317,750.350.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.40%20.73742351,651.27137,636769,523351,788.44279,496447,0957,289,3217,289,3210.00%
crit28.60%8.30021726,069.73278,9161,562,285726,323.7701,062,3906,028,4306,028,4300.00%

Action Details: Sacred Weapon Proc Damage

  • id:432616
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:432616
  • name:Sacred Weapon
  • school:holy
  • tooltip:
  • description:{$@spelldesc432502=While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Shield of the Righteous 36,212 (59,095)11.8% (19.3%)93.23.23s190,0840Direct93.2 (127.4)93,471190,436116,51823.8% (26.2%)

Stats Details: Shield Of The Righteous

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage93.1593.150.000.000.000.00000.000010,853,660.9110,853,660.910.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit76.23%71.014210393,470.8344,250187,34193,527.2283,538101,8196,637,5256,637,5250.00%
crit23.77%22.14742190,436.3989,687378,300190,630.57151,922227,4014,216,1354,216,1350.00%

Action Details: Shield Of The Righteous

  • id:53600
  • school:holy
  • range:5.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53600
  • name:Shield of the Righteous
  • school:holy
  • tooltip:
  • description:Slams enemies in front of you with your shield, causing {$s1=0} Holy damage, and increasing your Armor by {$?=}c1[{$=}{{$132403s1=160}*{$=}INT/100}][{$=}{{$132403s1=160}*{$=}STR/100}] for {$132403d=4.500 seconds}.{$?a386568=false}[ {$@spelldesc386568=When Shield of the Righteous expires, gain {$386556s1=10}% block chance and deal {$386553s1=0} Holy damage to all attackers for {$386556d=4 seconds}.}][]{$?a280373=true}[ {$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}][]

Action Priority List

    standard
    [I]:93.15
  • if_expr:(!talent.righteous_protector.enabled|cooldown.righteous_protector_icd.remains=0)&!buff.hammer_of_light_ready.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Hasted Global CooldownProtection Paladin1370285SET1.000
    Forge's Reckoning 22,8837.5%34.38.28s199,7040Direct34.3150,527301,567199,83132.6%

Stats Details: Forges Reckoning

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage34.3134.290.000.000.000.00000.00006,852,766.766,852,766.760.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.35%23.09841150,527.02138,061172,127150,509.81143,787157,6873,476,4483,476,4480.00%
crit32.65%11.20125301,566.98276,122347,717301,612.33284,387327,1993,376,3193,376,3190.00%

Action Details: Forges Reckoning

  • id:447258
  • school:holy
  • range:100.0
  • travel_speed:30.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:447258
  • name:Forge's Reckoning
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} damage to enemy targets. Reduced above {$s2=5} targets.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT34.0%
Spell Periodic AmountProtection Paladin1370282PCT34.0%
Spell Direct AmountProtection Paladin13702826PCT-15.0%
Spidersting 1,1730.4%11.019.85s32,2310Periodic94.43,1356,2753,74719.5%25.4%

Stats Details: Spidersting

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.970.0094.3694.362.970.00000.8069353,606.66353,606.660.00%4,644.100.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit80.50%75.96201983,134.961221,6013,083.812,1188,576238,152238,1520.00%
crit19.50%18.402516,274.562343,2036,160.782,90625,816115,454115,4540.00%

Action Details: Spidersting

  • id:452229
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:3045.72
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:452229
  • name:Spidersting
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every second.
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Bòfròst 94245
blessed_hammer_absorb 7,3877.8%0.00.00s00Direct124.317,831017,8310.0%

Stats Details: Blessed Hammer Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.00124.270.000.000.000.00000.00002,215,967.520.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%124.279215817,831.0716,88020,61817,829.7217,28418,5312,215,96800.00%
bulwark_of_order_absorb 7,7078.1%0.00.00s00Direct39.558,544058,5440.0%

Stats Details: Bulwark Of Order Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0039.470.000.000.000.00000.00002,310,485.230.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%39.47265158,544.4939,111226,80958,602.9146,73476,4212,310,48500.00%
holy_bulwark_absorb 23,77325.1%0.00.00s00Direct34.5206,6680206,6680.0%

Stats Details: Holy Bulwark Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0034.480.000.000.000.00000.00007,125,286.560.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%34.482046206,667.552,9811,163,253206,866.32188,580259,1047,125,28700.00%
Leech 1,4411.5%248.01.21s1,7420Direct248.01,74201,7420.0%

Stats Details: Leech

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal247.98247.980.000.000.000.00000.0000432,070.64443,247.642.52%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%247.981983011,742.29015,8521,742.721,5142,014432,071443,2482.55%

Action Details: Leech

  • id:143924
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:143924
  • name:Leech
  • school:physical
  • tooltip:
  • description:Health leeched.
Sacred Weapon (_proc_heal) 2430.3%0.165.46s578,2980Direct0.1473,8821,057,907578,70717.9%

Stats Details: Sacred Weapon Proc Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal0.120.120.000.000.000.00000.000072,063.1872,063.180.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.10%0.1003473,882.06227,083785,11446,083.780785,11448,45948,4590.00%
crit17.90%0.02021,057,907.39452,6241,532,19323,474.8101,532,19323,60423,6040.00%

Action Details: Sacred Weapon Proc Heal

  • id:441590
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:5
  • split_aoe_damage:false
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441590
  • name:Sacred Weapon
  • school:holy
  • tooltip:
  • description:{$@spelldesc432502=While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.}
Word of Glory 53,739 (53,855)57.2% (57.3%)6.725.42s2,428,4041,923,202Direct6.7 (6.9)2,153,5944,349,8402,423,50812.3% (12.9%)

Stats Details: Word Of Glory

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal6.706.700.000.000.001.26280.000016,241,447.4016,242,057.050.00%1,923,202.331,923,202.33
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit87.72%5.880142,153,594.2503,336,7822,151,380.2302,756,90612,661,31012,661,5910.00%
crit12.28%0.82054,349,840.3185,8876,528,7042,478,996.0506,511,9743,580,1383,580,4660.00%

Action Details: Word Of Glory

  • id:85673
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:0
  • harmful:false

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.465000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10
  • base_multiplier:1.00

Spelldata

  • id:85673
  • name:Word of Glory
  • school:holy
  • tooltip:
  • description:Calls down the Light to heal a friendly target for $130551s1{$?a378405=false}[ and an additional {$378405s1=20}% over {$378412d=10 seconds}][].{$?a379043=true}[ Your block chance is increased by {$379043s1=5}% for {$379041d=6 seconds}.][]{$?a315921=true}&!a315924[ |cFFFFFFFFProtection:|r If cast on yourself, healing increased by up to {$315921s1=300}% based on your missing health.][]{$?a315924=false}[ |cFFFFFFFFProtection:|r Healing increased by up to {$315921s1=300}% based on your missing health, or up to {$315924s1=100}% if cast on another target.][]

Action Priority List

    standard
    [W]:6.70
  • if_expr:buff.shining_light_free.up&(talent.blessed_assurance.enabled|(talent.lights_guidance.enabled&cooldown.hammerfall_icd.remains=0))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin13702817PCT110.0%
    Sacred Word 1160.1%0.2106.70s159,6420Direct0.2121,401242,257159,62831.6%

Stats Details: Sacred Word

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal0.220.220.000.000.000.00000.000034,613.9234,613.920.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit68.36%0.1502121,400.95114,287132,16117,399.000132,16117,99317,9930.00%
crit31.64%0.0702242,257.00229,353264,55916,256.600264,55916,62116,6210.00%

Action Details: Sacred Word

  • id:447246
  • school:holy
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:447246
  • name:Sacred Word
  • school:holy
  • tooltip:
  • description:Heals the target for {$s1=0}.
Simple Action Stats Execute Interval
Bòfròst
Ardent Defender 6.451.99s

Stats Details: Ardent Defender

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.420.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Ardent Defender

  • id:31850
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:84.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:31850
  • name:Ardent Defender
  • school:physical
  • tooltip:Damage taken reduced by {$=}w1%. The next attack that would otherwise kill you will instead bring you to {$=}w2% of your maximum health.{$?a469439=true}[ Healing taken increased by {$=}w4%.][]
  • description:Reduces all damage you take by {$s1=20}% for {$d=8 seconds}. While Ardent Defender is active, the next attack that would otherwise kill you will instead bring you to {$s2=20}% of your maximum health.

Action Priority List

    defensives
    [G]:6.42
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Avenging Wrath 4.382.35s

Stats Details: Avenging Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.270.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Avenging Wrath

  • id:454351
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:454351
  • name:Avenging Wrath
  • school:holy
  • tooltip:{$?=}{$=}w2>0&{$=}w3>0[Damage, healing and critical strike chance increased by {$=}w2%.]?{$=}w3==0&{$=}w2>0[Damage and healing increased by {$=}w2%.]?{$=}w2==0&{$=}w3>0[Critical strike chance increased by {$=}w3%.][]{$?a53376=true}[ ][]{$?a53376=true}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=true}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]{$?s384442=false}&s384376[increasing your damage, healing and critical strike chance by {$s2=20}% for {$d=8 seconds}.]?!s384442&s384376[increasing your damage and healing by {$s1=20}% for {$d=8 seconds}.]?!s384376&s384442[increasing your critical strike chance by {$s3=20}% for {$d=8 seconds}.][and activating all the effects learned for Avenging Wrath for {$d=8 seconds}.]

Action Priority List

    cooldowns
    [E]:4.27
Devotion Aura 1.00.00s

Stats Details: Devotion Aura

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Devotion Aura

  • id:465
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:465
  • name:Devotion Aura
  • school:holy
  • tooltip:Damage taken reduced by {$=}w1%.
  • description:Party and raid members within {$=}a1 yds are bolstered by their devotion, reducing damage taken by {$s1=3}%.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Holy Bulwark (Holy Armaments) 7.339.01s

Stats Details: Holy Armaments

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage7.270.000.000.000.001.21320.00000.000.000.00%0.000.00

Action Details: Holy Armaments

  • id:432459
  • school:holy
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:0.800
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:432459
  • name:Holy Bulwark
  • school:holy
  • tooltip:
  • description:Will the Light to coalesce and become manifest as a Holy Armament, wielded by your friendly target. {$@=}spellicon432496 {$@=}spellname432496: {$@spelldesc432496=While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.} Becomes Sacred Weapon after use.

Action Priority List

    standard
    [K]:3.97
  • if_expr:next_armament=sacred_weapon&(!buff.sacred_weapon.up|(buff.sacred_weapon.remains<6&!buff.avenging_wrath.up&cooldown.avenging_wrath.remains<=30))
    standard
    [O]:0.13
  • if_expr:next_armament=holy_bulwark&charges=2
    standard
    [U]:3.17
  • if_expr:next_armament=holy_bulwark

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time% (Category)Forewarning4328041SET-0.200
holy_bulwark 3.384.36s

Stats Details: Holy Bulwark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.290.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Holy Bulwark

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.30.00s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.300.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [F]:1.30
  • if_expr:buff.avenging_wrath.up
Rite of Sanctification 1.00.00s

Stats Details: Rite Of Sanctification

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Rite Of Sanctification

  • id:433568
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:433568
  • name:Rite of Sanctification
  • school:holy
  • tooltip:
  • description:Imbue your weapon with the power of the Light, increasing your armor by {$433550s2=5}% and your primary stat by {$433550s1=2}%. Lasts {$433550d=3600 seconds}.
sacred_weapon 8.240.19s

Stats Details: Sacred Weapon

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage8.250.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sacred Weapon

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
arakara_sacbrood 11.019.84s

Stats Details: Spiderfling

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.980.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Spiderfling

  • id:452227
  • school:physical
  • range:100.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:452227
  • name:Spiderfling
  • school:physical
  • tooltip:
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ardent Defender6.40.050.4s52.0s1.9s4.11%4.12%0.0 (0.0)0.9

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_ardent_defender
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:32.0s / 60.0s
  • trigger_min/max:38.0s / 60.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:2.44% / 6.44%

Stack Uptimes

  • ardent_defender_1:4.11%

Spelldata

  • id:31850
  • name:Ardent Defender
  • tooltip:Damage taken reduced by {$=}w1%. The next attack that would otherwise kill you will instead bring you to {$=}w2% of your maximum health.{$?a469439=true}[ Healing taken increased by {$=}w4%.][]
  • description:Reduces all damage you take by {$s1=20}% for {$d=8 seconds}. While Ardent Defender is active, the next attack that would otherwise kill you will instead bring you to {$s2=20}% of your maximum health.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Avenging Wrath4.30.080.6s82.3s31.0s44.21%45.78%0.0 (0.0)3.8

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:63.0s / 90.1s
  • trigger_min/max:66.9s / 90.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.0s
  • uptime_min/max:38.61% / 51.85%

Stack Uptimes

  • avenging_wrath_1:44.21%

Spelldata

  • id:31884
  • name:Avenging Wrath
  • tooltip:Damage, healing, and critical strike chance increased by {$=}w2%. {$?a53376=true}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=true}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]increasing your damage, healing, and critical strike chance by {$s2=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Barricade of Faith17.82.616.4s14.2s11.0s65.09%58.19%2.6 (2.6)17.2

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_barricade_of_faith
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 77.4s
  • trigger_min/max:2.5s / 53.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.5s
  • uptime_min/max:49.72% / 78.69%

Stack Uptimes

  • barricade_of_faith_1:65.09%

Spelldata

  • id:385726
  • name:Barricade of Faith
  • tooltip:
  • description:When you use Avenger's Shield, your block chance is increased by {$385724s1=10}% for {$385724d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Blessed Assurance68.631.24.4s3.0s2.4s55.31%91.79%31.2 (31.2)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_blessed_assurance
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 19.4s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.9s
  • uptime_min/max:42.96% / 70.07%

Stack Uptimes

  • blessed_assurance_1:55.31%

Spelldata

  • id:433019
  • name:Blessed Assurance
  • tooltip:Damage and healing of your next {$?s204019=true}[Blessed Hammer]?s53595[Hammer of the Righteous][Crusader Strike] increased by {$=}w1%.
  • description:{$@spelldesc433015=Casting a Holy Power ability increases the damage and healing of your next {$?s204019=true}[Blessed Hammer]?s53595[Hammer of the Righteous][Crusader Strike] by {$433019s1=200}%.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Blessed Hammer (_absorb)124.30.02.4s2.4s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_blessed_hammer_absorb
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 13.0s
  • trigger_min/max:0.0s / 13.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:204301
  • name:Blessed Hammer
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of Dawn62.80.04.8s4.8s2.1s26.50%62.82%0.0 (0.0)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_blessing_of_dawn
  • max_stacks:2
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 10.8s
  • trigger_min/max:2.7s / 10.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.1s
  • uptime_min/max:9.62% / 45.34%

Stack Uptimes

  • blessing_of_dawn_1:26.50%

Spelldata

  • id:385127
  • name:Blessing of Dawn
  • tooltip:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing.
  • description:Your next Holy Power spending ability deals {$s1=30}% additional increased damage and healing. This effect stacks.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blessing of Dusk1.860.791.7s4.8s164.4s98.78%99.75%60.7 (60.7)0.8

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_blessing_of_dusk
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.2s / 354.4s
  • trigger_min/max:1.0s / 14.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 357.0s
  • uptime_min/max:96.55% / 99.22%

Stack Uptimes

  • blessing_of_dusk_1:98.78%

Spelldata

  • id:385126
  • name:Blessing of Dusk
  • tooltip:Damage taken reduced by {$=}w1%{$?s385129=false}[, armor increased by {$=}w2%, and Holy Power generating abilities cool down {$=}w3% faster.][.]
  • description:Damage taken reduced by {$s1=4}%{$?s385129=false}&c2[, armor increased by {$s2=10}%, and Holy Power generating abilities cool down {$s3=10}% faster]?s385129[ and your Holy Power generating abilities also grant an absorb shield for {$s9=10}% of damage or healing dealt.][] For {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of the Forge4.30.080.6s82.3s19.2s27.44%34.62%0.0 (0.0)3.9

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_blessing_of_the_forge
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • blessing_of_the_forge_1:27.44%

Spelldata

  • id:434132
  • name:Blessing of the Forge
  • tooltip:Assisted by a Sacred Weapon.
  • description:{$@spelldesc433011=Avenging Wrath summons an additional Sacred Weapon, and during Avenging Wrath your Sacred Weapon casts spells on your target and echoes the effects of your Holy Power abilities.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bulwark of Order39.61.97.6s7.2s0.9s12.09%51.12%1.9 (1.9)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_bulwark_of_order
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 40.0s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s
  • uptime_min/max:7.47% / 17.02%

Stack Uptimes

  • bulwark_of_order_1:12.09%

Spelldata

  • id:209389
  • name:Bulwark of Order
  • tooltip:
  • description:Avenger's Shield also shields you for {$209388d=8 seconds}, absorbing {$s1=60}% as much damage as it dealt, up to {$s2=50}% of your maximum health.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Bulwark of Righteous Fury34.66.98.7s7.2s2.3s26.31%36.97%0.0 (0.0)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_bulwark_of_righteous_fury
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 40.0s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.2s
  • uptime_min/max:15.33% / 38.10%

Stack Uptimes

  • bulwark_of_righteous_fury_1:22.58%
  • bulwark_of_righteous_fury_2:3.50%
  • bulwark_of_righteous_fury_3:0.24%
  • bulwark_of_righteous_fury_4:0.00%

Spelldata

  • id:386652
  • name:Bulwark of Righteous Fury
  • tooltip:Increases your next Shield of the Righteous' damage by {$=}w1% and radius by {$s3=6}~ yds.
  • description:{$@spelldesc386653=Avenger's Shield increases the damage of your next Shield of the Righteous by {$386652s1=20}% for each target hit by Avenger's Shield, stacking up to {$386652u=5} times, and increases its radius by {$386652s3=6} yds.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Purpose15.00.018.7s18.7s1.1s5.24%14.83%0.0 (0.0)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 255.2s
  • trigger_min/max:0.1s / 255.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.1s
  • uptime_min/max:0.82% / 12.45%

Stack Uptimes

  • divine_purpose_1:5.24%

Spelldata

  • id:223819
  • name:Divine Purpose
  • tooltip:Your next Holy Power spending ability is free and deals {$s2=15}% increased damage and healing.
  • description:{$@spelldesc223817=Holy Power spending abilities have a {$s1=15}% chance to make your next Holy Power spending ability free and deal {$223819s2=15}% increased damage and healing.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Resonance5.40.061.1s61.1s14.7s26.33%0.00%10.5 (10.5)5.1

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_divine_resonance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:60.0s / 74.1s
  • trigger_min/max:60.0s / 74.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:23.61% / 29.07%

Stack Uptimes

  • divine_resonance_1:26.33%

Spelldata

  • id:355455
  • name:Divine Resonance
  • tooltip:Casting {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$t1=5} sec for {$s2=15} sec.
  • description:{$@spelldesc355098=After casting Divine Toll, you instantly cast {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$355455t1=5} sec. This effect lasts {$355455s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Egg Sac13.90.0135.4s20.3s238.1s92.54%0.00%0.0 (0.0)0.2

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_egg_sac
  • max_stacks:99
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:531.69

Trigger Details

  • interval_min/max:0.1s / 357.0s
  • trigger_min/max:0.1s / 85.2s
  • trigger_pct:99.99%
  • duration_min/max:0.1s / 358.5s
  • uptime_min/max:65.09% / 99.73%

Stack Uptimes

  • egg_sac_1:19.22%
  • egg_sac_2:27.83%
  • egg_sac_3:22.44%
  • egg_sac_4:13.30%
  • egg_sac_5:6.18%
  • egg_sac_6:2.39%
  • egg_sac_7:0.85%
  • egg_sac_8:0.26%
  • egg_sac_9:0.07%
  • egg_sac_10:0.02%
  • egg_sac_11:0.01%
  • egg_sac_12:0.00%

Spelldata

  • id:452146
  • name:Egg Sac
  • tooltip:Overcome by parental instinct, you gain {$=}w1 {$=}pri to protect your brood.
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}
  • max_stacks:99
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Faith in the Light5.11.634.7s25.3s7.1s12.08%16.85%1.6 (1.6)5.1

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_faith_in_the_light
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.1s / 184.7s
  • trigger_min/max:1.2s / 184.7s
  • trigger_pct:100.00%
  • duration_min/max:1.4s / 15.6s
  • uptime_min/max:0.00% / 23.48%

Stack Uptimes

  • faith_in_the_light_1:12.08%

Spelldata

  • id:379041
  • name:Faith in the Light
  • tooltip:Block chance increased by {$=}w1%.
  • description:Casting Word of Glory grants you an additional {$379043s1=5}% block chance for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Faith's Armor23.669.512.6s3.2s11.5s90.30%79.95%69.5 (69.5)22.7

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_faiths_armor
  • max_stacks:1
  • base duration:4.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.5s / 78.1s
  • trigger_min/max:1.0s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.6s
  • uptime_min/max:86.33% / 94.73%

Stack Uptimes

  • faiths_armor_1:90.30%

Spelldata

  • id:379017
  • name:Faith's Armor
  • tooltip:Armor increased by {$=}w1%.
  • description:{$?=}c2[Shield of the Righteous][Word of Glory] grants {$s1=20}% bonus armor for {$d=4.500 seconds}.
  • max_stacks:0
  • duration:4.50
  • cooldown:0.00
  • default_chance:0.00%
fake_solidarity11.50.029.8s26.3s23.0s64.40%89.77%0.0 (0.0)7.8

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_fake_solidarity
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 112.4s
  • trigger_min/max:1.2s / 87.7s
  • trigger_pct:99.96%
  • duration_min/max:0.0s / 74.8s
  • uptime_min/max:47.67% / 80.41%

Stack Uptimes

  • fake_solidarity_1:54.52%
  • fake_solidarity_2:9.82%
  • fake_solidarity_3:0.06%
Flask of Alchemical Chaos (Crit)2.10.6111.9s76.5s35.4s25.09%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 356.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 82.67%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.09%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6111.9s77.4s35.2s25.09%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.3s / 355.2s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 79.80%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.09%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6112.4s78.1s35.0s24.79%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 342.3s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 77.84%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.79%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.8s75.9s35.3s25.03%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 336.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 234.7s
  • uptime_min/max:0.00% / 80.84%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.03%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Holy Bulwark3.30.084.1s84.1s19.4s21.30%39.74%28.7 (28.7)3.1

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_holy_bulwark
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:48.8s / 145.8s
  • trigger_min/max:48.8s / 145.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:15.58% / 26.36%

Stack Uptimes

  • holy_bulwark_1:21.30%

Spelldata

  • id:432496
  • name:Holy Bulwark
  • tooltip:Wielding a Holy Bulwark.{$?=}{$=}w3<0[ Duration of Fear effects reduced by {$s3=0}%.][]
  • description:While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Holy Bulwark (_absorb)31.23.97.0s6.2s1.1s11.64%55.23%3.9 (3.9)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_holy_bulwark_absorb
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:2.0s / 125.8s
  • trigger_min/max:2.0s / 125.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.4s
  • uptime_min/max:2.50% / 21.97%

Stack Uptimes

  • holy_bulwark_absorb_1:11.64%

Spelldata

  • id:432607
  • name:Holy Bulwark
  • tooltip:Absorbing the next {$=}w1 damage you take.
  • description:{$@spelldesc432496=While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Redoubt1.092.2153.3s3.2s298.9s99.67%99.13%90.2 (90.2)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_redoubt
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:150.2s / 156.4s
  • trigger_min/max:1.0s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:149.9s / 359.0s
  • uptime_min/max:99.59% / 99.74%

Stack Uptimes

  • redoubt_1:0.61%
  • redoubt_2:0.57%
  • redoubt_3:98.50%

Spelldata

  • id:280375
  • name:Redoubt
  • tooltip:Strength and Stamina increased by {$=}w1%.
  • description:{$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Relentless Inquisitor1.098.90.0s3.0s299.0s99.67%84.86%96.9 (96.9)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_relentless_inquisitor
  • max_stacks:3
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:239.0s / 359.0s
  • uptime_min/max:99.59% / 99.74%

Stack Uptimes

  • relentless_inquisitor_1:0.61%
  • relentless_inquisitor_2:0.57%
  • relentless_inquisitor_3:98.50%

Spelldata

  • id:383389
  • name:Relentless Inquisitor
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc383388=Spending Holy Power grants you {$s1=1}% haste per finisher for {$383389d=12 seconds}, stacking up to {$=}{{$s2=0}+{$s3=3}} times.}
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Sacred Weapon5.92.355.0s40.3s24.6s48.61%49.33%2.3 (2.3)5.3

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_sacred_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:8.00
  • modifier:1.00

Stack Uptimes

  • sacred_weapon_1:48.61%

Spelldata

  • id:432502
  • name:Sacred Weapon
  • tooltip:Your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets.{$?=}{$=}w3<0[ Duration of Fear effects reduced by {$s3=0}%.][]
  • description:While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Shield of the Righteous1.092.20.0s3.2s299.0s99.67%100.00%92.2 (92.2)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_shield_of_the_righteous
  • max_stacks:1
  • base duration:4.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:1.0s / 10.3s
  • trigger_pct:100.00%
  • duration_min/max:239.0s / 359.0s
  • uptime_min/max:99.59% / 99.74%

Stack Uptimes

  • shield_of_the_righteous_1:99.67%

Spelldata

  • id:132403
  • name:Shield of the Righteous
  • tooltip:Armor increased by {$?=}c1[{$=}{{$=}W1*{$=}INT/100}][{$=}{{$=}W1*{$=}STR/100}].{$?=}{$=}W3<0[ Damage taken reduced by {$=}w3%.][]
  • description:{$@spelldesc53600=Slams enemies in front of you with your shield, causing {$s1=0} Holy damage, and increasing your Armor by {$?=}c1[{$=}{{$132403s1=160}*{$=}INT/100}][{$=}{{$132403s1=160}*{$=}STR/100}] for {$132403d=4.500 seconds}.{$?a386568=false}[ {$@spelldesc386568=When Shield of the Righteous expires, gain {$386556s1=10}% block chance and deal {$386553s1=0} Holy damage to all attackers for {$386556d=4 seconds}.}][]{$?a280373=true}[ {$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}][] }
  • max_stacks:0
  • duration:4.50
  • cooldown:0.00
  • default_chance:0.00%
Shining Light (_free)2.638.992.7s7.2s113.2s96.40%100.00%32.8 (32.8)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_shining_light_free
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.4s / 271.9s
  • trigger_min/max:0.0s / 22.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.8s
  • uptime_min/max:85.23% / 99.16%

Stack Uptimes

  • shining_light_free_1:12.42%
  • shining_light_free_2:83.98%

Spelldata

  • id:327510
  • name:Shining Light
  • tooltip:Your next Word of Glory costs no Holy Power.
  • description:{$@spelldesc321136=Every {$s1=3} Shields of the Righteous make your next Word of Glory cost no Holy Power. Maximum {$327510=}U stacks.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Shining Light (_stacks)31.431.09.7s4.8s6.4s66.66%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_shining_light_stacks
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 22.1s
  • trigger_min/max:1.0s / 15.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.9s
  • uptime_min/max:58.60% / 74.67%

Stack Uptimes

  • shining_light_stacks_1:33.44%
  • shining_light_stacks_2:33.22%

Spelldata

  • id:182104
  • name:Shining Light
  • tooltip:After {$=}{{$321136s1=3}~-{$=}w1} {$?=}{$=}w1<{$=}w2[Shields][Shield] of the Righteous, your next Word of Glory is free.
  • description:{$@spelldesc321136=Every {$s1=3} Shields of the Righteous make your next Word of Glory cost no Holy Power. Maximum {$327510=}U stacks.}
  • max_stacks:4
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Spiderling10.90.120.3s20.1s0.7s2.43%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_spiderling
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 85.2s
  • trigger_min/max:0.5s / 85.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.3s
  • uptime_min/max:0.26% / 6.67%

Stack Uptimes

  • spiderling_1:2.41%
  • spiderling_2:0.02%
  • spiderling_3:0.00%

Spelldata

  • id:452226
  • name:Spiderling
  • tooltip:A new brood is ready to attack!
  • description:Casting a harmful spell or ability launches one of your spiderlings at the enemy inflicting {$443541s2=6209} Nature damage over $12096d.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Strength in Adversity41.50.07.2s7.2s7.2s99.35%100.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_strength_in_adversity
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 40.0s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.0s
  • uptime_min/max:99.18% / 99.48%

Stack Uptimes

  • strength_in_adversity_1:99.35%

Spelldata

  • id:393071
  • name:Strength in Adversity
  • tooltip:
  • description:For each target hit by Avenger's Shield, gain {$s1=5}% parry for {$393038d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Tempered Potion1.30.0322.9s0.0s27.1s11.67%0.00%0.0 (0.0)1.1

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:304.2s / 341.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:8.95% / 17.61%

Stack Uptimes

  • tempered_potion_1:11.67%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devotion Aura

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_devotion_aura
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:465
  • name:Devotion Aura
  • tooltip:Damage taken reduced by {$=}w1%.
  • description:Party and raid members within {$=}a1 yds are bolstered by their devotion, reducing damage taken by {$s1=3}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rite of Sanctification

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_rite_of_sanctification
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:433550
  • name:Rite of Sanctification
  • tooltip:Primary stat increased by {$=}w1%. Armor increased by {$=}w2%.
  • description:{$@spelldesc433568=Imbue your weapon with the power of the Light, increasing your armor by {$433550s2=5}% and your primary stat by {$433550s1=2}%. Lasts {$433550d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:446.00

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)29.18.052.010.0s0.9s127.3s
parry_haste8.40.023.031.5s2.0s298.0s
Divine Purpose15.02.036.018.7s0.1s255.2s
Avenger's Shield: Grand Crusader8.20.020.031.5s2.0s263.1s
Avenger's Shield: Grand Crusader wasted4.40.017.052.5s0.0s336.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Avenger's Shield (_dt)40.4131.86661.983236.637192.359288.552
Avenger's Shield (_dr)11.2250.00051.983187.680152.289228.942
Consecration17.0040.00087.637251.284187.536316.632
Avenging Wrath0.4580.0001.2841.9620.0005.119
Divine Toll1.2200.00014.1326.5962.17020.069
Judgment0.0150.0001.5261.3140.0006.613
Eye of Tyr22.2900.000121.238121.41940.668239.379
Shield of the Righteous2.4150.1499.413226.122168.582281.417
Avenger's Shield4.9690.00047.722104.60443.029190.818
Blessed Hammer0.0920.0008.6856.8584.61620.162
Holy Bulwark (Holy Armaments)2.8170.00021.81620.49020.00029.678
Hammer of Wrath4.3820.00058.166129.30182.315166.948

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Bòfròst
Blessed HammerHoly Power74.1774.1631.45%1.000.020.02%
Blessed Hammer (_absorb)Health124.282,215,964.1311.66%17,831.070.000.00%
Divine TollHoly Power5.385.382.28%1.000.000.00%
Hammer of WrathHoly Power29.5029.5012.51%1.000.010.02%
JudgmentHoly Power85.79126.7653.76%1.480.040.03%
LeechHealth247.98432,060.142.27%1,742.2911,178.142.52%
Sacred Weapon (_proc_heal)Health0.1272,056.920.38%578,707.120.000.00%
Sacred WordHealth0.2234,591.540.18%159,627.520.000.00%
Word of GloryHealth6.7016,247,152.7285.50%2,423,508.23608.190.00%
Usage Type Count Total Tot% Avg RPE APR
Bòfròst
Shield of the RighteousHoly Power93.15234.72100.00%2.522.5275,436.72
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Health5,660,180.0569,690.88828,088.651,513,109.0-67,523,085.7-113,584,059.1-28,381,566.5
Holy Power0.00.790.780.11.10.05.0

Statistics & Data Analysis

Fight Length
Bòfròst Fight Length
Count 9999
Mean 299.98
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Bòfròst Damage Per Second
Count 9999
Mean 305816.81
Minimum 264514.94
Maximum 355273.71
Spread ( max - min ) 90758.77
Range [ ( max - min ) / 2 * 100% ] 14.84%
Standard Deviation 12458.3222
5th Percentile 286112.04
95th Percentile 326887.82
( 95th Percentile - 5th Percentile ) 40775.79
Mean Distribution
Standard Deviation 124.5895
95.00% Confidence Interval ( 305572.62 - 306061.00 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6376
0.1 Scale Factor Error with Delta=300 1324961
0.05 Scale Factor Error with Delta=300 5299841
0.01 Scale Factor Error with Delta=300 132496006
Priority Target DPS
Bòfròst Priority Target Damage Per Second
Count 9999
Mean 305816.81
Minimum 264514.94
Maximum 355273.71
Spread ( max - min ) 90758.77
Range [ ( max - min ) / 2 * 100% ] 14.84%
Standard Deviation 12458.3222
5th Percentile 286112.04
95th Percentile 326887.82
( 95th Percentile - 5th Percentile ) 40775.79
Mean Distribution
Standard Deviation 124.5895
95.00% Confidence Interval ( 305572.62 - 306061.00 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6376
0.1 Scale Factor Error with Delta=300 1324961
0.05 Scale Factor Error with Delta=300 5299841
0.01 Scale Factor Error with Delta=300 132496006
DPS(e)
Bòfròst Damage Per Second (Effective)
Count 9999
Mean 305816.81
Minimum 264514.94
Maximum 355273.71
Spread ( max - min ) 90758.77
Range [ ( max - min ) / 2 * 100% ] 14.84%
Damage
Bòfròst Damage
Count 9999
Mean 91642588.55
Minimum 66315992.17
Maximum 121650025.53
Spread ( max - min ) 55334033.36
Range [ ( max - min ) / 2 * 100% ] 30.19%
DTPS
Bòfròst Damage Taken Per Second
Count 9999
Mean 828084.36
Minimum 707077.31
Maximum 956103.17
Spread ( max - min ) 249025.87
Range [ ( max - min ) / 2 * 100% ] 15.04%
Standard Deviation 30977.6441
5th Percentile 777126.39
95th Percentile 879234.30
( 95th Percentile - 5th Percentile ) 102107.91
Mean Distribution
Standard Deviation 309.7919
95.00% Confidence Interval ( 827477.17 - 828691.54 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5376
0.1 Scale Factor Error with Delta=300 8191821
0.05 Scale Factor Error with Delta=300 32767283
0.01 Scale Factor Error with Delta=300 819182074
HPS
Bòfròst Healing Per Second
Count 9999
Mean 55538.98
Minimum 1445.88
Maximum 121743.27
Spread ( max - min ) 120297.39
Range [ ( max - min ) / 2 * 100% ] 108.30%
Standard Deviation 16545.5877
5th Percentile 28633.70
95th Percentile 83156.03
( 95th Percentile - 5th Percentile ) 54522.33
Mean Distribution
Standard Deviation 165.4642
95.00% Confidence Interval ( 55214.68 - 55863.28 )
Normalized 95.00% Confidence Interval ( 99.42% - 100.58% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 3410
0.1% Error 340930
0.1 Scale Factor Error with Delta=300 2336943
0.05 Scale Factor Error with Delta=300 9347771
0.01 Scale Factor Error with Delta=300 233694271
HPS(e)
Bòfròst Healing Per Second (Effective)
Count 9999
Mean 55538.98
Minimum 1445.88
Maximum 121743.27
Spread ( max - min ) 120297.39
Range [ ( max - min ) / 2 * 100% ] 108.30%
Heal
Bòfròst Heal
Count 9999
Mean 16780195.13
Minimum 364526.71
Maximum 39467498.09
Spread ( max - min ) 39102971.37
Range [ ( max - min ) / 2 * 100% ] 116.52%
HTPS
Bòfròst Healing Taken Per Second
Count 9999
Mean 353018.57
Minimum 295810.68
Maximum 418367.68
Spread ( max - min ) 122557.01
Range [ ( max - min ) / 2 * 100% ] 17.36%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 rite_of_sanctification
1 0.00 rite_of_adjuration
2 0.00 snapshot_stats
3 0.00 devotion_aura
4 0.00 lights_judgment
5 0.00 arcane_torrent
6 0.00 consecration
7 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_cooldown&trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)|!trinket.2.has_cooldown
8 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_cooldown&trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)|!trinket.1.has_cooldown
Default action list Executed every time the actor is available.
# count action,conditions
9 1.00 auto_attack
A 0.00 call_action_list,name=cooldowns
B 0.00 call_action_list,name=defensives
C 0.00 call_action_list,name=trinkets
D 0.00 call_action_list,name=standard
actions.cooldowns
# count action,conditions
0.00 lights_judgment,if=spell_targets.lights_judgment>=2|!raid_event.adds.exists|raid_event.adds.in>75|raid_event.adds.up
E 4.27 avenging_wrath
F 1.30 potion,if=buff.avenging_wrath.up
0.00 moment_of_glory,if=(buff.avenging_wrath.remains<15|(time>10))
0.00 divine_toll,if=spell_targets.shield_of_the_righteous>=3
0.00 bastion_of_light,if=buff.avenging_wrath.up|cooldown.avenging_wrath.remains<=30
0.00 invoke_external_buff,name=power_infusion,if=buff.avenging_wrath.up
0.00 fireblood,if=buff.avenging_wrath.remains>8
actions.defensives
# count action,conditions
G 6.42 ardent_defender
actions.standard
# count action,conditions
H 11.52 judgment,target_if=charges>=2|full_recharge_time<=gcd.max
0.00 hammer_of_light,if=buff.hammer_of_light_free.remains<2|buff.shake_the_heavens.remains<1|!buff.shake_the_heavens.up|cooldown.eye_of_tyr.remains<1.5|fight_remains<2
0.00 eye_of_tyr,if=(hpg_to_2dawn=5|!talent.of_dusk_and_dawn.enabled)&talent.lights_guidance.enabled
0.00 eye_of_tyr,if=(hpg_to_2dawn=1|buff.blessing_of_dawn.stack>0)&talent.lights_guidance.enabled
I 93.15 shield_of_the_righteous,if=(!talent.righteous_protector.enabled|cooldown.righteous_protector_icd.remains=0)&!buff.hammer_of_light_ready.up
0.00 judgment,target_if=min:debuff.judgment.remains,if=spell_targets.shield_of_the_righteous>3&buff.bulwark_of_righteous_fury.stack>=3&holy_power<3
0.00 avengers_shield,if=!buff.bulwark_of_righteous_fury.up&talent.bulwark_of_righteous_fury.enabled&spell_targets.shield_of_the_righteous>=3
0.00 hammer_of_the_righteous,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3&!buff.avenging_wrath.up
J 34.68 blessed_hammer,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3&!buff.avenging_wrath.up
0.00 crusader_strike,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<2&!buff.avenging_wrath.up
0.00 judgment,target_if=min:debuff.judgment.remains,if=charges>=2|full_recharge_time<=gcd.max
0.00 consecration,if=buff.divine_guidance.stack=5
K 3.97 holy_armaments,if=next_armament=sacred_weapon&(!buff.sacred_weapon.up|(buff.sacred_weapon.remains<6&!buff.avenging_wrath.up&cooldown.avenging_wrath.remains<=30))
L 29.50 hammer_of_wrath
M 5.38 divine_toll,if=(!raid_event.adds.exists|raid_event.adds.in>10)
0.00 avengers_shield,if=talent.refining_fire.enabled&talent.lights_guidance.enabled
N 35.14 judgment,target_if=min:debuff.judgment.remains,if=(buff.avenging_wrath.up&talent.hammer_and_anvil.enabled)
O 0.13 holy_armaments,if=next_armament=holy_bulwark&charges=2
P 39.14 judgment,target_if=min:debuff.judgment.remains
0.00 avengers_shield,if=!buff.shake_the_heavens.up&talent.shake_the_heavens.enabled
0.00 hammer_of_the_righteous,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
Q 33.41 blessed_hammer,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3)|buff.shake_the_heavens.up
0.00 crusader_strike,if=(buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<2)|buff.shake_the_heavens.up
R 20.44 avengers_shield,if=!talent.lights_guidance.enabled
S 12.72 consecration,if=!consecration.up
T 4.65 eye_of_tyr,if=(talent.inmost_light.enabled&raid_event.adds.in>=45|spell_targets.shield_of_the_righteous>=3)&!talent.lights_deliverance.enabled
U 3.17 holy_armaments,if=next_armament=holy_bulwark
V 6.08 blessed_hammer
0.00 hammer_of_the_righteous
0.00 crusader_strike
W 6.70 word_of_glory,if=buff.shining_light_free.up&(talent.blessed_assurance.enabled|(talent.lights_guidance.enabled&cooldown.hammerfall_icd.remains=0))
0.00 avengers_shield
0.00 eye_of_tyr,if=!talent.lights_deliverance.enabled
0.00 word_of_glory,if=buff.shining_light_free.up
0.00 arcane_torrent,if=holy_power<5
X 0.11 consecration

Sample Sequence

036789EFGHLIMHINQILINIQIQINILQINQINILINIQIQINIKILNIQNIQLNIQHINILQNIQIRLIGJHPISJTPURPIJVPIWJPPIJRSPMIJPKVIHJPIELNIQNIRLNIQNIQHILNIIQGNIQLNIIQRSLINQINQITPJRPIJSUPVIWPJMIPJRPIJSWHJIPRJPIWJHGPIJRPSTPIIJKELNIQNIQLINNIQNILNIQRSLINQINQIILNIQMNILQIJPRSPIGJTPVIIJIPJIRUPJSPIJWPJIRPJWXPIJWPJIPRJPIWELNIQSNILMNIGQRLINQIQNIILKNIQRLNIIQNIINILIJRPIJLPIJPRLIIJIJHIJLHIJPRGLIJHPIJ

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0rite_of_sanctification
[precombat]
Bòfròst 5660180.0/5660180 100% HP
0.0/5 0% HoPo
Pre3devotion_aura
[precombat]
Fluffy_Pillow 5660180.0/5660180 100% HP
0.0/5 0% HoPo
Pre6consecration
[precombat]
Fluffy_Pillow 5660180.0/5660180 100% HP
0.0/5 0% HoPo
Pre7trinket_sync_slot
[precombat]
Bòfròst 5660180.0/5660180 100% HP
0.0/5 0% HoPo
Pre8trinket_sync_slot
[precombat]
Bòfròst 5660180.0/5660180 100% HP
0.0/5 0% HoPo
0:00.0009auto_attack
[default]
Fluffy_Pillow 5660180.0/5660180 100% HP
0.0/5 0% HoPo
0:00.000Eavenging_wrath
[cooldowns]
Fluffy_Pillow 5660180.0/5660180 100% HP
0.0/5 0% HoPo
bloodlust
0:00.000Fpotion
[cooldowns]
Fluffy_Pillow 5660180.0/5660180 100% HP
0.0/5 0% HoPo
bloodlust, avenging_wrath, sacred_weapon, blessing_of_the_forge
0:00.000Gardent_defender
[defensives]
Fluffy_Pillow 5660180.0/5660180 100% HP
0.0/5 0% HoPo
bloodlust, avenging_wrath, sacred_weapon, blessing_of_the_forge, tempered_potion
0:00.000Hjudgment
[standard]
Fluffy_Pillow 5660180.0/5660180 100% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, avenging_wrath, sacred_weapon, blessing_of_the_forge, tempered_potion
0:00.978Lhammer_of_wrath
[standard]
Fluffy_Pillow 5660180.0/5660180 100% HP
2.0/5 40% HoPo
bloodlust, ardent_defender, avenging_wrath, sacred_weapon, blessing_of_the_forge, fake_solidarity, tempered_potion
0:00.978Ishield_of_the_righteous
[standard]
Fluffy_Pillow 5660180.0/5660180 100% HP
3.0/5 60% HoPo
bloodlust, ardent_defender, avenging_wrath, sacred_weapon, blessing_of_the_forge, fake_solidarity, tempered_potion
0:01.955Mdivine_toll
[standard]
Fluffy_Pillow 5773380.0/5773380 100% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, redoubt, shield_of_the_righteous, shining_light_stacks, avenging_wrath, faiths_armor, relentless_inquisitor, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, tempered_potion
0:02.924Hjudgment
[standard]
Fluffy_Pillow 5773380.0/5773380 100% HP
1.0/5 20% HoPo
bloodlust, ardent_defender, bulwark_of_order, redoubt, shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, avenging_wrath, strength_in_adversity, faiths_armor, relentless_inquisitor, divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, tempered_potion
0:02.924Ishield_of_the_righteous
[standard]
Fluffy_Pillow 5773380.0/5773380 100% HP
3.0/5 60% HoPo
bloodlust, ardent_defender, bulwark_of_order, redoubt, shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, avenging_wrath, strength_in_adversity, blessing_of_dawn, faiths_armor, relentless_inquisitor, divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, tempered_potion
0:03.891Njudgment
[standard]
Fluffy_Pillow 5886580.0/5886580 100% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, bulwark_of_order, redoubt(2), shield_of_the_righteous, shining_light_stacks(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(2), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, tempered_potion
0:04.849Qblessed_hammer
[standard]
Fluffy_Pillow 808428.3/5886580 14% HP
2.0/5 40% HoPo
bloodlust, ardent_defender, redoubt(2), shield_of_the_righteous, shining_light_stacks(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(2), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, tempered_potion
0:04.849Ishield_of_the_righteous
[standard]
Fluffy_Pillow 808428.3/5886580 14% HP
3.0/5 60% HoPo
bloodlust, ardent_defender, redoubt(2), shield_of_the_righteous, shining_light_stacks(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(2), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, tempered_potion
0:05.807Lhammer_of_wrath
[standard]
Fluffy_Pillow 2326511.4/5999780 39% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:05.905Ishield_of_the_righteous
[standard]
Fluffy_Pillow 2326511.4/5999780 39% HP
1.0/5 20% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:06.759Njudgment
[standard]
Fluffy_Pillow 338070.5/5999780 6% HP
1.0/5 20% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:06.945Ishield_of_the_righteous
[standard]
Fluffy_Pillow 338070.5/5999780 6% HP
3.0/5 60% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:07.712Qblessed_hammer
[standard]
Fluffy_Pillow 1204402.7/5999780 20% HP
3.0/5 60% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:08.021Ishield_of_the_righteous
[standard]
Fluffy_Pillow -604036.9/5999780 -10% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:08.665Qblessed_hammer
[standard]
Fluffy_Pillow -604036.9/5999780 -10% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:09.049Ishield_of_the_righteous
[standard]
Fluffy_Pillow -1169824.3/5999780 -19% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:09.618Njudgment
[standard]
Fluffy_Pillow -1169824.3/5999780 -19% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:10.118Ishield_of_the_righteous
[standard]
Fluffy_Pillow -2159776.8/5999780 -36% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:10.571Lhammer_of_wrath
[standard]
Fluffy_Pillow -2159776.8/5999780 -36% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:11.524Qblessed_hammer
[standard]
Fluffy_Pillow -2804549.9/5999780 -47% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:11.524Ishield_of_the_righteous
[standard]
Fluffy_Pillow -2804549.9/5999780 -47% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:12.478Njudgment
[standard]
Fluffy_Pillow -5702571.3/5999780 -95% HP
0.0/5 0% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:13.534Qblessed_hammer
[standard]
Fluffy_Pillow -6256446.3/5999780 -104% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:13.534Ishield_of_the_righteous
[standard]
Fluffy_Pillow -6256446.3/5999780 -104% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:14.486Njudgment
[standard]
Fluffy_Pillow -8365180.7/5999780 -139% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:14.598Ishield_of_the_righteous
[standard]
Fluffy_Pillow -8365180.7/5999780 -139% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:15.440Lhammer_of_wrath
[standard]
Fluffy_Pillow -7511686.7/5999780 -125% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:15.630Ishield_of_the_righteous
[standard]
Fluffy_Pillow -7507923.8/5999780 -125% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:16.392Njudgment
[standard]
Fluffy_Pillow -9604908.5/5999780 -160% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:16.685Ishield_of_the_righteous
[standard]
Fluffy_Pillow -9601855.7/5999780 -160% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:17.345Qblessed_hammer
[standard]
Fluffy_Pillow -10250312.9/5999780 -171% HP
2.0/5 40% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:17.765Ishield_of_the_righteous
[standard]
Fluffy_Pillow -10243679.8/5999780 -171% HP
3.0/5 60% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:18.297Qblessed_hammer
[standard]
Fluffy_Pillow -12229965.9/5999780 -204% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:18.799Ishield_of_the_righteous
[standard]
Fluffy_Pillow -12222216.9/5999780 -204% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:19.251Njudgment
[standard]
Fluffy_Pillow -12870674.2/5999780 -215% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:19.856Ishield_of_the_righteous
[standard]
Fluffy_Pillow -12869252.8/5999780 -214% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:20.203Kholy_armaments
[standard]
Fluffy_Pillow -13541007.6/5999780 -226% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, flask_of_alchemical_chaos_vers, tempered_potion
0:20.917Ishield_of_the_righteous
[standard]
Fluffy_Pillow -13537192.2/5999780 -226% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:21.156Lhammer_of_wrath
[standard]
Fluffy_Pillow -14185649.4/5999780 -236% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:22.108Njudgment
[standard]
Fluffy_Pillow -16301850.5/5999780 -272% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:22.108Ishield_of_the_righteous
[standard]
Fluffy_Pillow -16301850.5/5999780 -272% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:23.060Qblessed_hammer
[standard]
Fluffy_Pillow -16965170.6/5999780 -283% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:24.013Njudgment
[standard]
Fluffy_Pillow -16959500.6/5999780 -283% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:24.013Ishield_of_the_righteous
[standard]
Fluffy_Pillow -16959500.6/5999780 -283% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:24.963Qblessed_hammer
[standard]
Fluffy_Pillow -16958922.9/5999780 -283% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:25.914Lhammer_of_wrath
[standard]
Fluffy_Pillow -16103746.2/5999780 -268% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:26.868Njudgment
[standard]
Fluffy_Pillow -18981549.5/5999780 -316% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:26.868Ishield_of_the_righteous
[standard]
Fluffy_Pillow -18981549.5/5999780 -316% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:27.820Qblessed_hammer
[standard]
Fluffy_Pillow -19640010.0/5999780 -327% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:28.773Hjudgment
[standard]
Fluffy_Pillow -22516361.4/5999780 -375% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:28.773Ishield_of_the_righteous
[standard]
Fluffy_Pillow -22516361.4/5999780 -375% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:29.725Njudgment
[standard]
Fluffy_Pillow -23181958.6/5999780 -386% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:29.832Ishield_of_the_righteous
[standard]
Fluffy_Pillow -23180711.5/5999780 -386% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers, tempered_potion
0:30.677Lhammer_of_wrath
[standard]
Fluffy_Pillow -23848421.2/5999780 -397% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers
0:31.665Qblessed_hammer
[standard]
Fluffy_Pillow -24507495.0/5999780 -408% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers
0:32.652Njudgment
[standard]
Fluffy_Pillow -24505791.0/5999780 -408% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_vers
0:32.652Ishield_of_the_righteous
[standard]
Fluffy_Pillow -24505791.0/5999780 -408% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_vers
0:33.638Qblessed_hammer
[standard]
Fluffy_Pillow -25166477.3/5999780 -419% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers
0:33.737Ishield_of_the_righteous
[standard]
Fluffy_Pillow -25163050.6/5999780 -419% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_vers
0:34.624Ravengers_shield
[standard]
Fluffy_Pillow -25163050.6/5999780 -419% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers
0:35.611Lhammer_of_wrath
[standard]
Fluffy_Pillow -24218415.5/5999780 -404% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers
0:35.611Ishield_of_the_righteous
[standard]
Fluffy_Pillow -24218415.5/5999780 -404% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers
0:35.611Gardent_defender
[defensives]
Fluffy_Pillow -24218415.5/5999780 -404% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_vers
0:36.598Jblessed_hammer
[standard]
Fluffy_Pillow -24216804.9/5999780 -404% HP
0.0/5 0% HoPo
bloodlust, ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_mastery
0:37.660Hjudgment
[standard]
Fluffy_Pillow -12212240.8/5999780 -204% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_mastery
0:38.644Pjudgment
[standard]
Fluffy_Pillow -12211230.6/5999780 -204% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_mastery
0:38.644Ishield_of_the_righteous
[standard]
Fluffy_Pillow -12211230.6/5999780 -204% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, flask_of_alchemical_chaos_mastery
0:39.628Sconsecration
[standard]
Fluffy_Pillow -12906261.1/5999780 -215% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_mastery
0:40.609Jblessed_hammer
[standard]
Fluffy_Pillow -11406140.1/5999780 -190% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, flask_of_alchemical_chaos_mastery
0:41.885Teye_of_tyr
[standard]
Fluffy_Pillow -12004476.9/5999780 -200% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), flask_of_alchemical_chaos_mastery
0:43.159Pjudgment
[standard]
Fluffy_Pillow -12465564.0/5999780 -208% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), flask_of_alchemical_chaos_mastery
0:44.436Uholy_armaments
[standard]
Fluffy_Pillow -12464408.5/5999780 -208% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), flask_of_alchemical_chaos_mastery
0:45.710Ravengers_shield
[standard]
Fluffy_Pillow -10964354.1/5999780 -183% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, flask_of_alchemical_chaos_mastery
0:47.010Pjudgment
[standard]
Fluffy_Pillow -10963648.1/5999780 -183% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, flask_of_alchemical_chaos_mastery
0:47.010Ishield_of_the_righteous
[standard]
Fluffy_Pillow -10963648.1/5999780 -183% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, flask_of_alchemical_chaos_mastery
0:48.287Jblessed_hammer
[standard]
Fluffy_Pillow -10960492.2/5999780 -183% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, flask_of_alchemical_chaos_mastery
0:49.564Vblessed_hammer
[standard]
Fluffy_Pillow -11167759.5/5999780 -186% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, flask_of_alchemical_chaos_mastery
0:50.840Pjudgment
[standard]
Fluffy_Pillow -9667424.3/5999780 -161% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
0:50.840Ishield_of_the_righteous
[standard]
Fluffy_Pillow -9667424.3/5999780 -161% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
0:52.117Wword_of_glory
[standard]
Bòfròst -10138004.9/5999780 -169% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
0:53.392Jblessed_hammer
[standard]
Fluffy_Pillow -8739046.5/5999780 -146% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
0:54.667Pjudgment
[standard]
Fluffy_Pillow -8738599.2/5999780 -146% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
0:55.942Pjudgment
[standard]
Fluffy_Pillow -7794968.6/5999780 -130% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
0:55.957Ishield_of_the_righteous
[standard]
Fluffy_Pillow -7794968.6/5999780 -130% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
0:57.233Jblessed_hammer
[standard]
Fluffy_Pillow -8352190.6/5999780 -139% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
0:58.509Ravengers_shield
[standard]
Fluffy_Pillow -8351966.3/5999780 -139% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
0:59.784Sconsecration
[standard]
Fluffy_Pillow -8866573.5/5999780 -148% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
1:01.060Pjudgment
[standard]
Fluffy_Pillow -7838361.9/5999780 -131% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
1:02.336Mdivine_toll
[standard]
Fluffy_Pillow -12980921.0/5999780 -216% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
1:02.336Ishield_of_the_righteous
[standard]
Fluffy_Pillow -12980921.0/5999780 -216% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
1:03.610Jblessed_hammer
[standard]
Fluffy_Pillow -13386669.4/5999780 -223% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, blessed_assurance, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
1:04.885Pjudgment
[standard]
Fluffy_Pillow -15983748.7/5999780 -266% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark_absorb, egg_sac, flask_of_alchemical_chaos_mastery
1:06.159Kholy_armaments
[standard]
Fluffy_Pillow -14978999.0/5999780 -250% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, egg_sac, flask_of_alchemical_chaos_vers
1:07.440Vblessed_hammer
[standard]
Fluffy_Pillow -14978296.5/5999780 -250% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, sacred_weapon, fake_solidarity, egg_sac, flask_of_alchemical_chaos_vers
1:07.440Ishield_of_the_righteous
[standard]
Fluffy_Pillow -14978296.5/5999780 -250% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, sacred_weapon, fake_solidarity, egg_sac, flask_of_alchemical_chaos_vers
1:08.722Hjudgment
[standard]
Fluffy_Pillow -15523057.3/5999780 -259% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_vers
1:10.001Jblessed_hammer
[standard]
Fluffy_Pillow -16630921.4/5999780 -277% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_vers
1:11.283Pjudgment
[standard]
Fluffy_Pillow -17217591.1/5999780 -287% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:11.283Ishield_of_the_righteous
[standard]
Fluffy_Pillow -17217591.1/5999780 -287% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:12.564Eavenging_wrath
[cooldowns]
Fluffy_Pillow -19735455.7/5999780 -329% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:12.564Lhammer_of_wrath
[standard]
Fluffy_Pillow -19735455.7/5999780 -329% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:13.844Njudgment
[standard]
Fluffy_Pillow -19733022.5/5999780 -329% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:13.985Ishield_of_the_righteous
[standard]
Fluffy_Pillow -19733022.5/5999780 -329% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:15.266Qblessed_hammer
[standard]
Fluffy_Pillow -20915791.8/5999780 -349% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:16.547Njudgment
[standard]
Fluffy_Pillow -24486157.4/5999780 -408% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:16.547Ishield_of_the_righteous
[standard]
Fluffy_Pillow -24486157.4/5999780 -408% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:17.828Ravengers_shield
[standard]
Fluffy_Pillow -24481003.5/5999780 -408% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:19.109Lhammer_of_wrath
[standard]
Fluffy_Pillow -27139238.0/5999780 -452% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:20.391Njudgment
[standard]
Fluffy_Pillow -28461781.4/5999780 -474% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:20.391Ishield_of_the_righteous
[standard]
Fluffy_Pillow -28461781.4/5999780 -474% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:21.672Qblessed_hammer
[standard]
Fluffy_Pillow -28457062.2/5999780 -474% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:22.953Njudgment
[standard]
Fluffy_Pillow -31238025.4/5999780 -521% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:22.953Ishield_of_the_righteous
[standard]
Fluffy_Pillow -31238025.4/5999780 -521% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:24.235Qblessed_hammer
[standard]
Fluffy_Pillow -34870927.1/5999780 -581% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:25.515Hjudgment
[standard]
Fluffy_Pillow -33370250.1/5999780 -556% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:25.515Ishield_of_the_righteous
[standard]
Fluffy_Pillow -33370250.1/5999780 -556% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:26.795Lhammer_of_wrath
[standard]
Fluffy_Pillow -36155665.0/5999780 -603% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:28.076Njudgment
[standard]
Fluffy_Pillow -38973161.3/5999780 -650% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:28.076Ishield_of_the_righteous
[standard]
Fluffy_Pillow -38973161.3/5999780 -650% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:29.106Ishield_of_the_righteous
[standard]
Fluffy_Pillow -38969925.9/5999780 -650% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:29.358Qblessed_hammer
[standard]
Fluffy_Pillow -38969925.9/5999780 -650% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:29.611Gardent_defender
[defensives]
Fluffy_Pillow -38969925.9/5999780 -650% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:30.638Njudgment
[standard]
Fluffy_Pillow -26146820.0/5999780 -436% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:30.638Ishield_of_the_righteous
[standard]
Fluffy_Pillow -26146820.0/5999780 -436% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:31.918Qblessed_hammer
[standard]
Fluffy_Pillow -26141603.5/5999780 -436% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
1:33.199Lhammer_of_wrath
[standard]
Fluffy_Pillow -26800011.5/5999780 -447% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, egg_sac(3), flask_of_alchemical_chaos_vers
1:34.480Njudgment
[standard]
Fluffy_Pillow -27476240.7/5999780 -458% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, egg_sac(3), flask_of_alchemical_chaos_vers
1:34.480Ishield_of_the_righteous
[standard]
Fluffy_Pillow -27476240.7/5999780 -458% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, egg_sac(3), flask_of_alchemical_chaos_vers
1:35.493Ishield_of_the_righteous
[standard]
Fluffy_Pillow -25971379.0/5999780 -433% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, egg_sac(3), flask_of_alchemical_chaos_vers
1:35.759Qblessed_hammer
[standard]
Fluffy_Pillow -25971379.0/5999780 -433% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, egg_sac(3), flask_of_alchemical_chaos_crit
1:37.039Ravengers_shield
[standard]
Fluffy_Pillow -26649733.0/5999780 -444% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, egg_sac(3), flask_of_alchemical_chaos_crit
1:38.319Sconsecration
[standard]
Fluffy_Pillow -27296748.2/5999780 -455% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, egg_sac(4), flask_of_alchemical_chaos_crit
1:39.600Lhammer_of_wrath
[standard]
Fluffy_Pillow -27295938.9/5999780 -455% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(4), flask_of_alchemical_chaos_crit
1:39.600Ishield_of_the_righteous
[standard]
Fluffy_Pillow -27295938.9/5999780 -455% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(4), flask_of_alchemical_chaos_crit
1:40.881Njudgment
[standard]
Fluffy_Pillow -26402664.7/5999780 -440% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_crit
1:42.161Qblessed_hammer
[standard]
Fluffy_Pillow -27027612.7/5999780 -450% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_crit
1:42.161Ishield_of_the_righteous
[standard]
Fluffy_Pillow -27027612.7/5999780 -450% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(4), flask_of_alchemical_chaos_crit
1:43.443Njudgment
[standard]
Fluffy_Pillow -27026602.6/5999780 -450% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_crit
1:44.726Qblessed_hammer
[standard]
Fluffy_Pillow -27633940.0/5999780 -461% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_crit
1:44.726Ishield_of_the_righteous
[standard]
Fluffy_Pillow -27633940.0/5999780 -461% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(4), flask_of_alchemical_chaos_crit
1:46.006Teye_of_tyr
[standard]
Fluffy_Pillow -26132112.8/5999780 -436% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_crit
1:47.287Pjudgment
[standard]
Fluffy_Pillow -26581583.6/5999780 -443% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_crit
1:48.567Jblessed_hammer
[standard]
Fluffy_Pillow -27032178.9/5999780 -451% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_crit
1:49.845Ravengers_shield
[standard]
Fluffy_Pillow -27031839.2/5999780 -451% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), egg_sac(4), flask_of_alchemical_chaos_crit
1:51.125Pjudgment
[standard]
Fluffy_Pillow -25899922.3/5999780 -432% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), spiderling, egg_sac(3), flask_of_alchemical_chaos_crit
1:51.328Ishield_of_the_righteous
[standard]
Fluffy_Pillow -25899922.3/5999780 -432% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(3), flask_of_alchemical_chaos_crit
1:52.610Jblessed_hammer
[standard]
Fluffy_Pillow -26584455.5/5999780 -443% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(3), flask_of_alchemical_chaos_crit
1:53.889Sconsecration
[standard]
Fluffy_Pillow -26584012.6/5999780 -443% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(3), flask_of_alchemical_chaos_crit
1:55.168Uholy_armaments
[standard]
Fluffy_Pillow -25692448.5/5999780 -428% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(4), flask_of_alchemical_chaos_crit
1:56.447Pjudgment
[standard]
Fluffy_Pillow -25691987.9/5999780 -428% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_crit
1:57.729Vblessed_hammer
[standard]
Fluffy_Pillow -25689728.9/5999780 -428% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_crit
1:57.729Ishield_of_the_righteous
[standard]
Fluffy_Pillow -25689728.9/5999780 -428% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_crit
1:59.010Wword_of_glory
[standard]
Bòfròst -25773888.3/5999780 -430% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_crit
2:00.291Pjudgment
[standard]
Fluffy_Pillow -22794789.8/5999780 -380% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_crit
2:01.572Jblessed_hammer
[standard]
Fluffy_Pillow -22793877.3/5999780 -380% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_crit
2:02.854Mdivine_toll
[standard]
Fluffy_Pillow -26244470.2/5999780 -437% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, fake_solidarity, egg_sac(6), flask_of_alchemical_chaos_crit
2:02.854Ishield_of_the_righteous
[standard]
Fluffy_Pillow -26244470.2/5999780 -437% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, egg_sac(6), flask_of_alchemical_chaos_crit
2:04.135Pjudgment
[standard]
Fluffy_Pillow -28654256.4/5999780 -478% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, blessed_assurance, fake_solidarity, egg_sac(6), flask_of_alchemical_chaos_crit
2:05.416Jblessed_hammer
[standard]
Fluffy_Pillow -27150855.2/5999780 -453% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, egg_sac(6), flask_of_alchemical_chaos_crit
2:06.697Ravengers_shield
[standard]
Fluffy_Pillow -29583817.2/5999780 -493% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, egg_sac(6), flask_of_alchemical_chaos_haste
2:07.915Pjudgment
[standard]
Fluffy_Pillow -29582965.8/5999780 -493% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, relentless_inquisitor(3), divine_resonance, holy_bulwark, holy_bulwark_absorb, fake_solidarity, egg_sac(6), flask_of_alchemical_chaos_haste
2:08.054Ishield_of_the_righteous
[standard]
Fluffy_Pillow -32621496.2/5999780 -544% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(3), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, egg_sac(6), flask_of_alchemical_chaos_haste
2:09.272Jblessed_hammer
[standard]
Fluffy_Pillow -33315837.3/5999780 -555% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, spiderling, egg_sac(5), flask_of_alchemical_chaos_haste
2:10.489Sconsecration
[standard]
Fluffy_Pillow -33843707.2/5999780 -564% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_haste
2:11.708Wword_of_glory
[standard]
Bòfròst -34463275.5/5999780 -574% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark, holy_bulwark_absorb, fake_solidarity, spiderling, egg_sac(5), flask_of_alchemical_chaos_haste
2:12.926Hjudgment
[standard]
Fluffy_Pillow -31890098.3/5999780 -532% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_haste
2:14.143Jblessed_hammer
[standard]
Fluffy_Pillow -34242982.5/5999780 -571% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, holy_bulwark, blessed_assurance, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_haste
2:14.143Ishield_of_the_righteous
[standard]
Fluffy_Pillow -34242982.5/5999780 -571% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, holy_bulwark, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_haste
2:15.361Pjudgment
[standard]
Fluffy_Pillow -33343994.0/5999780 -556% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, holy_bulwark_absorb, blessed_assurance, egg_sac(5), flask_of_alchemical_chaos_haste
2:16.580Ravengers_shield
[standard]
Fluffy_Pillow -35847990.1/5999780 -597% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, egg_sac(5), flask_of_alchemical_chaos_haste
2:17.799Jblessed_hammer
[standard]
Fluffy_Pillow -36413484.9/5999780 -607% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, egg_sac(5), flask_of_alchemical_chaos_haste
2:19.020Pjudgment
[standard]
Fluffy_Pillow -38307013.5/5999780 -638% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(6), flask_of_alchemical_chaos_haste
2:19.020Ishield_of_the_righteous
[standard]
Fluffy_Pillow -38307013.5/5999780 -638% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(6), flask_of_alchemical_chaos_haste
2:20.239Wword_of_glory
[standard]
Bòfròst -39428606.7/5999780 -657% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(6), flask_of_alchemical_chaos_haste
2:21.459Jblessed_hammer
[standard]
Fluffy_Pillow -38032126.7/5999780 -634% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(6), flask_of_alchemical_chaos_haste
2:22.678Hjudgment
[standard]
Fluffy_Pillow -40697339.7/5999780 -678% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(6), flask_of_alchemical_chaos_haste
2:23.611Gardent_defender
[defensives]
Fluffy_Pillow -41321086.7/5999780 -689% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(7), flask_of_alchemical_chaos_haste
2:23.898Pjudgment
[standard]
Fluffy_Pillow -41321086.7/5999780 -689% HP
2.0/5 40% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(7), flask_of_alchemical_chaos_haste
2:23.898Ishield_of_the_righteous
[standard]
Fluffy_Pillow -41321086.7/5999780 -689% HP
3.0/5 60% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(7), flask_of_alchemical_chaos_haste
2:25.116Jblessed_hammer
[standard]
Fluffy_Pillow -28523502.3/5999780 -475% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(7), flask_of_alchemical_chaos_haste
2:26.435Ravengers_shield
[standard]
Fluffy_Pillow -30687544.5/5999780 -511% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(8), flask_of_alchemical_chaos_haste
2:27.653Pjudgment
[standard]
Fluffy_Pillow -31347871.8/5999780 -522% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(8), flask_of_alchemical_chaos_haste
2:28.873Sconsecration
[standard]
Fluffy_Pillow -33475657.6/5999780 -558% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(8), flask_of_alchemical_chaos_haste
2:30.090Teye_of_tyr
[standard]
Fluffy_Pillow -35407682.8/5999780 -590% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(8), flask_of_alchemical_chaos_haste
2:31.309Pjudgment
[standard]
Fluffy_Pillow -35874789.9/5999780 -598% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(8), flask_of_alchemical_chaos_haste
2:31.309Ishield_of_the_righteous
[standard]
Fluffy_Pillow -35874789.9/5999780 -598% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(8), flask_of_alchemical_chaos_haste
2:32.424Ishield_of_the_righteous
[standard]
Fluffy_Pillow -35874120.5/5999780 -598% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, barricade_of_faith, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(8), flask_of_alchemical_chaos_haste
2:32.529Jblessed_hammer
[standard]
Fluffy_Pillow -35874120.5/5999780 -598% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(8), flask_of_alchemical_chaos_haste
2:33.746Kholy_armaments
[standard]
Fluffy_Pillow -36323384.5/5999780 -605% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(8), flask_of_alchemical_chaos_haste
2:34.966Eavenging_wrath
[cooldowns]
Fluffy_Pillow -36323223.6/5999780 -605% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac(8), flask_of_alchemical_chaos_haste
2:35.064Lhammer_of_wrath
[standard]
Fluffy_Pillow -35269109.0/5999780 -588% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(8), flask_of_alchemical_chaos_haste
2:36.283Njudgment
[standard]
Fluffy_Pillow -35265947.6/5999780 -588% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(9), flask_of_alchemical_chaos_haste
2:36.283Ishield_of_the_righteous
[standard]
Fluffy_Pillow -35265947.6/5999780 -588% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(9), flask_of_alchemical_chaos_haste
2:37.501Qblessed_hammer
[standard]
Fluffy_Pillow -35884266.7/5999780 -598% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), spiderling, egg_sac(8), flask_of_alchemical_chaos_haste
2:38.720Njudgment
[standard]
Fluffy_Pillow -35883416.4/5999780 -598% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:38.720Ishield_of_the_righteous
[standard]
Fluffy_Pillow -35883416.4/5999780 -598% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:39.937Qblessed_hammer
[standard]
Fluffy_Pillow -36481353.7/5999780 -608% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:41.155Lhammer_of_wrath
[standard]
Fluffy_Pillow -35582355.9/5999780 -593% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:41.155Ishield_of_the_righteous
[standard]
Fluffy_Pillow -35582355.9/5999780 -593% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:42.374Njudgment
[standard]
Fluffy_Pillow -35579783.9/5999780 -593% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:43.594Njudgment
[standard]
Fluffy_Pillow -36256437.3/5999780 -604% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:43.733Ishield_of_the_righteous
[standard]
Fluffy_Pillow -36256437.3/5999780 -604% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:44.952Qblessed_hammer
[standard]
Fluffy_Pillow -36250915.9/5999780 -604% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:46.171Njudgment
[standard]
Fluffy_Pillow -35428330.9/5999780 -590% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:46.171Ishield_of_the_righteous
[standard]
Fluffy_Pillow -35428330.9/5999780 -590% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:47.391Lhammer_of_wrath
[standard]
Fluffy_Pillow -36117469.2/5999780 -602% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:48.608Njudgment
[standard]
Fluffy_Pillow -36113246.6/5999780 -602% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:48.751Ishield_of_the_righteous
[standard]
Fluffy_Pillow -36113246.6/5999780 -602% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:49.970Qblessed_hammer
[standard]
Fluffy_Pillow -36788501.4/5999780 -613% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:51.188Ravengers_shield
[standard]
Fluffy_Pillow -35966077.3/5999780 -599% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:52.406Sconsecration
[standard]
Fluffy_Pillow -35965664.3/5999780 -599% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:53.625Lhammer_of_wrath
[standard]
Fluffy_Pillow -36514701.1/5999780 -609% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:53.625Ishield_of_the_righteous
[standard]
Fluffy_Pillow -36514701.1/5999780 -609% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity(2), egg_sac(8), flask_of_alchemical_chaos_haste
2:54.843Njudgment
[standard]
Fluffy_Pillow -36508899.9/5999780 -609% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(8), flask_of_alchemical_chaos_haste
2:56.062Qblessed_hammer
[standard]
Fluffy_Pillow -35626304.3/5999780 -594% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, spiderling, egg_sac(8), flask_of_alchemical_chaos_haste
2:56.062Ishield_of_the_righteous
[standard]
Fluffy_Pillow -35626304.3/5999780 -594% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, egg_sac(8), flask_of_alchemical_chaos_haste
2:57.279Njudgment
[standard]
Fluffy_Pillow -36227112.2/5999780 -604% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, spiderling, egg_sac(7), flask_of_alchemical_chaos_haste
2:58.500Qblessed_hammer
[standard]
Fluffy_Pillow -36223207.1/5999780 -604% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, egg_sac(7), flask_of_alchemical_chaos_haste
2:58.500Ishield_of_the_righteous
[standard]
Fluffy_Pillow -36223207.1/5999780 -604% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, egg_sac(7), flask_of_alchemical_chaos_haste
2:59.558Ishield_of_the_righteous
[standard]
Fluffy_Pillow -36823725.7/5999780 -614% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, egg_sac(7), flask_of_alchemical_chaos_haste
2:59.718Lhammer_of_wrath
[standard]
Fluffy_Pillow -36823725.7/5999780 -614% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, egg_sac(7), flask_of_alchemical_chaos_haste
3:00.936Njudgment
[standard]
Fluffy_Pillow -35321346.9/5999780 -589% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, egg_sac(7), flask_of_alchemical_chaos_haste
3:00.936Ishield_of_the_righteous
[standard]
Fluffy_Pillow -35321346.9/5999780 -589% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, egg_sac(7), flask_of_alchemical_chaos_haste
3:02.155Qblessed_hammer
[standard]
Fluffy_Pillow -40809125.4/5999780 -680% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, spiderling, egg_sac(7), flask_of_alchemical_chaos_haste
3:03.375Mdivine_toll
[standard]
Fluffy_Pillow -41417255.7/5999780 -690% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(7), flask_of_alchemical_chaos_haste
3:04.593Njudgment
[standard]
Fluffy_Pillow -43965522.3/5999780 -733% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, egg_sac(7), flask_of_alchemical_chaos_haste
3:04.787Ishield_of_the_righteous
[standard]
Fluffy_Pillow -43965522.3/5999780 -733% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, egg_sac(7), flask_of_alchemical_chaos_haste
3:06.007Lhammer_of_wrath
[standard]
Fluffy_Pillow -45681027.9/5999780 -761% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, egg_sac(7), flask_of_alchemical_chaos_vers
3:07.287Qblessed_hammer
[standard]
Fluffy_Pillow -46365270.5/5999780 -773% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, egg_sac(7), flask_of_alchemical_chaos_vers
3:07.287Ishield_of_the_righteous
[standard]
Fluffy_Pillow -46365270.5/5999780 -773% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, egg_sac(7), flask_of_alchemical_chaos_vers
3:08.568Jblessed_hammer
[standard]
Fluffy_Pillow -46362991.5/5999780 -773% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, egg_sac(7), flask_of_alchemical_chaos_vers
3:09.849Pjudgment
[standard]
Fluffy_Pillow -46361711.7/5999780 -773% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, egg_sac(7), flask_of_alchemical_chaos_vers
3:11.130Ravengers_shield
[standard]
Fluffy_Pillow -47584416.4/5999780 -793% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, egg_sac(7), flask_of_alchemical_chaos_vers
3:12.410Sconsecration
[standard]
Fluffy_Pillow -50517222.5/5999780 -842% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, egg_sac(6), flask_of_alchemical_chaos_vers
3:13.691Pjudgment
[standard]
Fluffy_Pillow -50516860.8/5999780 -842% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(3), shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, egg_sac(6), flask_of_alchemical_chaos_vers
3:13.691Ishield_of_the_righteous
[standard]
Fluffy_Pillow -50516860.8/5999780 -842% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(3), shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), divine_resonance, egg_sac(6), flask_of_alchemical_chaos_vers
3:13.691Gardent_defender
[defensives]
Fluffy_Pillow -50516860.8/5999780 -842% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, egg_sac(6), flask_of_alchemical_chaos_vers
3:14.972Jblessed_hammer
[standard]
Fluffy_Pillow -39081370.1/5999780 -651% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, egg_sac(6), flask_of_alchemical_chaos_vers
3:16.253Teye_of_tyr
[standard]
Fluffy_Pillow -40787479.0/5999780 -680% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, egg_sac(6), flask_of_alchemical_chaos_vers
3:17.534Pjudgment
[standard]
Fluffy_Pillow -40785951.1/5999780 -680% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, egg_sac(6), flask_of_alchemical_chaos_vers
3:18.816Vblessed_hammer
[standard]
Fluffy_Pillow -42655860.4/5999780 -711% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), egg_sac(5), flask_of_alchemical_chaos_vers
3:18.816Ishield_of_the_righteous
[standard]
Fluffy_Pillow -42655860.4/5999780 -711% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(5), flask_of_alchemical_chaos_vers
3:19.870Ishield_of_the_righteous
[standard]
Fluffy_Pillow -42654588.7/5999780 -711% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(5), flask_of_alchemical_chaos_vers
3:20.097Jblessed_hammer
[standard]
Fluffy_Pillow -42984376.4/5999780 -716% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(5), flask_of_alchemical_chaos_vers
3:20.930Ishield_of_the_righteous
[standard]
Fluffy_Pillow -42983054.9/5999780 -716% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(5), flask_of_alchemical_chaos_vers
3:21.376Pjudgment
[standard]
Fluffy_Pillow -42983054.9/5999780 -716% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(6), flask_of_alchemical_chaos_vers
3:22.877Jblessed_hammer
[standard]
Fluffy_Pillow -44881663.7/5999780 -748% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, spiderling, egg_sac(5), flask_of_alchemical_chaos_vers
3:22.877Ishield_of_the_righteous
[standard]
Fluffy_Pillow -44881663.7/5999780 -748% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(5), flask_of_alchemical_chaos_vers
3:24.159Ravengers_shield
[standard]
Fluffy_Pillow -47377032.0/5999780 -790% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(5), flask_of_alchemical_chaos_vers
3:25.439Uholy_armaments
[standard]
Fluffy_Pillow -45876190.4/5999780 -765% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, spiderling, egg_sac(4), flask_of_alchemical_chaos_vers
3:26.720Pjudgment
[standard]
Fluffy_Pillow -47366807.2/5999780 -789% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:27.999Jblessed_hammer
[standard]
Fluffy_Pillow -47365478.7/5999780 -789% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:29.282Sconsecration
[standard]
Fluffy_Pillow -50217292.2/5999780 -837% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:30.563Pjudgment
[standard]
Fluffy_Pillow -51228432.2/5999780 -854% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:30.563Ishield_of_the_righteous
[standard]
Fluffy_Pillow -51228432.2/5999780 -854% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:31.844Jblessed_hammer
[standard]
Fluffy_Pillow -51226702.7/5999780 -854% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:33.125Wword_of_glory
[standard]
Bòfròst -51693003.9/5999780 -862% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:34.406Pjudgment
[standard]
Fluffy_Pillow -50144024.9/5999780 -836% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_vers
3:35.685Jblessed_hammer
[standard]
Fluffy_Pillow -48642785.7/5999780 -811% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_vers
3:35.685Ishield_of_the_righteous
[standard]
Fluffy_Pillow -48642785.7/5999780 -811% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, fake_solidarity, egg_sac(5), flask_of_alchemical_chaos_vers
3:36.965Ravengers_shield
[standard]
Fluffy_Pillow -49108513.5/5999780 -819% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, spiderling, egg_sac(4), flask_of_alchemical_chaos_vers
3:38.246Pjudgment
[standard]
Fluffy_Pillow -49549574.1/5999780 -826% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:39.727Jblessed_hammer
[standard]
Fluffy_Pillow -49549086.0/5999780 -826% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:41.037Wword_of_glory
[standard]
Bòfròst -48514485.5/5999780 -809% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:42.317Xconsecration
[standard]
Fluffy_Pillow -46965436.9/5999780 -783% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:43.598Pjudgment
[standard]
Fluffy_Pillow -46964515.3/5999780 -783% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:43.598Ishield_of_the_righteous
[standard]
Fluffy_Pillow -46964515.3/5999780 -783% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), holy_bulwark, holy_bulwark_absorb, blessed_assurance, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:44.880Jblessed_hammer
[standard]
Fluffy_Pillow -47430741.2/5999780 -791% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), holy_bulwark, blessed_assurance, fake_solidarity, egg_sac(4), flask_of_alchemical_chaos_vers
3:46.159Wword_of_glory
[standard]
Bòfròst -46402277.3/5999780 -773% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac(4), flask_of_alchemical_chaos_vers
3:47.440Pjudgment
[standard]
Fluffy_Pillow -42335267.8/5999780 -706% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_vers
3:48.721Jblessed_hammer
[standard]
Fluffy_Pillow -42927867.1/5999780 -715% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_vers
3:48.721Ishield_of_the_righteous
[standard]
Fluffy_Pillow -42927867.1/5999780 -715% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(4), flask_of_alchemical_chaos_vers
3:50.002Pjudgment
[standard]
Fluffy_Pillow -41426107.4/5999780 -690% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_vers
3:51.284Ravengers_shield
[standard]
Fluffy_Pillow -42019075.4/5999780 -700% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_vers
3:52.565Jblessed_hammer
[standard]
Fluffy_Pillow -42567067.2/5999780 -709% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(4), flask_of_alchemical_chaos_vers
3:53.845Pjudgment
[standard]
Fluffy_Pillow -42566591.9/5999780 -709% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dusk, relentless_inquisitor(3), egg_sac(4), flask_of_alchemical_chaos_vers
3:53.845Ishield_of_the_righteous
[standard]
Fluffy_Pillow -42566591.9/5999780 -709% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac(4), flask_of_alchemical_chaos_vers
3:55.125Wword_of_glory
[standard]
Bòfròst -41657721.4/5999780 -694% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, spiderling, egg_sac(3), flask_of_alchemical_chaos_vers
3:56.407Eavenging_wrath
[cooldowns]
Fluffy_Pillow -40317746.1/5999780 -672% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), faith_in_the_light, barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, spiderling, egg_sac(3), flask_of_alchemical_chaos_vers
3:56.407Lhammer_of_wrath
[standard]
Fluffy_Pillow -40317746.1/5999780 -672% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), faith_in_the_light, barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, spiderling, egg_sac(3), flask_of_alchemical_chaos_vers
3:57.688Njudgment
[standard]
Fluffy_Pillow -40315358.1/5999780 -672% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), faith_in_the_light, barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
3:57.688Ishield_of_the_righteous
[standard]
Fluffy_Pillow -40315358.1/5999780 -672% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), faith_in_the_light, barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
3:58.970Qblessed_hammer
[standard]
Fluffy_Pillow -40991103.9/5999780 -683% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
4:00.250Sconsecration
[standard]
Fluffy_Pillow -40151530.2/5999780 -669% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_vers
4:01.529Njudgment
[standard]
Fluffy_Pillow -40151136.0/5999780 -669% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, spiderling, egg_sac(2), flask_of_alchemical_chaos_vers
4:01.529Ishield_of_the_righteous
[standard]
Fluffy_Pillow -40151136.0/5999780 -669% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_vers
4:02.809Lhammer_of_wrath
[standard]
Fluffy_Pillow -47219894.8/5999780 -787% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_vers
4:04.089Mdivine_toll
[standard]
Fluffy_Pillow -49716472.8/5999780 -829% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_vers
4:05.371Njudgment
[standard]
Fluffy_Pillow -48215113.0/5999780 -804% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_vers
4:05.371Ishield_of_the_righteous
[standard]
Fluffy_Pillow -48215113.0/5999780 -804% HP
4.0/5 80% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_vers
4:05.691Gardent_defender
[defensives]
Fluffy_Pillow -48215113.0/5999780 -804% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:06.651Qblessed_hammer
[standard]
Fluffy_Pillow -36206751.4/5999780 -603% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:07.927Ravengers_shield
[standard]
Fluffy_Pillow -36205864.5/5999780 -603% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:09.202Lhammer_of_wrath
[standard]
Fluffy_Pillow -38652436.2/5999780 -644% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:09.202Ishield_of_the_righteous
[standard]
Fluffy_Pillow -38652436.2/5999780 -644% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:10.477Njudgment
[standard]
Fluffy_Pillow -39563778.2/5999780 -659% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:11.751Qblessed_hammer
[standard]
Fluffy_Pillow -40172538.1/5999780 -670% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:11.751Ishield_of_the_righteous
[standard]
Fluffy_Pillow -40172538.1/5999780 -670% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:13.028Qblessed_hammer
[standard]
Fluffy_Pillow -40169698.6/5999780 -670% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:14.304Njudgment
[standard]
Fluffy_Pillow -43743777.4/5999780 -729% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:14.304Ishield_of_the_righteous
[standard]
Fluffy_Pillow -43743777.4/5999780 -729% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:15.312Ishield_of_the_righteous
[standard]
Fluffy_Pillow -42821280.1/5999780 -714% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:15.579Lhammer_of_wrath
[standard]
Fluffy_Pillow -42816193.8/5999780 -714% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, blessing_of_the_forge, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:16.854Kholy_armaments
[standard]
Fluffy_Pillow -45034647.8/5999780 -751% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, blessed_assurance, egg_sac(2), flask_of_alchemical_chaos_mastery
4:18.129Njudgment
[standard]
Fluffy_Pillow -47920967.9/5999780 -799% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_mastery
4:18.129Ishield_of_the_righteous
[standard]
Fluffy_Pillow -47920967.9/5999780 -799% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), divine_resonance, sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_mastery
4:19.405Qblessed_hammer
[standard]
Fluffy_Pillow -48615566.6/5999780 -810% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_mastery
4:20.680Ravengers_shield
[standard]
Fluffy_Pillow -50020775.3/5999780 -834% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac(3), flask_of_alchemical_chaos_mastery
4:21.955Lhammer_of_wrath
[standard]
Fluffy_Pillow -50663788.6/5999780 -844% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, spiderling, egg_sac(2), flask_of_alchemical_chaos_mastery
4:23.232Njudgment
[standard]
Fluffy_Pillow -53559743.9/5999780 -893% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:23.232Ishield_of_the_righteous
[standard]
Fluffy_Pillow -53559743.9/5999780 -893% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:24.245Ishield_of_the_righteous
[standard]
Fluffy_Pillow -55765934.7/5999780 -929% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:24.508Qblessed_hammer
[standard]
Fluffy_Pillow -55757921.2/5999780 -929% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:25.786Njudgment
[standard]
Fluffy_Pillow -54935486.4/5999780 -916% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:25.786Ishield_of_the_righteous
[standard]
Fluffy_Pillow -54935486.4/5999780 -916% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:26.816Ishield_of_the_righteous
[standard]
Fluffy_Pillow -57159427.7/5999780 -953% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:27.062Njudgment
[standard]
Fluffy_Pillow -57834256.6/5999780 -964% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:27.823Ishield_of_the_righteous
[standard]
Fluffy_Pillow -57834256.6/5999780 -964% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:28.397Lhammer_of_wrath
[standard]
Fluffy_Pillow -60027637.6/5999780 -1000% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:28.908Ishield_of_the_righteous
[standard]
Fluffy_Pillow -60027637.6/5999780 -1000% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:29.676Jblessed_hammer
[standard]
Fluffy_Pillow -60723028.8/5999780 -1012% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:30.953Ravengers_shield
[standard]
Fluffy_Pillow -62142476.2/5999780 -1036% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:32.228Pjudgment
[standard]
Fluffy_Pillow -62838826.5/5999780 -1047% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:32.228Ishield_of_the_righteous
[standard]
Fluffy_Pillow -62838826.5/5999780 -1047% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac(2), flask_of_alchemical_chaos_mastery
4:33.505Jblessed_hammer
[standard]
Fluffy_Pillow -63468921.0/5999780 -1058% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, blessed_assurance, fake_solidarity, spiderling, egg_sac, flask_of_alchemical_chaos_mastery
4:34.781Lhammer_of_wrath
[standard]
Fluffy_Pillow -63468410.3/5999780 -1058% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
4:36.057Pjudgment
[standard]
Fluffy_Pillow -62646182.9/5999780 -1044% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
4:36.057Ishield_of_the_righteous
[standard]
Fluffy_Pillow -62646182.9/5999780 -1044% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), sacred_weapon, fake_solidarity, egg_sac, flask_of_alchemical_chaos_mastery
4:37.333Jblessed_hammer
[standard]
Fluffy_Pillow -63330459.9/5999780 -1056% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac, flask_of_alchemical_chaos_mastery
4:38.607Pjudgment
[standard]
Fluffy_Pillow -63330214.6/5999780 -1056% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:39.882Ravengers_shield
[standard]
Fluffy_Pillow -64015299.6/5999780 -1067% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:41.158Lhammer_of_wrath
[standard]
Fluffy_Pillow -63159046.0/5999780 -1053% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:41.158Ishield_of_the_righteous
[standard]
Fluffy_Pillow -63159046.0/5999780 -1053% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:42.172Ishield_of_the_righteous
[standard]
Fluffy_Pillow -63159046.0/5999780 -1053% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac, flask_of_alchemical_chaos_mastery
4:42.434Jblessed_hammer
[standard]
Fluffy_Pillow -63156892.5/5999780 -1053% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, divine_purpose, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac, flask_of_alchemical_chaos_mastery
4:43.208Ishield_of_the_righteous
[standard]
Fluffy_Pillow -63842864.5/5999780 -1064% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, divine_purpose, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:43.711Jblessed_hammer
[standard]
Fluffy_Pillow -63841818.8/5999780 -1064% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac, flask_of_alchemical_chaos_mastery
4:44.986Hjudgment
[standard]
Fluffy_Pillow -63841506.9/5999780 -1064% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:44.986Ishield_of_the_righteous
[standard]
Fluffy_Pillow -63841506.9/5999780 -1064% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:46.263Jblessed_hammer
[standard]
Fluffy_Pillow -63026079.1/5999780 -1050% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac, flask_of_alchemical_chaos_mastery
4:47.537Lhammer_of_wrath
[standard]
Fluffy_Pillow -63711624.9/5999780 -1062% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:48.813Hjudgment
[standard]
Fluffy_Pillow -63710529.3/5999780 -1062% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:48.813Ishield_of_the_righteous
[standard]
Fluffy_Pillow -63710529.3/5999780 -1062% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:50.088Jblessed_hammer
[standard]
Fluffy_Pillow -62895107.0/5999780 -1048% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac, flask_of_alchemical_chaos_mastery
4:51.364Pjudgment
[standard]
Fluffy_Pillow -63580764.9/5999780 -1060% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:52.640Ravengers_shield
[standard]
Fluffy_Pillow -63579889.1/5999780 -1060% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:53.691Gardent_defender
[defensives]
Fluffy_Pillow -64223766.4/5999780 -1070% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:53.916Lhammer_of_wrath
[standard]
Fluffy_Pillow -64223766.4/5999780 -1070% HP
2.0/5 40% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:53.916Ishield_of_the_righteous
[standard]
Fluffy_Pillow -64223766.4/5999780 -1070% HP
3.0/5 60% HoPo
ardent_defender, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:55.191Jblessed_hammer
[standard]
Fluffy_Pillow -50722528.0/5999780 -845% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac, flask_of_alchemical_chaos_mastery
4:56.466Hjudgment
[standard]
Fluffy_Pillow -50721694.4/5999780 -845% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:57.742Pjudgment
[standard]
Fluffy_Pillow -51406594.1/5999780 -857% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:57.742Ishield_of_the_righteous
[standard]
Fluffy_Pillow -51406594.1/5999780 -857% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dawn, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), egg_sac, flask_of_alchemical_chaos_mastery
4:59.016Jblessed_hammer
[standard]
Fluffy_Pillow -51405023.3/5999780 -857% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, strength_in_adversity, blessing_of_dusk, faiths_armor, relentless_inquisitor(3), blessed_assurance, egg_sac(2), flask_of_alchemical_chaos_mastery

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength176470359603402915074 (14131)
Agility61760617661760
Stamina86452028300926953293057
Intellect17647018176176470
Spirit00000
Health566018053906400
Holy Power550
Spell Power18176488300
Crit9.82%10.25%872
Haste14.51%14.51%9574
Versatility11.01%8.38%6539
Mitigation Versatility5.50%4.19%6539
Attack Power47780406610
Mastery26.54%19.49%5242
Armor828677892152698
Run Speed700
Leech0.43%0.43%437
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry9.98%10.02%872
Tank-Block51.38%46.32%0
Tank-Crit-6.00%-6.00%0

Gear

Source Slot Average Item Level: 557.00
Local Head Earthforged Greathelm of the Harmonious (earthforged_greathelm)
ilevel: 561, stats: { 4,386 Armor, +8,479 Sta, +1,835 StrInt, +583 Mastery, +777 Vers }
Local Neck Spinner's Amulet of the Feverflare (spinners_amulet)
ilevel: 558, stats: { +4,705 Sta, +1,696 Haste, +1,428 Mastery }
Local Shoulders Earthforged Shoulder Scales of the Feverflare (earthforged_shoulder_scales)
ilevel: 564, stats: { 4,082 Armor, +6,447 Sta, +1,415 StrInt, +441 Haste, +588 Mastery }
Local Chest Earthforged Haubergeon of the Harmonious (earthforged_haubergeon)
ilevel: 564, stats: { 5,937 Armor, +8,595 Sta, +1,887 StrInt, +392 Mastery, +980 Vers }
Local Waist Charmbelt of Hidden Stars
ilevel: 616, stats: { 4,818 Armor, +13,251 Sta, +855 Crit, +505 Haste, +2,297 StrInt }
Local Legs Earthforged Faulds of the Aurora (earthforged_faulds)
ilevel: 558, stats: { 5,042 Armor, +8,364 Sta, +1,784 StrInt, +867 Haste, +482 Vers }
Local Feet Earthforged Sabatons of the Feverflare (earthforged_sabatons)
ilevel: 561, stats: { 3,655 Armor, +6,359 Sta, +1,376 StrInt, +437 Leech, +583 Haste, +437 Mastery }
Local Wrists Earthforged Cuffs of the Aurora (earthforged_cuffs)
ilevel: 564, stats: { 2,969 Armor, +4,835 Sta, +1,061 StrInt, +386 Haste, +386 Vers }
Local Hands Earthforged Handguards of the Aurora (earthforged_handguards)
ilevel: 564, stats: { 3,340 Armor, +6,447 Sta, +1,415 StrInt, +515 Haste, +515 Vers }
Local Finger1 Spinner's Hoop of the Aurora (spinners_hoop)
ilevel: 564, stats: { +4,835 Sta, +1,090 Haste, +2,089 Vers }
Local Finger2 Spinner's Circlet of the Feverflare (spinners_circlet)
ilevel: 561, stats: { +4,769 Sta, +1,441 Haste, +1,711 Mastery }
Local Trinket1 Xeri'tac's Unhatched Egg Sac
ilevel: 457, stats: { +2,540 Sta }
item effects: { equip: Xeri'tac's Defense }
Local Trinket2 Ara-Kara Sacbrood
ilevel: 535, stats: { +900 Haste }
item effects: { equip: Ara-Kara Sacbrood }
Local Back Spinner's Shawl of the Aurora (spinners_shawl)
ilevel: 564, stats: { 1,072 Armor, +4,835 Sta, +1,061 StrAgiInt, +276 Haste, +496 Vers }
Local Main Hand Deep-Dweller's Cudgel of the Aurora (deepdwellers_cudgel)
ilevel: 564, weapon: { 2,439 - 3,137, 2.6 }, stats: { +943 Agi, +4,298 Sta, +196 Haste, +490 Vers }
Local Off Hand Expeditionary Bulwark of the Aurora (expeditionary_bulwark)
ilevel: 564, stats: { 17,397 Armor, +943 Str, +2,893 Int, +4,298 Sta, +490 Haste, +196 Vers }

Talents

Talent Tables

Paladin Talents [31]
1
2
3
4
5
6
7
8
9
10
Protection Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

paladin="Bòfròst"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/b%C3%B2fr%C3%B2st"
spec=protection
level=80
race=human
role=tank
position=front
talents=CIEA5ba6OK14IUITjS1kSUVJctNjBzyYZegZMzMLbzMzYGjZMAAADAAAAAAAt1MzwgZYMjZrNAYMwAYgtBAAABYmZbbptZGLmBDAMMMG

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:algari_mana_oil_3,if=!(talent.rite_of_adjuration.enabled|talent.rite_of_sanctification.enabled)

head=earthforged_greathelm,id=224616,bonus_id=10288/6652/10876/1715/10844/1488
neck=spinners_amulet,id=224594,bonus_id=10289/6652/10395/10393/1766/10844/1485
shoulders=earthforged_shoulder_scales,id=224621,bonus_id=10287/6652/1701/10844/1491
back=spinners_shawl,id=224624,bonus_id=10287/6652/1709/10844/1491
chest=earthforged_haubergeon,id=224617,bonus_id=10287/6652/1717/10844/1491
wrists=earthforged_cuffs,id=224623,bonus_id=10287/6652/10877/1707/10844/1491
hands=earthforged_handguards,id=224619,bonus_id=10287/6652/1707/10844/1491
waist=charmbelt_of_hidden_stars,id=219152,bonus_id=10263/6652/10876/10377/3195/10255
legs=earthforged_faulds,id=224620,bonus_id=10289/6652/1705/10844/1485
feet=earthforged_sabatons,id=224618,bonus_id=10288/41/1699/10844/1488
finger1=spinners_hoop,id=224592,bonus_id=10287/6652/10395/10393/1775/10844/1491
finger2=spinners_circlet,id=224593,bonus_id=10288/6652/10395/10392/3404/10844/1488
trinket1=xeritacs_unhatched_egg_sac,id=110019,bonus_id=9561/9639/6652/9144/9836/8767
trinket2=arakara_sacbrood,id=219314,bonus_id=10385/10387/6652,drop_level=77
main_hand=deepdwellers_cudgel,id=224631,bonus_id=10287/6652/1710/10844/1491
off_hand=expeditionary_bulwark,id=224635,bonus_id=10287/6652/1704/10844/1491

# Gear Summary
# gear_ilvl=557.44
# gear_strength=15074
# gear_stamina=93057
# gear_crit_rating=855
# gear_haste_rating=9386
# gear_mastery_rating=5139
# gear_versatility_rating=6411
# gear_leech_rating=437
# gear_armor=52698

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 80291876
Max Event Queue: 127
Sim Seconds: 3006656
CPU Seconds: 62.2322
Physical Seconds: 10.8679
Speed Up: 48314

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Bòfròst Bòfròst ardent_defender 31850 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 51.99sec 0 299.98sec
Bòfròst Bòfròst augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Bòfròst Bòfròst avengers_shield 31935 1859400 6199 4.09 74704 159231 20.4 20.4 19.3% 0.0% 0.0% 0.0% 14.18sec 1859400 299.98sec
Bòfròst Bòfròst avenging_wrath 454351 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 82.35sec 0 299.98sec
Bòfròst Bòfròst blessed_hammer 204019 0 0 0.00 0 0 74.2 0.0 0.0% 0.0% 0.0% 0.0% 4.00sec 0 299.98sec
Bòfròst Bòfròst blessed_hammer_tick ticks -204301 8521489 28405 0.00 46267 101446 0.0 0.0 20.7% 0.0% 0.0% 0.0% 0.00sec 8521489 299.98sec
Bòfròst Bòfròst blessed_hammer_absorb 0 2215968 7387 24.86 17831 0 0.0 124.3 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Bòfròst Bòfròst bulwark_of_order_absorb 0 2310485 7702 7.89 58544 0 0.0 39.5 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Bòfròst Bòfròst consecration 26573 0 0 0.00 0 0 13.8 0.0 0.0% 0.0% 0.0% 0.0% 21.51sec 0 299.98sec
Bòfròst Bòfròst consecration_tick ticks -81297 1726533 5755 0.00 5956 12716 0.0 0.0 19.3% 0.0% 0.0% 0.0% 0.00sec 1726533 299.98sec
Bòfròst Bòfròst devotion_aura 465 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Bòfròst Bòfròst divine_toll 375576 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.09sec 0 299.98sec
Bòfròst Bòfròst avengers_shield_dt 31935 513736 1713 1.08 76342 161874 5.4 5.4 22.3% 0.0% 0.0% 0.0% 61.09sec 513736 299.98sec
Bòfròst Bòfròst avengers_shield_dr 31935 1487744 4960 3.13 76208 163174 15.7 15.7 21.6% 0.0% 0.0% 0.0% 18.47sec 1487744 299.98sec
Bòfròst Bòfròst eye_for_an_eye 469311 522136 1741 2.14 37783 79903 10.7 10.7 26.2% 0.0% 0.0% 0.0% 30.86sec 522136 299.98sec
Bòfròst Bòfròst eye_of_tyr 387174 1353061 4511 0.93 248179 522137 4.6 4.6 15.7% 0.0% 0.0% 0.0% 57.83sec 1353061 299.98sec
Bòfròst Bòfròst flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Bòfròst Bòfròst food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Bòfròst Bòfròst hammer_of_wrath 24275 8476045 28256 5.90 221012 456660 29.5 29.5 28.2% 0.0% 0.0% 0.0% 10.39sec 8476045 299.98sec
Bòfròst Bòfròst holy_armaments 432459 0 0 0.00 0 0 7.3 0.0 0.0% 0.0% 0.0% 0.0% 39.01sec 0 299.98sec
Bòfròst Bòfròst holy_bulwark 0 0 0 0.00 0 0 3.3 0.0 0.0% 0.0% 0.0% 0.0% 84.36sec 0 299.98sec
Bòfròst Bòfròst holy_bulwark_absorb 0 7125287 23753 6.90 206668 0 0.0 34.5 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Bòfròst Bòfròst holy_shield 157122 585362 1951 8.32 11309 24164 41.6 41.6 21.5% 0.0% 0.0% 0.0% 7.00sec 585362 299.98sec
Bòfròst Bòfròst judgment 275779 19132040 63779 17.15 179581 382600 85.8 85.8 21.4% 0.0% 0.0% 0.0% 3.53sec 19132040 299.98sec
Bòfròst Bòfròst hammer_and_anvil 433717 3807067 12691 3.68 160008 334038 18.4 18.4 27.0% 0.0% 0.0% 0.0% 16.09sec 3807067 299.98sec
Bòfròst Bòfròst leech 143924 432071 1440 49.60 1742 0 248.0 248.0 0.0% 0.0% 0.0% 0.0% 1.21sec 443248 299.98sec
Bòfròst Bòfròst melee 0 5035960 16788 34.93 23287 49631 174.6 174.6 21.1% 0.0% 0.0% 0.0% 2.06sec 7194222 299.98sec
Bòfròst Bòfròst potion 431932 0 0 0.00 0 0 1.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Bòfròst Bòfròst refining_fire ticks -469882 7244229 24147 45.55 25675 54772 41.5 227.7 21.1% 0.0% 0.0% 0.0% 7.21sec 7244229 299.98sec
Bòfròst Bòfròst rite_of_sanctification 433568 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
Bòfròst Bòfròst sacred_weapon 0 0 0 0.00 0 0 8.2 0.0 0.0% 0.0% 0.0% 0.0% 40.19sec 0 299.98sec
Bòfròst Bòfròst sacred_weapon_proc_damage 432616 13317750 44396 5.81 351651 726070 29.0 29.0 28.6% 0.0% 0.0% 0.0% 9.75sec 13317750 299.98sec
Bòfròst Bòfròst sacred_weapon_proc_heal 441590 72063 240 0.02 473882 1057907 0.1 0.1 17.9% 0.0% 0.0% 0.0% 65.46sec 72063 299.98sec
Bòfròst Bòfròst shield_of_the_righteous 53600 10853661 36182 18.63 93471 190436 93.2 93.2 23.8% 0.0% 0.0% 0.0% 3.23sec 10853661 299.98sec
Bòfròst Bòfròst forges_reckoning 447258 6852767 22844 6.86 150527 301567 34.3 34.3 32.6% 0.0% 0.0% 0.0% 8.28sec 6852767 299.98sec
Bòfròst Bòfròst spiderfling 452227 0 0 0.00 0 0 11.0 0.0 0.0% 0.0% 0.0% 0.0% 19.84sec 0 299.98sec
Bòfròst Bòfròst spidersting ticks -452229 353607 1179 18.87 3135 6275 11.0 94.4 19.5% 0.0% 0.0% 0.0% 19.85sec 353607 299.98sec
Bòfròst Bòfròst word_of_glory 85673 16241447 54143 1.34 2153594 4349840 6.7 6.7 12.3% 0.0% 0.0% 0.0% 25.42sec 16242057 299.98sec
Bòfròst Bòfròst sacred_word 447246 34614 115 0.04 121401 242257 0.2 0.2 31.6% 0.0% 0.0% 0.0% 106.70sec 34614 299.98sec

Fluffy_Pillow : 828,084 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
828,084.4828,084.40.0 / 0.000%0.0 / 0.0%2.8
Resource Out In Waiting APM Active
Health297,421.10.046.46%3.4100.0%

Scale Factors for other metrics

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Fluffy_Pillow828,084
melee_main_hand_Bòfròst 497,83860.1%77.53.75s1,927,327963,667Direct77.52,207,99801,927,3900.0%12.7%49.6%

Stats Details: Melee Main Hand Bòfròst

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage77.4977.490.000.000.002.00000.0000149,356,769.18541,168,150.0372.40%963,666.67963,666.67
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit37.66%29.199502,604,024.3003,334,3332,603,705.302,137,2422,886,05776,002,339233,495,37767.45%
hit (blocked)49.63%38.4619601,907,414.1802,524,2121,907,092.221,580,1942,109,07773,354,430307,672,77376.16%
parry12.71%9.850250.00000.0000000.00%

Action Details: Melee Main Hand Bòfròst

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7840000.00
  • base_dd_max:8160000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
melee_nuke_Bòfròst 59,7717.2%5.559.56s3,269,5111,631,188Direct5.53,269,39103,269,3910.0%0.0%57.4%

Stats Details: Melee Nuke Bòfròst

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.475.470.000.000.002.00450.000017,869,666.3165,586,243.7972.75%1,631,188.161,631,188.16
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit42.57%2.33063,830,331.9704,903,4783,630,576.9304,861,7188,913,01127,924,20664.64%
hit (blocked)57.43%3.14062,853,580.3103,626,8362,823,904.2503,610,4618,956,65537,662,03875.40%

Action Details: Melee Nuke Bòfròst

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11760000.00
  • base_dd_max:12240000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Action Priority List

    default
    [2]:5.50
spell_dot_Bòfròst 270,47632.7%5.361.01s15,201,58415,134,231Periodic144.8560,6800560,6800.0%0.0%0.0%96.5%

Stats Details: Spell Dot Bòfròst

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.340.00144.79144.790.001.00452.000081,180,014.02115,832,143.2129.92%275,238.7415,134,230.80
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%144.79115174560,680.220725,816560,511.89519,851600,03581,180,014115,832,14329.94%

Action Details: Spell Dot Bòfròst

  • id:0
  • school:physical
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_cast_speed
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:800000.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:60.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Action Priority List

    default
    [3]:5.36
Simple Action Stats Execute Interval
Fluffy_Pillow
pause_action 4.560.01s

Stats Details: Pause Action

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.500.000.000.000.0030.00450.00000.000.000.00%0.000.00

Action Details: Pause Action

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:30.00
  • base_crit:0.00
  • target:Bòfròst
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [4]:5.00
  • if_expr:time>=30
    default
    [4]:5.00
  • if_expr:time>=30
tank_heal 60.55.00s

Stats Details: Tank Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal60.500.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Tank Heal

  • id:0
  • school:holy
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1500000.00
  • base_dd_max:1500000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blessed Hammer124.623.12.4s2.0s0.9s38.69%57.28%23.1 (23.1)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_blessed_hammer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 11.6s
  • trigger_min/max:0.0s / 11.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s
  • uptime_min/max:32.33% / 45.79%

Stack Uptimes

  • blessed_hammer_1:38.69%

Spelldata

  • id:204301
  • name:Blessed Hammer
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Eye of Tyr4.60.057.8s57.8s6.0s9.25%8.93%0.0 (0.0)4.6

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_eye_of_tyr
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:25.0s / 141.9s
  • trigger_min/max:40.2s / 141.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:4.75% / 14.35%

Stack Uptimes

  • eye_of_tyr_1:9.25%

Spelldata

  • id:387174
  • name:Eye of Tyr
  • tooltip:Dealing {$s1=25}% less damage to the Paladin.
  • description:Releases a blinding flash from your shield, causing {$s2=0} Holy damage to all nearby enemies within {$=}A1 yds and reducing all damage they deal to you by {$s1=25}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment85.70.06.2s3.5s4.0s76.68%81.59%0.0 (0.0)0.0

Buff Details

  • buff initial source:Bòfròst
  • cooldown name:buff_judgment
  • max_stacks:20
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 34.7s
  • trigger_min/max:0.9s / 8.1s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 31.5s
  • uptime_min/max:60.70% / 88.07%

Stack Uptimes

  • judgment_1:54.57%
  • judgment_2:19.62%
  • judgment_3:2.42%
  • judgment_4:0.07%
  • judgment_5:0.00%

Spelldata

  • id:197277
  • name:Judgment
  • tooltip:Taking {$=}w1% increased damage from {$@=}auracaster's next Holy Power ability.
  • description:{$@spelldesc20271=Judges the target, dealing {$s1=0} {$?s403664=false}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]}
  • max_stacks:20
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
delayed_aa_cast5.04.06.060.0s60.0s60.0s

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 299.98
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 828084.36
Minimum 707077.31
Maximum 956103.17
Spread ( max - min ) 249025.87
Range [ ( max - min ) / 2 * 100% ] 15.04%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 828084.36
Minimum 707077.31
Maximum 956103.17
Spread ( max - min ) 249025.87
Range [ ( max - min ) / 2 * 100% ] 15.04%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 248406449.50
Minimum 170517348.82
Maximum 313680582.82
Spread ( max - min ) 143163234.00
Range [ ( max - min ) / 2 * 100% ] 28.82%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 305816.81
Minimum 264514.94
Maximum 355273.71
Spread ( max - min ) 90758.77
Range [ ( max - min ) / 2 * 100% ] 14.84%
Standard Deviation 12458.3222
5th Percentile 286112.04
95th Percentile 326887.82
( 95th Percentile - 5th Percentile ) 40775.79
Mean Distribution
Standard Deviation 124.5895
95.00% Confidence Interval ( 305572.62 - 306061.00 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6376
0.1 Scale Factor Error with Delta=300 1324961
0.05 Scale Factor Error with Delta=300 5299841
0.01 Scale Factor Error with Delta=300 132496006
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=8000000,range=160000,attack_speed=2,aoe_tanks=1
2 5.50 melee_nuke,damage=12000000,range=240000,attack_speed=2,cooldown=30,aoe_tanks=1
3 5.36 spell_dot,damage=800000,range=16000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
4 5.00 pause_action,duration=30,cooldown=30,if=time>=30

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health0730553050
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=8000000,range=160000,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=12000000,range=240000,attack_speed=2,cooldown=30,aoe_tanks=1
actions+=/spell_dot,damage=800000,range=16000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
actions+=/pause_action,duration=30,cooldown=30,if=time>=30


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.