SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.5.57171 Live (hotfix 2024-10-22/57171, git build 798d7fc4fd)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Acýs : 660,898 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
660,898.1660,898.1722.6 / 0.109%145,839.9 / 22.1%15,195.7
Resource Out In Waiting APM Active
Energy42.942.80.69%80.5100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/ac%C3%BDs
TalentCQQA27SZpS4XnmFfcXRqkppuwDAMwwYmZwMzwMMMzMzMjZmplZMLzAAAAAAgttxM8AzMjFmZZ2GAAAAzMDwAbwMGNmFAbTYxMA
Scale Factors for Acýs Damage Per Second
Wdps Agi Vers Crit Haste Mastery
Scale Factors 66.82 14.25 6.93 6.67 6.37 4.20
Normalized 4.69 1.00 0.49 0.47 0.45 0.29
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.50 0.45 0.45 0.45 0.43 0.44
Ranking
  • Wdps > Agi > Vers ~= Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, Agility=14.25, CritRating=6.67, HasteRating=6.37, MasteryRating=4.20, Versatility=6.93, Dps=66.82 )

Scale Factors for other metrics

Scale Factors for Acýs Priority Target Damage Per Second
Wdps Agi Vers Crit Haste Mastery
Scale Factors 66.82 14.25 6.93 6.67 6.37 4.20
Normalized 4.69 1.00 0.49 0.47 0.45 0.29
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.50 0.45 0.45 0.45 0.43 0.44
Ranking
  • Wdps > Agi > Vers ~= Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, Agility=14.25, CritRating=6.67, HasteRating=6.37, MasteryRating=4.20, Versatility=6.93, Dps=66.82 )
Scale Factors for Acýs Damage Per Second (Effective)
Wdps Agi Vers Crit Haste Mastery
Scale Factors 66.82 14.25 6.93 6.67 6.37 4.20
Normalized 4.69 1.00 0.49 0.47 0.45 0.29
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, Agility=14.25, CritRating=6.67, HasteRating=6.37, MasteryRating=4.20, Versatility=6.93, Dps=66.82 )
Scale Factors for Acýs Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, )
Scale Factors for Acýs Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, )
Scale Factors for Acýs Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, )
Scale Factors for Acýs Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, )
Scale Factors for Acýs Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, )
Scale Factors for Acýs Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, )
Scale Factors for Acýs Fight Length
Haste Mastery Crit Agi Wdps Vers
Scale Factors -0.00 -0.00 -0.00 -0.00 -0.00 -0.00
Normalized 1.07 1.03 1.00 1.00 0.05 0.01
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Haste > Mastery > Crit > Agi > Wdps > Vers
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, Agility=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=0.00, Versatility=0.00, Dps=0.00 )
Scale Factors for Raid Damage Per Second
Wdps Agi Vers Crit Haste Mastery
Scale Factors 66.82 14.25 6.93 6.67 6.37 4.20
Normalized 4.69 1.00 0.49 0.47 0.45 0.29
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.50 0.45 0.45 0.45 0.43 0.44
Ranking
  • Wdps > Agi > Vers ~= Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Acýs-Outlaw": Class=Rogue, Spec=Outlaw, Agility=14.25, CritRating=6.67, HasteRating=6.37, MasteryRating=4.20, Versatility=6.93, Dps=66.82 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Acýs660,898
Ambush 50,124 (77,201)7.6% (11.7%)81.83.71s282,952345,325Direct81.8 (125.9)117,368246,048183,66951.5% (51.6%)0.0%

Stats Details: Ambush

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage81.8281.820.000.000.000.81940.000015,028,110.2421,468,707.4430.00%345,325.06345,325.06
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit48.47%39.661569117,368.2184,577203,669117,362.63104,432130,7454,654,9616,649,93730.00%
crit51.53%42.161768246,048.20177,613407,338246,063.45220,145272,85710,373,15014,818,77030.00%

Action Details: Ambush

  • id:8676
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:50
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing {$s1=0} Physical damage.{$?s383281=true}[ Has a {$193315s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;{$?s383281=true}[ each time it strikes][].|r

Action Priority List

    build
    [F]:37.45
  • if_expr:talent.hidden_opportunity&buff.audacity.up
    stealth
    [U]:44.37
  • if_expr:talent.hidden_opportunity

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT10.0%
    Ambush (_hidden_opportunity) 14,6502.2%0.00.00s00Direct23.9117,359246,345184,00751.7%0.0%

Stats Details: Ambush Hidden Opportunity

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0023.860.000.000.000.00000.00004,390,693.436,272,412.9230.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit48.32%11.53126117,359.3284,577189,209117,383.1797,229153,5711,353,2071,933,15130.00%
crit51.68%12.33228246,345.22177,613418,529246,309.93203,673296,9163,037,4874,339,26230.00%

Action Details: Ambush Hidden Opportunity

  • id:385897
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:385897
  • name:Ambush
  • school:physical
  • tooltip:
  • description:{$@spelldesc8676=Ambush the target, causing {$s1=0} Physical damage.{$?s383281=true}[ Has a {$193315s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;{$?s383281=true}[ each time it strikes][].|r}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT10.0%
    Ambush (_hidden_opportunity_audacity) 12,4271.9%0.00.00s00Direct20.2117,824247,199184,62451.6%0.0%

Stats Details: Ambush Hidden Opportunity Audacity

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0020.220.000.000.000.00000.00003,732,478.855,332,107.3130.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit48.37%9.78026117,824.4484,577199,300117,757.850141,7561,152,3151,646,16329.99%
crit51.63%10.44128247,198.50177,613396,108247,124.61201,138303,2852,580,1643,685,94530.00%

Action Details: Ambush Hidden Opportunity Audacity

  • id:8676
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:50
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing {$s1=0} Physical damage.{$?s383281=true}[ Has a {$193315s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=2} combo {$=}lpoint:points;{$?s383281=true}[ each time it strikes][].|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT10.0%
Auto Attack 0 (61,632)0.0% (9.3%)19.116.57s967,8980

Stats Details: Auto Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.090.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Auto Attack

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
    Auto Attack (Main Hand) 41,5456.3%381.00.92s32,69336,885Direct381.026,68353,36632,69239.0%16.4%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage380.96380.960.000.000.000.88630.000012,454,596.0117,792,262.2230.00%36,884.9136,884.91
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit44.59%169.8710823426,683.3021,54243,08326,679.2725,08628,5524,532,7496,475,35030.00%
crit38.97%148.449521153,366.3043,67784,11553,360.9149,96957,4277,921,84711,316,91330.00%
miss16.44%62.64291030.00000.0000000.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Auto Attack (Off Hand) 20,0863.0%549.70.63s10,95517,664Direct549.78,93317,86410,95539.0%16.4%

Stats Details: Auto Attack Oh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage549.73549.730.000.000.000.62020.00006,022,103.218,602,995.9830.00%17,663.6517,663.65
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit44.56%244.951613348,932.627,12814,4268,931.418,3469,4822,188,0733,125,81630.00%
crit39.04%214.6213729517,863.9914,45628,50817,861.5416,79018,9603,834,0305,477,18030.00%
miss16.40%90.15501340.00000.0000000.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Between the Eyes 137,932 (168,133)20.8% (25.4%)92.33.24s545,649676,422Direct92.3 (169.1)144,830579,146447,66869.7% (59.3%)0.0%

Stats Details: Between The Eyes

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage92.3392.330.000.000.000.80670.000041,331,241.6359,044,571.8530.00%676,421.57676,421.57
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit30.28%27.95262144,829.5486,994247,384144,740.26124,029166,3034,048,3565,783,35930.00%
crit69.72%64.3830107579,146.05347,9751,033,205578,876.76522,144644,06137,282,88653,261,21230.00%

Action Details: Between The Eyes

  • id:315341
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315341
  • name:Between the Eyes
  • school:physical
  • tooltip:{$=}w2% increased critical strike chance.
  • description:Finishing move that deals damage with your pistol, increasing your critical strike chance by {$s2=20}%.{$?a235484=true}[ Critical strikes with this ability deal four times normal damage.][] 1 point : {$=}{{$=}<damage>*1} damage, 3 sec 2 points: {$=}{{$=}<damage>*2} damage, 6 sec 3 points: {$=}{{$=}<damage>*3} damage, 9 sec 4 points: {$=}{{$=}<damage>*4} damage, 12 sec 5 points: {$=}{{$=}<damage>*5} damage, 15 sec{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$=}<damage>*6} damage, 18 sec][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$=}<damage>*7} damage, 21 sec][]

Action Priority List

    finish
    [P]:15.47
  • if_expr:talent.crackshot&(cooldown.vanish.remains>45|talent.underhanded_upper_hand&talent.without_a_trace&(buff.adrenaline_rush.remains>12|buff.adrenaline_rush.down&cooldown.adrenaline_rush.remains>45))&(raid_event.adds.remains>8|raid_event.adds.in<raid_event.adds.remains|!raid_event.adds.up)
    stealth
    [R]:76.85
  • if_expr:variable.finish_condition&talent.crackshot&(!buff.shadowmeld.up|stealthed.rogue)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Critical Bonus MultiplierImproved Between the Eyes2354841PCT200.0%
Spell Direct AmountDevious Stratagem3943214PCT5.0%
Spell RangePrecision Shot4283771ADD10.000
    Dispatch (_crackshot) 30,2014.6%0.00.00s00Direct76.880,299160,554117,82146.8%0.0%

Stats Details: Dispatch Crackshot

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0076.790.000.000.000.00000.00009,047,284.0512,924,678.5730.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit53.25%40.89177380,299.4048,488137,02980,250.4665,89989,9593,283,1564,690,21830.00%
crit46.75%35.901164160,554.4896,976277,764160,456.35140,285183,9185,764,1288,234,46030.00%

Action Details: Dispatch Crackshot

  • id:2098
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:2098
  • name:Dispatch
  • school:physical
  • tooltip:
  • description:Finishing move that dispatches the enemy, dealing damage per combo point: 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountDevious Stratagem3943214PCT5.0%
Dispatch 64,7299.8%82.43.39s235,969279,027Direct82.4161,162322,106235,97146.5%0.0%

Stats Details: Dispatch

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage82.3982.390.000.000.000.84570.000019,441,773.9727,773,935.0430.00%279,027.14279,027.14
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit53.52%44.102276161,161.7696,976265,745161,103.72142,291179,2497,106,42910,152,03130.00%
crit46.48%38.301765322,105.99193,953561,653322,057.70284,681356,35812,335,34517,621,90430.00%

Action Details: Dispatch

  • id:2098
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:2098
  • name:Dispatch
  • school:physical
  • tooltip:
  • description:Finishing move that dispatches the enemy, dealing damage per combo point: 1 point : {$=}{{$m1=0}*1} damage 2 points: {$=}{{$m1=0}*2} damage 3 points: {$=}{{$m1=0}*3} damage 4 points: {$=}{{$m1=0}*4} damage 5 points: {$=}{{$m1=0}*5} damage{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$m1=0}*6} damage][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$m1=0}*7} damage][]

Action Priority List

    finish
    [Q]:79.74
    stealth
    [S]:2.65
  • if_expr:variable.finish_condition

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Spell Direct AmountDeeper Stratagem1935314PCT5.0%
Spell Direct AmountDevious Stratagem3943214PCT5.0%
Fate Intertwined 22,0073.3%74.24.01s89,0170Direct74.289,018089,0180.0%0.0%

Stats Details: Fate Intertwined

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage74.2074.200.000.000.000.00000.00006,604,785.596,604,785.590.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%74.203711589,017.7239,582199,34489,005.6175,256103,2706,604,7866,604,7860.00%

Action Details: Fate Intertwined

  • id:456306
  • school:cosmic
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:110495.67
  • base_dd_max:110495.67
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:456306
  • name:Fate Intertwined
  • school:cosmic
  • tooltip:
  • description:{$@spelldesc454429=Fate Intertwined duplicates {$s1=30}% of {$?a137037=false}[Envenom][Dispatch] critical strike damage as Cosmic to {$s2=2} additional nearby enemies. If there are no additional nearby targets, duplicate {$s1=30}% to the primary target instead.}
Ghostly Strike 11,0611.7%18.616.66s178,3390Direct18.6114,857241,126178,32950.3%0.0%

Stats Details: Ghostly Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage18.6018.6072.6272.620.880.00002.99993,317,772.5623,263,465.9485.74%15,228.290.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit49.73%9.25018114,857.4698,245189,297114,817.300129,5321,062,5231,517,88830.00%
crit50.27%9.35119241,126.41206,315359,577241,097.14218,835272,3972,255,2503,221,78230.00%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%72.62451000.00000.0000018,523,796100.00%

Action Details: Ghostly Strike

  • id:196937
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:35
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.96
  • base_multiplier:1.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196937
  • name:Ghostly Strike
  • school:physical
  • tooltip:Taking {$s3=15}% increased damage from the Rogue's abilities.
  • description:Strikes an enemy, dealing {$s1=0} Physical damage and causing the target to take {$s3=15}% increased damage from your abilities for {$d=12 seconds}. |cFFFFFFFFAwards {$s2=1} combo {$=}lpoint:points;.|r

Action Priority List

    cds
    [M]:18.60
  • if_expr:combo_points<cp_max_spend

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT10.0%
Hand of Fate 0 (108,364)0.0% (16.4%)0.00.00s00

Stats Details: Hand Of Fate

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Hand Of Fate

  • id:452536
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:452536
  • name:Hand of Fate
  • school:physical
  • tooltip:
  • description:Flip a Fatebound Coin each time a finishing move consumes {$s1=5} or more combo points. Heads increases the damage of your attacks by {$=}{{$456479s1=8}+{$452923s1=2}}%, lasting {$452923d=15 seconds} or until you flip Tails. Tails deals {$452538s1=0} Cosmic damage to your target. For each time the same face is flipped in a row, Heads increases damage by an additional {$452923s1=2}% and Tails increases its damage by {$452917s1=10}%.
    Fatebound Coin (Tails) 102,24515.5%100.73.26s304,5670Direct100.7208,062415,485304,56846.5%0.0%

Stats Details: Fatebound Coin Tails

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage100.71100.710.000.000.000.00000.000030,671,655.6830,671,655.680.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit53.47%53.852289208,062.16149,766629,441207,687.97178,935279,59511,204,71611,204,7160.00%
crit46.53%46.851883415,484.69299,5321,246,496414,732.81364,478522,14319,466,94019,466,9400.00%

Action Details: Fatebound Coin Tails

  • id:452538
  • school:cosmic
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:452538
  • name:Fatebound Coin (Tails)
  • school:cosmic
  • tooltip:
  • description:{$@spelldesc452536=Flip a Fatebound Coin each time a finishing move consumes {$s1=5} or more combo points. Heads increases the damage of your attacks by {$=}{{$456479s1=8}+{$452923s1=2}}%, lasting {$452923d=15 seconds} or until you flip Tails. Tails deals {$452538s1=0} Cosmic damage to your target. For each time the same face is flipped in a row, Heads increases damage by an additional {$452923s1=2}% and Tails increases its damage by {$452917s1=10}%.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
    Lucky Coin 6,1200.9%4.443.95s416,0380Direct4.4284,735568,713415,98646.2%0.0%

Stats Details: Lucky Coin

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.434.430.000.000.000.00000.00001,841,733.831,841,733.830.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit53.76%2.3809284,735.24225,589347,534260,832.950346,995677,631677,6310.00%
crit46.24%2.0509568,712.57451,178695,069497,739.580695,0691,164,1031,164,1030.00%

Action Details: Lucky Coin

  • id:461818
  • school:cosmic
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:461818
  • name:Lucky Coin
  • school:cosmic
  • tooltip:
  • description:{$@spelldesc452536=Flip a Fatebound Coin each time a finishing move consumes {$s1=5} or more combo points. Heads increases the damage of your attacks by {$=}{{$456479s1=8}+{$452923s1=2}}%, lasting {$452923d=15 seconds} or until you flip Tails. Tails deals {$452538s1=0} Cosmic damage to your target. For each time the same face is flipped in a row, Heads increases damage by an additional {$452923s1=2}% and Tails increases its damage by {$452917s1=10}%.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Instant Poison 16,3312.5%0.00.00s00Direct592.35,63711,2668,26846.7%0.0%

Stats Details: Instant Poison

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00592.340.000.000.000.00000.00004,897,210.524,897,210.520.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit53.26%315.501794335,637.074,3859,1835,636.135,2056,0051,778,4751,778,4750.00%
crit46.74%276.8416939311,265.558,77118,36611,264.3010,47612,0443,118,7353,118,7350.00%

Action Details: Instant Poison

  • id:315585
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315585
  • name:Instant Poison
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$t1=0} seconds.
  • description:{$@spelldesc315584=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=30}% chance of poisoning the enemy which instantly inflicts {$315585s1=0} Nature damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Main Gauche 44,2546.7%0.00.00s00Direct202.944,51489,23165,44046.8%0.0%

Stats Details: Main Gauche

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00202.910.000.000.000.00000.000013,278,750.7218,969,624.9230.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit53.20%107.965916544,513.9432,30884,17544,483.0840,81248,7874,805,6986,865,27630.00%
crit46.80%94.954815489,231.4464,616168,35089,165.4280,30396,3718,473,05312,104,34930.00%

Action Details: Main Gauche

  • id:86392
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:{$@spelldesc76806=Your main-hand attacks have a {$h=30}% chance to trigger an attack with your off-hand that deals {$86392s1=0} Physical damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Pistol Shot 21,486 (64,424)3.3% (9.8%)53.45.47s362,016435,446Direct53.4 (160.2)76,939161,399120,74151.9% (51.9%)0.0%

Stats Details: Pistol Shot

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage53.4253.420.000.000.000.83140.00006,450,287.659,214,687.4430.00%435,445.52435,445.52
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit48.14%25.7294476,938.5355,179127,04876,921.9166,87986,0751,978,5712,826,52730.00%
crit51.86%27.711049161,399.07115,876275,809161,385.84142,194179,0744,471,7176,388,16030.00%

Action Details: Pistol Shot

  • id:185763
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Spelldata

  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=30}%{$?a428377=true}[ and dealing {$s4=5}% less damage to the Rogue.][.]
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} Physical damage{$?a428377=true}[, also reducing movement speed by {$s3=30}% and reducing the target's damage done to you by {$s4=5}% for {$d=6 seconds}.][ and reducing movement speed by {$s3=30}% for {$d=6 seconds}.] |cFFFFFFFFAwards {$s2=1} combo {$=}lpoint:points;.|r

Action Priority List

    build
    [G]:49.59
  • if_expr:talent.fan_the_hammer&talent.audacity&talent.hidden_opportunity&buff.opportunity.up&!buff.audacity.up
    build
    [H]:0.00
  • if_expr:talent.fan_the_hammer&buff.opportunity.up&(buff.opportunity.stack>=buff.opportunity.max_stack|buff.opportunity.remains<2)
    build
    [I]:0.47
  • if_expr:talent.fan_the_hammer&buff.opportunity.up&(combo_points.deficit>=(1+(talent.quick_draw+buff.broadside.up)*(talent.fan_the_hammer.rank+1))|combo_points<=talent.ruthlessness)
    stealth
    [T]:3.36
  • if_expr:talent.crackshot&talent.fan_the_hammer.rank>=2&buff.opportunity.stack>=6&(buff.broadside.up&combo_points<=1|buff.greenskins_wickers.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT10.0%
Spell RangePrecision Shot4283771ADD10.000
    Pistol Shot (_fan_the_hammer) 42,9396.5%0.00.00s00Direct106.876,869161,242120,70252.0%0.0%

Stats Details: Pistol Shot Fan The Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.00106.790.000.000.000.00000.000012,889,589.5918,413,681.0030.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit48.05%51.31218576,868.7027,865128,09576,850.2667,12184,6903,943,8555,634,07430.00%
crit51.95%55.482790161,241.5755,304275,809161,222.83141,982180,7958,945,73412,779,60730.00%

Action Details: Pistol Shot Fan The Hammer

  • id:185763
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=30}%{$?a428377=true}[ and dealing {$s4=5}% less damage to the Rogue.][.]
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} Physical damage{$?a428377=true}[, also reducing movement speed by {$s3=30}% and reducing the target's damage done to you by {$s4=5}% for {$d=6 seconds}.][ and reducing movement speed by {$s3=30}% for {$d=6 seconds}.] |cFFFFFFFFAwards {$s2=1} combo {$=}lpoint:points;.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT10.0%
Spell RangePrecision Shot4283771ADD10.000
Sigil of Algari Concordance 0 (8,367)0.0% (1.3%)3.173.51s803,7500

Stats Details: Sigil Of Algari Concordance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.120.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sigil Of Algari Concordance

  • id:443378
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:443378
  • name:Sigil of Algari Concordance
  • school:physical
  • tooltip:Your abilities have a chance to call an earthen ally to your aid, supporting you in combat.
  • description:Your abilities have a chance to call an earthen ally to your aid, supporting you in combat.
    Thunder Bolt 40,232 / 6,1430.9%12.214.69s150,5470Direct12.2108,365216,786150,60639.0%0.0%

Stats Details: Thunder Bolt Silvervein

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage12.2512.240.000.000.000.00000.00001,843,912.061,843,912.060.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.04%7.47026108,365.01106,931113,688107,850.760113,247809,819809,8190.00%
crit38.96%4.77019216,785.55213,861227,376211,925.920227,0231,034,0931,034,0930.00%

Action Details: Thunder Bolt Silvervein

  • id:452335
  • school:nature
  • range:100.0
  • travel_speed:60.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:91436.77
  • base_dd_max:91436.77
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:452335
  • name:Thunder Bolt
  • school:nature
  • tooltip:
  • description:{$@spelldesc443378=Your abilities have a chance to call an earthen ally to your aid, supporting you in combat.}
    Thundering Bolt 14,703 / 2,2240.3%3.173.24s214,9120Direct3.1154,874309,818214,98538.8%0.0%

Stats Details: Thundering Bolt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.103.100.000.000.000.00000.0000667,253.42667,253.420.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit61.20%1.9008154,874.03152,757162,410139,229.930162,410294,158294,1580.00%
crit38.80%1.2006309,818.11305,513324,819226,555.700324,819373,096373,0960.00%

Action Details: Thundering Bolt

  • id:452445
  • school:nature
  • range:100.0
  • travel_speed:40.0000
  • radius:40.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:130623.21
  • base_dd_max:130623.21
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:452445
  • name:Thundering Bolt
  • school:nature
  • tooltip:
  • description:{$@spelldesc443378=Your abilities have a chance to call an earthen ally to your aid, supporting you in combat.}
Sinister Strike 9,717 (14,416)1.5% (2.2%)36.67.26s118,112139,073Direct36.6 (54.3)50,962106,81379,60051.3% (51.3%)0.0%

Stats Details: Sinister Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage36.6536.650.000.000.000.84930.00002,917,323.754,167,601.1930.00%139,072.62139,072.62
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit48.72%17.8624250,962.4237,21489,61451,007.1343,42161,799909,9801,299,97130.00%
crit51.28%18.79243106,813.3278,150174,857106,944.5691,858129,6672,007,3432,867,63130.00%

Action Details: Sinister Strike

  • id:193315
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:45
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:193315
  • name:Sinister Strike
  • school:physical
  • tooltip:
  • description:Viciously strike an enemy, causing {$=}{{$s1=0}*{$=}<mult>} Physical damage.{$?s279876=true}[ Has a {$s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=1} combo {$=}lpoint:points; each time it strikes.|r

Action Priority List

    build
    [J]:36.65

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT10.0%
    Sinister Strike (_extra_attack) 4,7000.7%0.00.00s00Direct17.750,984106,84579,75051.5%0.0%

Stats Details: Sinister Strike Extra Attack

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0017.700.000.000.000.00000.00001,411,311.562,016,157.3530.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit48.51%8.5802150,983.7637,21482,14250,992.20062,839437,656625,22230.00%
crit51.49%9.11023106,845.3078,150183,600106,897.530130,174973,6561,390,93530.00%

Action Details: Sinister Strike Extra Attack

  • id:197834
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197834
  • name:Sinister Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc193315=Viciously strike an enemy, causing {$=}{{$s1=0}*{$=}<mult>} Physical damage.{$?s279876=true}[ Has a {$s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=1} combo {$=}lpoint:points; each time it strikes.|r}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountOutlaw Rogue1370361PCT-4.0%
Spell Periodic AmountOutlaw Rogue1370362PCT-4.0%
Spell Critical ChanceDeadly Precision3815421ADD0.050
Spell Critical Bonus MultiplierLethality3822382PCT10.0%
Simple Action Stats Execute Interval
Acýs
Adrenaline Rush 9.533.69s

Stats Details: Adrenaline Rush

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.450.00192.390.000.000.00000.95090.000.000.00%0.000.00

Action Details: Adrenaline Rush

  • id:13750
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Acýs
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$=}w1%. Maximum Energy increased by {$=}w4. Attack speed increased by {$=}w2%. {$?=}{$=}w5>0[Damage increased by {$=}w5%.][]
  • description:Increases your Energy regeneration rate by {$s1=50}%, your maximum Energy by {$s4=50}, and your attack speed by {$s2=20}% for {$d=20 seconds}.

Action Priority List

    cds
    [K]:8.45
  • if_expr:!buff.adrenaline_rush.up&(!variable.finish_condition|!talent.improved_adrenaline_rush)|stealthed.all&talent.crackshot&talent.improved_adrenaline_rush&combo_points<=2
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Acýs
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Flask of Tempered Versatility 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:431973
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Acýs
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Acýs
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.50.00s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.500.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cds
    [O]:1.50
  • if_expr:buff.bloodlust.react|fight_remains<30|buff.adrenaline_rush.up
Roll the Bones 10.231.75s

Stats Details: Roll The Bones

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.160.000.000.000.000.74260.00000.000.000.00%0.000.00

Action Details: Roll The Bones

  • id:315508
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Acýs
  • aoe:0
  • harmful:false

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315508
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Roll the dice of fate, providing a random combat enhancement for {$d=30 seconds}.

Action Priority List

    cds
    [L]:9.15
  • if_expr:variable.rtb_reroll|rtb_buffs=0
Shadowmeld 2.7126.56s

Stats Details: Shadowmeld

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.720.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Shadowmeld

  • id:58984
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.

Action Priority List

    stealth_cds
    [W]:2.72
  • if_expr:variable.finish_condition&!cooldown.vanish.ready
Slice and Dice 1.00.00s

Stats Details: Slice And Dice

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Slice And Dice

  • id:315496
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Acýs
  • aoe:0
  • harmful:false

Resources

  • resource:energy
  • base_cost:25
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:315496
  • name:Slice and Dice
  • school:physical
  • tooltip:Attack speed increased by {$=}w1%.
  • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
Stealth 1.00.00s

Stats Details: Stealth

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Stealth

  • id:1784
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:2.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Acýs
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1784
  • name:Stealth
  • school:physical
  • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
Vanish 15.419.66s

Stats Details: Vanish

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.370.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vanish

  • id:1856
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Acýs
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:combo_points
  • energize_amount:0.0

Spelldata

  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Action Priority List

    stealth_cds
    [V]:15.37
  • if_expr:talent.underhanded_upper_hand&talent.subterfuge&(buff.adrenaline_rush.up|!talent.without_a_trace&talent.crackshot)&(variable.finish_condition|!talent.crackshot&(variable.ambush_condition|!talent.hidden_opportunity))

Affected By (Passive)

Type Spell ID # +/% Value
Modify Cooldown Charge (Category)Without a Trace3825131SET1.000

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance (Haste)7.02.339.5s29.1s10.4s24.37%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Acýs
  • cooldown name:buff_Ascendance_Haste
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:145.00

Trigger Details

  • interval_min/max:16.0s / 248.0s
  • trigger_min/max:8.0s / 248.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 72.0s
  • uptime_min/max:2.67% / 56.45%

Stack Uptimes

  • Ascendance_Haste_1:0.68%
  • Ascendance_Haste_2:0.69%
  • Ascendance_Haste_3:0.67%
  • Ascendance_Haste_4:0.68%
  • Ascendance_Haste_5:0.67%
  • Ascendance_Haste_6:0.71%
  • Ascendance_Haste_7:0.68%
  • Ascendance_Haste_8:0.66%
  • Ascendance_Haste_9:0.66%
  • Ascendance_Haste_10:18.28%

Spelldata

  • id:458503
  • name:Ascendance
  • tooltip:Haste increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Ascendance (Vers)7.02.239.6s29.1s10.4s24.35%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Acýs
  • cooldown name:buff_Ascendance_Vers
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:145.00

Trigger Details

  • interval_min/max:16.0s / 296.0s
  • trigger_min/max:8.0s / 296.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 72.0s
  • uptime_min/max:4.60% / 54.27%

Stack Uptimes

  • Ascendance_Vers_1:0.69%
  • Ascendance_Vers_2:0.67%
  • Ascendance_Vers_3:0.68%
  • Ascendance_Vers_4:0.66%
  • Ascendance_Vers_5:0.66%
  • Ascendance_Vers_6:0.68%
  • Ascendance_Vers_7:0.66%
  • Ascendance_Vers_8:0.68%
  • Ascendance_Vers_9:0.68%
  • Ascendance_Vers_10:18.29%

Spelldata

  • id:458524
  • name:Ascendance
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Ascension (Crit)7.02.339.5s29.0s10.4s24.29%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Acýs
  • cooldown name:buff_Ascension_Crit
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:145.00

Trigger Details

  • interval_min/max:16.0s / 248.0s
  • trigger_min/max:8.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 80.0s
  • uptime_min/max:0.00% / 52.40%

Stack Uptimes

  • Ascension_Crit_1:0.66%
  • Ascension_Crit_2:0.66%
  • Ascension_Crit_3:0.67%
  • Ascension_Crit_4:0.66%
  • Ascension_Crit_5:0.68%
  • Ascension_Crit_6:0.66%
  • Ascension_Crit_7:0.68%
  • Ascension_Crit_8:0.69%
  • Ascension_Crit_9:0.68%
  • Ascension_Crit_10:18.25%

Spelldata

  • id:458502
  • name:Ascension
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Ascension (Mastery)7.02.239.7s29.2s10.4s24.29%0.00%1.7 (1.7)0.0

Buff Details

  • buff initial source:Acýs
  • cooldown name:buff_Ascension_Mastery
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:145.00

Trigger Details

  • interval_min/max:16.0s / 272.0s
  • trigger_min/max:8.0s / 264.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.0s
  • uptime_min/max:0.00% / 50.87%

Stack Uptimes

  • Ascension_Mastery_1:0.68%
  • Ascension_Mastery_2:0.68%
  • Ascension_Mastery_3:0.69%
  • Ascension_Mastery_4:0.70%
  • Ascension_Mastery_5:0.69%
  • Ascension_Mastery_6:0.66%
  • Ascension_Mastery_7:0.69%
  • Ascension_Mastery_8:0.67%
  • Ascension_Mastery_9:0.68%
  • Ascension_Mastery_10:18.15%

Spelldata

  • id:458525
  • name:Ascension
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc453572=Taking damage has the chance to grant {$@=}spellname453572 granting {$s2=151892} Versatility for {$457592d=15 seconds}. Moving within 3 yards of a friendly party member grants them a portion of {$@=}spellname453572, sharing the effect for the remaining duration.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Acrobatic Strikes1.0776.9176.9s0.4s295.4s99.98%100.00%767.7 (767.7)0.0

Buff Details

  • buff initial source:Acýs
  • cooldown name:buff_acrobatic_strikes
  • max_stacks:10
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Damage Modifiers

  • direct:1.00 + 0.00/stack
  • periodic:1.00 + 0.00/stack
  • auto_attack:1.00 + 0.01/stack
  • crit_chance:1.00
  • is_stacking:true

Trigger Details

  • interval_min/max:47.6s / 343.2s
  • trigger_min/max:0.0s / 4.4s
  • trigger_pct:100.00%
  • duration_min/max:2.1s / 360.0s
  • uptime_min/max:99.43% / 100.00%

Stack Uptimes

  • acrobatic_strikes_1:0.08%
  • acrobatic_strikes_2:0.10%
  • acrobatic_strikes_3:0.08%
  • acrobatic_strikes_4:0.09%
  • acrobatic_strikes_5:0.09%
  • acrobatic_strikes_6:0.09%
  • acrobatic_strikes_7:0.09%
  • acrobatic_strikes_8:0.09%
  • acrobatic_strikes_9:0.09%
  • acrobatic_strikes_10:99.18%

Spelldata

  • id:455144
  • name:Acrobatic Strikes
  • tooltip:Auto-attack damage and movement speed increased by {$=}{{$=}W}.1%.
  • description:{$@spelldesc455143=Auto-attacks increase auto-attack damage and movement speed by {$=}{{$s1=10}/10}.1% for {$455144d=3 seconds}, stacking up to {$=}{{$s1=10}/10*{$455144u=10}}%.}
  • max_stacks:10
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Adrenaline Rush9.50.033.4s33.6s28.1s88.71%91.28%259.9 (259.9)6.3

Buff Details

  • buff initial source:Acýs
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:17.7s / 80.7s
  • trigger_min/max:18.5s / 80.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.1s
  • uptime_min/max:67.94% / 99.34%

Stack Uptimes

  • adrenaline_rush_1:88.71%

Spelldata

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$=}w1%. Maximum Energy increased by {$=}w4. Attack speed increased by {$=}w2%. {$?=}{$=}w5>0[Damage increased by {$=}w5%.][]
  • description:Increases your Energy regeneration rate by {$s1=50}%, your maximum Energy by {$s4=50}, and your attack speed by {$s2=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity1.0162.5182.8s1.8s285.9s99.85%0.00%158.3 (158.3)0.0

Buff Details

  • buff initial source:Acýs
  • cooldown name:buff_alacrity
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste
  • amount:1.00%

Trigger Details

  • interval_min/max:23.1s / 359.5s
  • trigger_min/max:0.3s / 31.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 360.0s
  • uptime_min/max:93.89% / 100.00%

Stack Uptimes

  • alacrity_1:0.42%
  • alacrity_2:0.41%
  • alacrity_3:0.45%
  • alacrity_4:0.42%
  • alacrity_5:98.14%

Spelldata

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=1}% for {$d=15 seconds}.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Audacity46.740.16.2s3.3s1.9s29.31%0.00%40.1 (40.1)0.0

Buff Details

  • buff initial source:Acýs
  • cooldown name:buff_audacity
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.2s / 49.5s
  • trigger_min/max:0.1s / 49.5s
  • trigger_pct:54.16%
  • duration_min/max:0.0s / 9.9s
  • uptime_min/max:18.56% / 39.76%

Stack Uptimes

  • audacity_1:29.31%

Spelldata

  • id:386270
  • name:Audacity
  • tooltip:Ambush is usable without Stealth.
  • description:{$@spelldesc111240=Exploits the vulnerability of foes with less than {$s4=35}% health, dealing {$s2=0} Physical damage to the target. Mutilate has a {$s5=25}% chance to make your next Blindside free and usable on any target, regardless of their health. |cFFFFFFFFAwards {$s3=1} combo {$=}lpoint:points;.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Between the Eyes1.590.8157.1s3.2s195.6s99.22%0.00%90.8 (90.8)0.0

Buff Details

  • buff initial source:Acýs
  • cooldown name:buff_between_the_eyes
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:max
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

    Trigger Details

    • interval_min/max:15.1s / 351.7s
    • trigger_min/max:0.8s / 42.5s
    • trigger_pct:100.00%
    • duration_min/max:0.0s / 359.2s
    • uptime_min/max:89.78% / 99.78%

    Stack Uptimes

    • between_the_eyes_1:99.22%

    Spelldata

    • id:315341
    • name:Between the Eyes
    • tooltip:{$=}w2% increased critical strike chance.
    • description:Finishing move that deals damage with your pistol, increasing your critical strike chance by {$s2=20}%.{$?a235484=true}[ Critical strikes with this ability deal four times normal damage.][] 1 point : {$=}{{$=}<damage>*1} damage, 3 sec 2 points: {$=}{{$=}<damage>*2} damage, 6 sec 3 points: {$=}{{$=}<damage>*3} damage, 9 sec 4 points: {$=}{{$=}<damage>*4} damage, 12 sec 5 points: {$=}{{$=}<damage>*5} damage, 15 sec{$?s193531=true}|((s394320|s394321)&!s193531)[ 6 points: {$=}{{$=}<damage>*6} damage, 18 sec][]{$?s193531=true}&(s394320|s394321)[ 7 points: {$=}{{$=}<damage>*7} damage, 21 sec][]
    • max_stacks:0
    • duration:0.00
    • cooldown:45.00
    • default_chance:0.00%
    Bloodlust1.00.00.0s0.0s40.0s13.51%0.00%0.0 (0.0)1.0

    Buff Details

    • buff initial source:Acýs
    • cooldown name:buff_bloodlust
    • max_stacks:1
    • base duration:40.00
    • duration modifier:1.00
    • base cooldown:300.00
    • default_chance:100.00%
    • default_value:0.30
    • activated:true
    • reactable:true
    • reverse:false
    • refresh behavior:duration
    • stack behavior:default
    • tick behavior:none
    • tick_time behavior:unhasted
    • period:0.00

    Trigger Details

    • interval_min/max:0.0s / 0.0s
    • trigger_min/max:0.0s / 0.0s
    • trigger_pct:100.00%
    • duration_min/max:40.0s / 40.0s
    • uptime_min/max:11.11% / 16.67%

    Stack Uptimes

    • bloodlust_1:13.51%

    Spelldata

    • id:2825
    • name:Bloodlust
    • tooltip:Haste increased by {$=}w1%.
    • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
    • max_stacks:0
    • duration:40.00
    • cooldown:300.00
    • default_chance:0.00%
    Broadside12.70.022.9s22.8s12.4s52.64%50.68%0.0 (0.0)0.0

    Buff Details

    • buff initial source:Acýs
    • cooldown name:buff_broadside
    • max_stacks:1
    • base duration:0.00
    • duration modifier:1.00
    • base cooldown:0.00
    • default_chance:100.00%
    • default_value:1.00
    • activated:true
    • reactable:false
    • reverse:false
    • refresh behavior:duration
    • stack behavior:default
    • tick behavior:none
    • tick_time behavior:unhasted
    • period:0.00

    Damage Modifiers

    • direct:1.15
    • periodic:1.15
    • auto_attack:1.00
    • crit_chance:1.00
    • is_stacking:false

    Trigger Details

    • interval_min/max:0.2s / 181.2s
    • trigger_min/max:0.2s / 181.2s
    • trigger_pct:100.00%
    • duration_min/max:0.0s / 39.0s
    • uptime_min/max:13.02% / 98.50%

    Stack Uptimes

    • broadside_1:52.64%

    Spelldata

    • id:193356
    • name:Broadside
    • tooltip:Your combo-point generating abilities generate {$s1=1} additional combo point and deal {$s4=15}% increased damage.
    • description:Your combo-point generating abilities generate {$s1=1} additional combo point and deal {$s4=15}% increased damage for the duration of Roll the Bones.
    • max_stacks:0
    • duration:-0.00
    • cooldown:0.00
    • default_chance:0.00%
    Buried Treasure12.50.023.3s23.2s12.5s52.03%51.73%0.0 (0.0)0.0

    Buff Details

    • buff initial source:Acýs
    • cooldown name:buff_buried_treasure
    • max_stacks:1
    • base duration:0.00
    • duration modifier:1.00
    • base cooldown:0.00
    • default_chance:100.00%
    • default_value:5.00
    • activated:true
    • reactable:false
    • reverse:false
    • refresh behavior:duration
    • stack behavior:default
    • tick behavior:none
    • tick_time behavior:unhasted
    • period:0.00

    Trigger Details

    • interval_min/max:0.2s / 182.9s
    • trigger_min/max:0.2s / 182.9s
    • trigger_pct:100.00%
    • duration_min/max:0.0s / 39.0s
    • uptime_min/max:12.02% / 95.07%

    Stack Uptimes

    • buried_treasure_1:52.03%

    Spelldata

    • id:199600
    • name:Buried Treasure
    • tooltip:Increases Energy regeneration by {$=}{{$s1=25}/5} per sec.
    • description:Your base Energy regeneration is increased by {$=}{{$s1=25}/5} per sec for the duration of Roll the Bones.
    • max_stacks:0
    • duration:-0.00
    • cooldown:0.00
    • default_chance:0.00%
    Double Jeopardy16.40.018.8s19.6s0.3s0.02%0.00%0.0 (0.0)0.0

    Buff Details

    • buff initial source:Acýs
    • cooldown name:buff_double_jeopardy
    • max_stacks:1
    • base duration:0.00
    • duration modifier:1.00
    • base cooldown:0.00
    • default_chance:100.00%
    • default_value:-0.00
    • activated:true
    • reactable:false
    • reverse:false
    • refresh behavior:duration
    • stack behavior:default
    • tick behavior:none
    • tick_time behavior:unhasted
    • period:0.00

    Trigger Details

    • interval_min/max:6.1s / 95.6s
    • trigger_min/max:6.1s / 95.6s
    • trigger_pct:100.00%
    • duration_min/max:0.0s / 1.8s
    • uptime_min/max:0.00% / 0.75%

    Stack Uptimes

    • double_jeopardy_1:0.02%

    Spelldata

    • id:454430
    • name:Double Jeopardy
    • tooltip:
    • description:Your first Fatebound Coin flip after breaking Stealth flips two coins that are guaranteed to match the same outcome.
    • max_stacks:0
    • duration:0.00
    • cooldown:0.00
    • default_chance:0.00%
    Edge Case9.50.033.4s33.6s0.7s0.18%0.00%0.0 (0.0)0.0

    Buff Details

    • buff initial source:Acýs
    • cooldown name:buff_edge_case
    • max_stacks:1
    • base duration:0.00
    • duration modifier:1.00
    • base cooldown:0.00
    • default_chance:100.00%
    • default_value:-0.00
    • activated:true
    • reactable:false
    • reverse:false
    • refresh behavior:duration
    • stack behavior:default
    • tick behavior:none
    • tick_time behavior:unhasted
    • period:0.00

    Trigger Details

    • interval_min/max:17.7s / 80.7s
    • trigger_min/max:18.5s / 80.7s
    • trigger_pct:100.00%
    • duration_min/max:0.0s / 1.4s
    • uptime_min/max:0.00% / 1.85%

    Stack Uptimes

    • edge_case_1:0.18%

    Spelldata

    • id:453457
    • name:Edge Case
    • tooltip:
    • description:Activating {$?a137036=true}[Adrenaline Rush][Deathmark] flips a Fatebound Coin and causes it to land on its edge, counting as both Heads and Tails.
    • max_stacks:0
    • duration:0.00
    • cooldown:0.00
    • default_chance:0.00%
    Fatebound Coin (Heads)36.066.48.4s0.0s4.4s52.28%100.00%0.0 (0.0)0.0

    Buff Details

    • buff initial source:Acýs
    • cooldown name:buff_fatebound_coin_heads
    • max_stacks:99
    • base duration:15.00
    • duration modifier:1.00
    • base cooldown:0.00
    • default_chance:101.00%
    • default_value:-0.00
    • activated:true
    • reactable:false
    • reverse:false
    • refresh behavior:duration
    • stack behavior:default
    • tick behavior:none
    • tick_time behavior:unhasted
    • period:0.00

    Damage Modifiers

    • direct:1.06 + 0.02/stack
    • periodic:1.06 + 0.02/stack
    • auto_attack:1.06 + 0.02/stack
    • crit_chance:1.00
    • is_stacking:true

    Stack Uptimes

    • fatebound_coin_heads_1:17.13%
    • fatebound_coin_heads_2:12.23%
    • fatebound_coin_heads_3:8.09%
    • fatebound_coin_heads_4:5.29%
    • fatebound_coin_heads_5:3.41%
    • fatebound_coin_heads_6:2.18%
    • fatebound_coin_heads_7:1.40%
    • fatebound_coin_heads_8:0.92%
    • fatebound_coin_heads_9:0.59%
    • fatebound_coin_heads_10:0.38%
    • fatebound_coin_heads_11:0.24%
    • fatebound_coin_heads_12:0.15%
    • fatebound_coin_heads_13:0.09%
    • fatebound_coin_heads_14:0.06%
    • fatebound_coin_heads_15:0.04%
    • fatebound_coin_heads_16:0.03%
    • fatebound_coin_heads_17:0.02%
    • fatebound_coin_heads_18:0.01%
    • fatebound_coin_heads_19:0.01%
    • fatebound_coin_heads_20:0.01%
    • fatebound_coin_heads_21:0.00%
    • fatebound_coin_heads_22:0.00%
    • fatebound_coin_heads_23:0.00%
    • fatebound_coin_heads_24:0.00%
    • fatebound_coin_heads_25:0.00%
    • fatebound_coin_heads_26:0.00%
    • fatebound_coin_heads_27:0.00%
    • fatebound_coin_heads_28:0.00%
    • fatebound_coin_heads_29:0.00%
    • fatebound_coin_heads_30:0.00%
    • fatebound_coin_heads_31:0.00%

    Spelldata

    • id:452923
    • name:Fatebound Coin (Heads)
    • tooltip:Damage increased by {$=}{{$=}W1+$456479s~1}%.{$?a454300=false}[ Leech increased by {$=}{{$=}W3}.1%.][]
    • description:{$@spelldesc452536=Flip a Fatebound Coin each time a finishing move consumes {$s1=5} or more combo points. Heads increases the damage of your attacks by {$=}{{$456479s1=8}+{$452923s1=2}}%, lasting {$452923d=15 seconds} or until you flip Tails. Tails deals {$452538s1=0} Cosmic damage to your target. For each time the same face is flipped in a row, Heads increases damage by an additional {$452923s1=2}% and Tails increases its damage by {$452917s1=10}%.}
    • max_stacks:99
    • duration:15.00
    • cooldown:0.00
    • default_chance:101.00%
    Fatebound Coin (Tails)36.066.78.4s0.0s4.4s52.39%0.00%0.0 (0.0)0.0

    Buff Details

    • buff initial source:Acýs
    • cooldown name:buff_fatebound_coin_tails
    • max_stacks:99
    • base duration:15.00
    • duration modifier:1.00
    • base cooldown:0.00
    • default_chance:101.00%
    • default_value:-0.00
    • activated:true
    • reactable:false
    • reverse:false
    • refresh behavior:duration
    • stack behavior:default
    • tick behavior:none
    • tick_time behavior:unhasted
    • period:0.00

    Stack Uptimes

    • fatebound_coin_tails_1:17.13%
    • fatebound_coin_tails_2:12.24%
    • fatebound_coin_tails_3:8.11%
    • fatebound_coin_tails_4:5.28%
    • fatebound_coin_tails_5:3.43%
    • fatebound_coin_tails_6:2.18%
    • fatebound_coin_tails_7:1.40%
    • fatebound_coin_tails_8:0.93%
    • fatebound_coin_tails_9:0.60%
    • fatebound_coin_tails_10:0.39%
    • fatebound_coin_tails_11:0.25%
    • fatebound_coin_tails_12:0.16%
    • fatebound_coin_tails_13:0.10%
    • fatebound_coin_tails_14:0.06%
    • fatebound_coin_tails_15:0.04%
    • fatebound_coin_tails_16:0.03%
    • fatebound_coin_tails_17:0.02%
    • fatebound_coin_tails_18:0.01%
    • fatebound_coin_tails_19:0.01%
    • fatebound_coin_tails_20:0.01%
    • fatebound_coin_tails_21:0.01%
    • fatebound_coin_tails_22:0.00%
    • fatebound_coin_tails_23:0.00%
    • fatebound_coin_tails_24:0.00%
    • fatebound_coin_tails_25:0.01%
    • fatebound_coin_tails_26:0.00%
    • fatebound_coin_tails_27:0.00%

    Spelldata

    • id:452917
    • name:Fatebound Coin (Tails)
    • tooltip:Fatebound Coin damage increased by {$=}w1%.{$?a454300=false}[ Leech increased by {$=}{{$=}W2}.1%.][]
    • description:{$@spelldesc452536=Flip a Fatebound Coin each time a finishing move consumes {$s1=5} or more combo points. Heads increases the damage of your attacks by {$=}{{$456479s1=8}+{$452923s1=2}}%, lasting {$452923d=15 seconds} or until you flip Tails. Tails deals {$452538s1=0} Cosmic damage to your target. For each time the same face is flipped in a row, Heads increases damage by an additional {$452923s1=2}% and Tails increases its damage by {$452917s1=10}%.}
    • max_stacks:99
    • duration:15.00
    • cooldown:0.00
    • default_chance:101.00%
    (fatebound_) Lucky Coin1.00.00.0s0.0s248.1s82.30%0.00%0.0 (0.0)0.0

    Buff Details

    • buff initial source:Acýs
    • cooldown name:buff_fatebound_lucky_coin
    • max_stacks:1
    • base duration:0.00
    • duration modifier:1.00
    • base cooldown:0.00
    • default_chance:100.00%
    • default_value:0.07
    • activated:true
    • reactable:false
    • reverse:false
    • refresh behavior:duration
    • stack behavior:default
    • tick behavior:none
    • tick_time behavior:unhasted
    • period:0.00

    Stat Details

      Trigger Details

      • interval_min/max:0.0s / 0.0s
      • trigger_min/max:0.0s / 0.0s
      • trigger_pct:100.00%
      • duration_min/max:5.4s / 353.4s
      • uptime_min/max:0.00% / 98.83%

      Stack Uptimes

      • fatebound_lucky_coin_1:82.30%

      Spelldata

      • id:452562
      • name:Lucky Coin
      • tooltip:Agility increased by {$=}w1%.
      • description:{$@spelldesc452536=Flip a Fatebound Coin each time a finishing move consumes {$s1=5} or more combo points. Heads increases the damage of your attacks by {$=}{{$456479s1=8}+{$452923s1=2}}%, lasting {$452923d=15 seconds} or until you flip Tails. Tails deals {$452538s1=0} Cosmic damage to your target. For each time the same face is flipped in a row, Heads increases damage by an additional {$452923s1=2}% and Tails increases its damage by {$452917s1=10}%.}
      • max_stacks:0
      • duration:-0.00
      • cooldown:0.00
      • default_chance:0.00%
      Grand Melee12.60.023.1s22.9s12.4s52.35%100.00%0.0 (0.0)0.0

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_grand_melee
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Damage Modifiers

      • direct:1.05
      • periodic:1.05
      • auto_attack:1.05
      • crit_chance:1.00
      • is_stacking:false

      Trigger Details

      • interval_min/max:0.2s / 175.0s
      • trigger_min/max:0.2s / 175.0s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 39.0s
      • uptime_min/max:14.52% / 92.60%

      Stack Uptimes

      • grand_melee_1:52.35%

      Spelldata

      • id:193358
      • name:Grand Melee
      • tooltip:Damage increased by {$=}w1%. Blade Flurry deals {$=}w2% additional damage to nearby enemies.
      • description:Damage increased by {$s1=5}%. Blade Flurry deals {$s2=10}% additional damage to nearby enemies.
      • max_stacks:0
      • duration:-0.00
      • cooldown:0.00
      • default_chance:0.00%
      Loaded Dice9.20.334.5s33.6s16.0s46.05%85.44%0.3 (0.3)0.0

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_loaded_dice
      • max_stacks:1
      • base duration:45.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Trigger Details

      • interval_min/max:18.5s / 83.5s
      • trigger_min/max:18.5s / 80.7s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 41.5s
      • uptime_min/max:5.46% / 89.13%

      Stack Uptimes

      • loaded_dice_1:46.05%

      Spelldata

      • id:256171
      • name:Loaded Dice
      • tooltip:Your next {$?s5171=true}[Slice and Dice will be {$=}w1% more effective][Roll the Bones will grant at least two matches].
      • description:{$@spelldesc256170=Activating Adrenaline Rush causes your next Roll the Bones to grant at least two matches.}
      • max_stacks:0
      • duration:45.00
      • cooldown:0.00
      • default_chance:100.00%
      Opportunity34.827.08.6s4.8s5.2s60.78%100.00%7.6 (22.8)0.1

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_opportunity
      • max_stacks:6
      • base duration:12.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:1.20
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Trigger Details

      • interval_min/max:2.4s / 93.5s
      • trigger_min/max:0.3s / 47.5s
      • trigger_pct:44.61%
      • duration_min/max:0.0s / 80.1s
      • uptime_min/max:34.36% / 84.64%

      Stack Uptimes

      • opportunity_1:1.14%
      • opportunity_2:1.14%
      • opportunity_3:39.65%
      • opportunity_4:0.64%
      • opportunity_5:0.64%
      • opportunity_6:17.57%

      Spelldata

      • id:195627
      • name:Opportunity
      • tooltip:Your next Pistol Shot costs {$s1=50}% less Energy and deals {$s3=100}% increased damage.
      • description:{$@spelldesc193315=Viciously strike an enemy, causing {$=}{{$s1=0}*{$=}<mult>} Physical damage.{$?s279876=true}[ Has a {$s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=1} combo {$=}lpoint:points; each time it strikes.|r}
      • max_stacks:1
      • duration:12.00
      • cooldown:0.00
      • default_chance:100.00%
      Roll the Bones9.30.933.6s31.7s31.0s95.74%0.00%0.9 (0.9)8.5

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_roll_the_bones
      • max_stacks:1
      • base duration:30.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:pandemic
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Trigger Details

      • interval_min/max:28.1s / 70.8s
      • trigger_min/max:4.4s / 56.0s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 60.0s
      • uptime_min/max:83.04% / 99.38%

      Stack Uptimes

      • roll_the_bones_1:95.74%

      Spelldata

      • id:315508
      • name:Roll the Bones
      • tooltip:Gained a random combat enhancement.
      • description:Roll the dice of fate, providing a random combat enhancement for {$d=30 seconds}.
      • max_stacks:0
      • duration:30.00
      • cooldown:45.00
      • default_chance:0.00%
      Ruthless Precision12.70.023.1s22.9s12.4s52.46%52.14%0.0 (0.0)0.0

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_ruthless_precision
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Damage Modifiers

      • direct:1.00
      • periodic:1.00
      • auto_attack:1.00
      • crit_chance:1.15
      • is_stacking:false

      Trigger Details

      • interval_min/max:0.2s / 182.8s
      • trigger_min/max:0.2s / 182.8s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 39.0s
      • uptime_min/max:16.17% / 93.16%

      Stack Uptimes

      • ruthless_precision_1:52.46%

      Spelldata

      • id:193357
      • name:Ruthless Precision
      • tooltip:Critical strike chance of Between the Eyes increased by {$=}{{$s1=15}+{$s2=45}}%. Critical strike chance of all other abilities increased by {$s1=15}%.
      • description:Increases the critical ctrike chance of Between the Eyes by {$=}{{$s1=15}+{$s2=45}}% and the critical strike chance of all other abilities by {$s1=15}% for the duration of Roll the Bones.
      • max_stacks:0
      • duration:-0.00
      • cooldown:0.00
      • default_chance:0.00%
      Shadowmeld2.70.0126.5s126.5s0.0s0.01%0.00%0.0 (0.0)0.0

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_shadowmeld
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Trigger Details

      • interval_min/max:120.0s / 188.8s
      • trigger_min/max:120.0s / 188.8s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 2.0s
      • uptime_min/max:0.00% / 0.72%

      Stack Uptimes

      • shadowmeld_1:0.01%

      Spelldata

      • id:58984
      • name:Shadowmeld
      • tooltip:Shadowmelded.
      • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
      • max_stacks:0
      • duration:-0.00
      • cooldown:120.00
      • default_chance:100.00%
      Skull and Crossbones12.30.023.6s23.5s12.6s51.93%53.42%0.0 (0.0)0.0

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_skull_and_crossbones
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.25
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Trigger Details

      • interval_min/max:0.2s / 163.2s
      • trigger_min/max:0.2s / 163.2s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 39.0s
      • uptime_min/max:9.66% / 95.02%

      Stack Uptimes

      • skull_and_crossbones_1:51.93%

      Spelldata

      • id:199603
      • name:Skull and Crossbones
      • tooltip:Sinister Strike has an additional {$s1=25}% chance of striking an additional time.
      • description:Causes Sinister Strike to have an additional {$s1=25}% chance of striking an additional time for the duration of Roll the Bones.
      • max_stacks:0
      • duration:-0.00
      • cooldown:0.00
      • default_chance:0.00%
      Slice and Dice1.00.00.0s0.0s300.0s100.00%97.24%0.0 (0.0)0.0

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_slice_and_dice
      • max_stacks:1
      • base duration:6.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.50
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:pandemic
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Trigger Details

      • interval_min/max:0.0s / 0.0s
      • trigger_min/max:0.0s / 0.0s
      • trigger_pct:100.00%
      • duration_min/max:240.0s / 360.0s
      • uptime_min/max:100.00% / 100.00%

      Stack Uptimes

      • slice_and_dice_1:100.00%

      Spelldata

      • id:315496
      • name:Slice and Dice
      • tooltip:Attack speed increased by {$=}w1%.
      • description:Finishing move that consumes combo points to increase attack speed by {$s1=50}%. Lasts longer per combo point. 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=true}|((s394320|s394321|s457512)&!s193531)[ 6 points: 42 seconds][]{$?s193531=true}&(s394320|s394321|s457512)[ 7 points: 48 seconds][]
      • max_stacks:0
      • duration:6.00
      • cooldown:0.00
      • default_chance:0.00%
      Stealth1.00.00.0s0.0s0.0s0.00%0.00%0.0 (0.0)0.0

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_stealth
      • max_stacks:1
      • base duration:150.00
      • duration modifier:1.00
      • base cooldown:2.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Trigger Details

      • interval_min/max:0.0s / 0.0s
      • trigger_min/max:0.0s / 0.0s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 0.0s
      • uptime_min/max:0.00% / 0.00%

      Stack Uptimes

      • stealth_1:0.00%

      Spelldata

      • id:1784
      • name:Stealth
      • tooltip:Stealthed.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]
      • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=5}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
      • max_stacks:0
      • duration:-0.00
      • cooldown:2.00
      • default_chance:100.00%
      Subterfuge16.40.018.8s19.6s5.9s32.53%0.00%0.0 (0.0)16.1

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_subterfuge
      • max_stacks:1
      • base duration:6.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Trigger Details

      • interval_min/max:6.1s / 95.6s
      • trigger_min/max:6.1s / 95.6s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 6.0s
      • uptime_min/max:24.02% / 39.77%

      Stack Uptimes

      • subterfuge_1:32.53%

      Spelldata

      • id:115192
      • name:Subterfuge
      • tooltip:Temporarily concealed in the shadows.
      • description:{$@spelldesc108208=Abilities requiring Stealth can be used for {$=}{{$s2=3000}/1000} sec after Stealth breaks. Combat benefits requiring Stealth persist for an additional {$=}{{$s2=3000}/1000} sec after Stealth breaks.}
      • max_stacks:0
      • duration:0.00
      • cooldown:0.00
      • default_chance:0.00%
      Take 'em by Surprise16.40.018.8s18.8s16.0s87.63%0.00%0.0 (0.0)6.5

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_take_em_by_surprise
      • max_stacks:1
      • base duration:20.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.10
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Stat Details

      • stat:haste
      • amount:10.00%

      Trigger Details

      • interval_min/max:6.1s / 95.6s
      • trigger_min/max:6.1s / 95.6s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 20.0s
      • uptime_min/max:63.86% / 99.02%

      Stack Uptimes

      • take_em_by_surprise_1:87.63%

      Spelldata

      • id:385907
      • name:Take 'em by Surprise
      • tooltip:Haste increased by {$=}w1%.
      • description:{$@spelldesc382742=Haste increased by {$s2=10}% while Stealthed and for {$430035d=20 seconds} after breaking Stealth.}
      • max_stacks:0
      • duration:-0.00
      • cooldown:0.00
      • default_chance:0.00%
      Take 'em by Surprise (_aura)16.40.018.8s19.6s0.0s0.03%0.00%0.0 (0.0)0.0

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_take_em_by_surprise_aura
      • max_stacks:1
      • base duration:150.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.10
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Stat Details

      • stat:haste
      • amount:10.00%

      Trigger Details

      • interval_min/max:6.1s / 95.6s
      • trigger_min/max:6.1s / 95.6s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 1.8s
      • uptime_min/max:0.00% / 0.76%

      Stack Uptimes

      • take_em_by_surprise_aura_1:0.03%

      Spelldata

      • id:385907
      • name:Take 'em by Surprise
      • tooltip:Haste increased by {$=}w1%.
      • description:{$@spelldesc382742=Haste increased by {$s2=10}% while Stealthed and for {$430035d=20 seconds} after breaking Stealth.}
      • max_stacks:0
      • duration:-0.00
      • cooldown:0.00
      • default_chance:0.00%
      Tempered Potion1.50.0300.6s0.0s27.5s13.47%0.00%0.0 (0.0)1.2

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_tempered_potion
      • max_stacks:1
      • base duration:30.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Stat Details

      • stat:mastery_rating
      • amount:2617.40
      • stat:haste_rating
      • amount:2617.40
      • stat:crit_rating
      • amount:2617.40

      Trigger Details

      • interval_min/max:300.0s / 319.1s
      • trigger_min/max:0.0s / 0.0s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 30.0s
      • uptime_min/max:9.98% / 18.18%

      Stack Uptimes

      • tempered_potion_1:13.47%

      Spelldata

      • id:431932
      • name:Tempered Potion
      • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
      • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
      • max_stacks:0
      • duration:30.00
      • cooldown:300.00
      • default_chance:0.00%
      True Bearing12.50.023.2s23.1s12.5s52.34%52.34%0.0 (0.0)0.0

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_true_bearing
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.50
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Trigger Details

      • interval_min/max:0.2s / 217.5s
      • trigger_min/max:0.2s / 217.5s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 39.0s
      • uptime_min/max:11.24% / 95.39%

      Stack Uptimes

      • true_bearing_1:52.34%

      Spelldata

      • id:193359
      • name:True Bearing
      • tooltip:Finishing moves reduce the remaining cooldown of many of your abilities by an additional {$=}<cdr> sec per combo point.
      • description:Finishing moves reduce the remaining cooldown of many of your abilities by an additional {$=}<cdr> sec per combo point.
      • max_stacks:0
      • duration:-0.00
      • cooldown:0.00
      • default_chance:0.00%
      Vanish15.40.019.6s19.6s0.0s0.03%0.00%0.0 (0.0)0.0

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_vanish
      • max_stacks:1
      • base duration:3.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Trigger Details

      • interval_min/max:6.1s / 95.6s
      • trigger_min/max:6.1s / 95.6s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 1.8s
      • uptime_min/max:0.00% / 0.75%

      Stack Uptimes

      • vanish_1:0.03%

      Spelldata

      • id:11327
      • name:Vanish
      • tooltip:Improved stealth.{$?=}{$=}w3!=0[ Movement speed increased by {$=}w3%.][]{$?=}{$=}w4!=0[ Damage increased by {$=}w4%.][]
      • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
      • max_stacks:0
      • duration:3.00
      • cooldown:0.00
      • default_chance:100.00%
      Constant Buffs
      Arcane Intellect

      Buff Details

      • buff initial source:
      • cooldown name:buff_arcane_intellect
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.03
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:1459
      • name:Arcane Intellect
      • tooltip:Intellect increased by $w1%.
      • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
      • max_stacks:0
      • duration:3600.00
      • cooldown:0.00
      • default_chance:0.00%
      Ascendance (_darkmoon)

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_ascendance_darkmoon
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:pandemic
      • stack behavior:default
      • tick behavior:clip
      • tick_time behavior:unhasted
      • period:8.00

      Spelldata

      • id:457594
      • name:Ascendance
      • tooltip:
      • description:{$@spelldesc453575=Gain {$@=}spellname453575 every $457594t seconds spent in combat. {$@=}spellname453575 grants {$458573s2=89} of a random secondary stat for {$457596d=15 seconds}, stacking up to {$457594s1=10} times. This is a Nerubian embellishment.}
      • max_stacks:0
      • duration:-0.00
      • cooldown:0.00
      • default_chance:0.00%
      Battle Shout

      Buff Details

      • buff initial source:
      • cooldown name:buff_battle_shout
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:15.00
      • default_chance:100.00%
      • default_value:0.05
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:6673
      • name:Battle Shout
      • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
      • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
      • max_stacks:0
      • duration:3600.00
      • cooldown:15.00
      • default_chance:0.00%
      Crystallization

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_crystallization
      • max_stacks:1
      • base duration:3600.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Stat Details

      • stat:agility
      • amount:733.25

      Spelldata

      • id:453250
      • name:Crystallization
      • tooltip:{$=}pri increased by {$=}w1.
      • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
      • max_stacks:0
      • duration:3600.00
      • cooldown:0.00
      • default_chance:0.00%
      Flask of Tempered Versatility

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_flask_of_tempered_versatility
      • max_stacks:1
      • base duration:3600.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00
      • associated item:Flask of Tempered Versatility

      Stat Details

      • stat:versatility_rating
      • amount:2825.00

      Spelldata

      • id:431973
      • name:Flask of Tempered Versatility
      • tooltip:Versatility increased by {$=}w1.
      • description:Drink to increase your Versatility by {$s1=4307}. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
      • max_stacks:0
      • duration:3600.00
      • cooldown:0.00
      • default_chance:0.00%
      Mark of the Wild

      Buff Details

      • buff initial source:
      • cooldown name:buff_mark_of_the_wild
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.03
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:1126
      • name:Mark of the Wild
      • tooltip:Versatility increased by $w1%.
      • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
      • max_stacks:0
      • duration:3600.00
      • cooldown:0.00
      • default_chance:0.00%
      Power Word: Fortitude

      Buff Details

      • buff initial source:
      • cooldown name:buff_power_word_fortitude
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.05
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:21562
      • name:Power Word: Fortitude
      • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
      • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
      • max_stacks:0
      • duration:3600.00
      • cooldown:0.00
      • default_chance:0.00%
      Skyfury

      Buff Details

      • buff initial source:
      • cooldown name:buff_skyfury
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.10
      • default_chance:20.00%
      • default_value:2.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:462854
      • name:Skyfury
      • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
      • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
      • max_stacks:0
      • duration:3600.00
      • cooldown:0.00
      • default_chance:20.00%
      Feast of the Divine Day

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_well_fed
      • max_stacks:1
      • base duration:3600.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:101.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Stat Details

      • stat:agility
      • amount:446.00

      Spelldata

      • id:457284
      • name:Well Fed
      • tooltip:Your primary stats have been increased by {$=}w11.
      • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=446} primary stat for $457172d.
      • max_stacks:0
      • duration:3600.00
      • cooldown:0.00
      • default_chance:101.00%

      Procs, Uptimes & Benefits

      Proc Count Min Max Interval Min Max
      Skyfury (Main Hand)52.126.090.05.7s0.6s74.8s
      Skyfury (Off Hand)75.442.0122.03.9s0.4s61.2s
      Roll the Bones Buffs: 11.20.04.0204.1s30.0s358.6s
      Roll the Bones Buffs: 28.95.012.033.2s28.1s102.2s
      Roll the Bones Buffs: 50.10.02.0119.1s28.1s278.8s
      Roll the Bones Buff Lost: broadside0.10.02.0208.9s76.8s326.8s
      Roll the Bones Buff Lost: buried_treasure0.10.02.0193.3s57.8s313.9s
      Roll the Bones Buff Lost: grand_melee0.10.02.0204.7s54.9s320.8s
      Roll the Bones Buff Lost: ruthless_precision0.10.03.0196.0s54.1s298.5s
      Roll the Bones Buff Lost: skull_and_crossbones0.10.02.0197.5s87.5s300.4s
      Roll the Bones Buff Lost: true_bearing0.20.02.0187.9s47.9s297.8s
      Count the Odds50.821.084.05.8s0.2s73.8s
      Count the Odds (Ambush)18.93.039.015.3s0.3s224.9s
      Count the Odds (Sinister Strike)8.10.023.028.9s0.3s261.3s
      Count the Odds (Dispatch)23.87.044.012.1s0.5s151.3s
      Count the Odds Capped1.30.014.041.8s0.2s340.4s
      Uptime Avg % Min Max Avg Dur Min Max
      Energy Cap2.23%0.34%4.88%0.3s0.0s1.0s

      Resources

      Gains Type Count Total Tot% Avg Overflow Ovr%
      Acýs
      Ace Up Your SleeveCombo Points29.88149.3913.07%5.000.000.00%
      Adrenaline RushEnergy1,351.912,440.9219.02%1.8179.703.16%
      Adrenaline Rush (Expiry)Energy1.360.000.00%0.0050.70100.00%
      BroadsideCombo Points182.07141.8212.40%0.7840.2522.11%
      Buried TreasureEnergy766.12745.645.81%0.9734.644.44%
      Deal FateCombo Points61.8456.964.98%0.924.887.89%
      Energy RegenEnergy1,481.025,458.8442.54%3.69180.483.20%
      Fatal FlourishEnergy340.753,310.0925.79%9.7197.392.86%
      Improved Adrenaline RushCombo Points9.4553.784.70%5.6912.3918.72%
      Improved Adrenaline Rush (Expiry)Energy8.59877.786.84%102.17840.5148.92%
      Improved AmbushCombo Points125.9076.356.68%0.6149.5539.36%
      Quick DrawCombo Points160.21124.3010.87%0.7835.9122.42%
      RuthlessnessCombo Points175.72227.8419.93%1.300.000.00%
      AmbushCombo Points81.82163.6414.31%2.000.000.00%
      Ambush (_hidden_opportunity)Combo Points23.8613.381.17%0.5634.3471.96%
      Ambush (_hidden_opportunity_audacity)Combo Points20.2215.751.38%0.7824.6961.06%
      Ghostly StrikeCombo Points18.6018.601.63%1.000.000.00%
      Pistol ShotCombo Points53.4253.424.67%1.000.000.00%
      Sinister StrikeCombo Points36.6536.653.21%1.000.000.00%
      Sinister Strike (_extra_attack)Combo Points17.7011.481.00%0.656.2135.11%
      Usage Type Count Total Tot% Avg RPE APR
      Acýs
      AmbushEnergy81.824,090.9931.76%50.0050.005,659.10
      Between the EyesEnergy92.332,308.1517.92%25.0025.0021,826.35
      Between the EyesCombo Points92.33596.9152.38%6.476.4784,398.27
      DispatchEnergy82.392,883.6822.39%35.0035.006,742.01
      DispatchCombo Points82.39535.5947.00%6.506.5036,299.81
      Ghostly StrikeEnergy18.60651.135.06%35.0035.005,095.38
      Pistol ShotEnergy53.421,068.508.30%20.0020.0018,100.05
      Roll the BonesEnergy10.15228.871.78%22.5422.540.00
      Sinister StrikeEnergy36.651,649.1312.80%45.0045.002,624.79
      Slice and DiceCombo Points1.007.000.61%7.007.000.00
      Change Start Gain/s Loss/s Overflow End (Avg) Min Max
      Energy200.042.7842.931,232.6102.10.0200.0
      Combo Points1.43.813.80208.23.91.07.0

      Statistics & Data Analysis

      Fight Length
      Acýs Fight Length
      Count 9999
      Mean 300.01
      Minimum 240.01
      Maximum 359.99
      Spread ( max - min ) 119.98
      Range [ ( max - min ) / 2 * 100% ] 20.00%
      DPS
      Acýs Damage Per Second
      Count 9999
      Mean 660898.15
      Minimum 504378.20
      Maximum 799039.02
      Spread ( max - min ) 294660.82
      Range [ ( max - min ) / 2 * 100% ] 22.29%
      Standard Deviation 36864.1416
      5th Percentile 599287.35
      95th Percentile 720155.32
      ( 95th Percentile - 5th Percentile ) 120867.96
      Mean Distribution
      Standard Deviation 368.6598
      95.00% Confidence Interval ( 660175.59 - 661620.71 )
      Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
      Approx. Iterations needed for ( always use n>=50 )
      1% Error 120
      0.1% Error 11952
      0.1 Scale Factor Error with Delta=300 11600907
      0.05 Scale Factor Error with Delta=300 46403626
      0.01 Scale Factor Error with Delta=300 1160090633
      Priority Target DPS
      Acýs Priority Target Damage Per Second
      Count 9999
      Mean 660898.15
      Minimum 504378.20
      Maximum 799039.02
      Spread ( max - min ) 294660.82
      Range [ ( max - min ) / 2 * 100% ] 22.29%
      Standard Deviation 36864.1416
      5th Percentile 599287.35
      95th Percentile 720155.32
      ( 95th Percentile - 5th Percentile ) 120867.96
      Mean Distribution
      Standard Deviation 368.6598
      95.00% Confidence Interval ( 660175.59 - 661620.71 )
      Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
      Approx. Iterations needed for ( always use n>=50 )
      1% Error 120
      0.1% Error 11952
      0.1 Scale Factor Error with Delta=300 11600907
      0.05 Scale Factor Error with Delta=300 46403626
      0.01 Scale Factor Error with Delta=300 1160090633
      DPS(e)
      Acýs Damage Per Second (Effective)
      Count 9999
      Mean 660898.15
      Minimum 504378.20
      Maximum 799039.02
      Spread ( max - min ) 294660.82
      Range [ ( max - min ) / 2 * 100% ] 22.29%
      Damage
      Acýs Damage
      Count 9999
      Mean 195728702.84
      Minimum 127207119.25
      Maximum 264287165.68
      Spread ( max - min ) 137080046.43
      Range [ ( max - min ) / 2 * 100% ] 35.02%
      DTPS
      Acýs Damage Taken Per Second
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%
      HPS
      Acýs Healing Per Second
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%
      Standard Deviation 0.0000
      5th Percentile 0.00
      95th Percentile 0.00
      ( 95th Percentile - 5th Percentile ) 0.00
      Mean Distribution
      Standard Deviation 0.0000
      95.00% Confidence Interval ( 0.00 - 0.00 )
      Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
      Approx. Iterations needed for ( always use n>=50 )
      1% Error 0
      0.1% Error 0
      0.1 Scale Factor Error with Delta=300 0
      0.05 Scale Factor Error with Delta=300 0
      0.01 Scale Factor Error with Delta=300 0
      HPS(e)
      Acýs Healing Per Second (Effective)
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%
      Heal
      Acýs Heal
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%
      HTPS
      Acýs Healing Taken Per Second
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%

      Action Priority List

      actions.precombat Executed before combat begins. Accepts non-harmful actions only.
      # count action,conditions
      0 0.00 apply_poison,nonlethal=none,lethal=instant
      1 0.00 flask
      2 0.00 augmentation
      3 0.00 food
      4 0.00 snapshot_stats
      5 0.00 use_item,name=imperfect_ascendancy_serum
      6 0.00 stealth,precombat_seconds=2
      7 0.00 adrenaline_rush,precombat_seconds=2,if=talent.improved_adrenaline_rush&talent.keep_it_rolling&talent.loaded_dice
      8 0.00 roll_the_bones,precombat_seconds=2
      9 0.00 adrenaline_rush,precombat_seconds=1,if=talent.improved_adrenaline_rush
      A 0.00 slice_and_dice,precombat_seconds=1
      Default action list Executed every time the actor is available.
      # count action,conditions
      0.00 stealth
      0.00 kick
      0.00 variable,name=rtb_reroll,value=rtb_buffs.will_lose=(rtb_buffs.will_lose.buried_treasure+rtb_buffs.will_lose.grand_melee&spell_targets.blade_flurry<2&raid_event.adds.in>12&raid_event.adds.count<2)
      0.00 variable,name=rtb_reroll,if=talent.loaded_dice,value=rtb_buffs.will_lose=buff.loaded_dice.up
      0.00 variable,name=rtb_reroll,value=variable.rtb_reroll&rtb_buffs.longer=0|rtb_buffs.normal=0&rtb_buffs.longer>=1&rtb_buffs<6&rtb_buffs.max_remains<=39&!stealthed.all&buff.loaded_dice.up
      0.00 variable,name=rtb_reroll,op=reset,if=!(raid_event.adds.remains>12|raid_event.adds.up&(raid_event.adds.in-raid_event.adds.remains)<6|target.time_to_die>12)|fight_remains<12
      0.00 variable,name=ambush_condition,value=(talent.hidden_opportunity|combo_points.deficit>=2+talent.improved_ambush+buff.broadside.up)&energy>=50
      0.00 variable,name=finish_condition,value=effective_combo_points>=cp_max_spend-1-(stealthed.all&talent.crackshot|(talent.hand_of_fate|talent.flawless_form)&talent.hidden_opportunity&(buff.audacity.up|buff.opportunity.up))
      0.00 variable,name=blade_flurry_sync,value=spell_targets.blade_flurry<2&raid_event.adds.in>20|buff.blade_flurry.remains>gcd
      B 0.00 call_action_list,name=cds
      C 0.00 call_action_list,name=stealth,if=stealthed.all
      D 0.00 run_action_list,name=finish,if=variable.finish_condition
      E 0.00 call_action_list,name=build
      0.00 arcane_torrent,if=energy.base_deficit>=15+energy.regen
      0.00 arcane_pulse
      0.00 lights_judgment
      0.00 bag_of_tricks
      actions.build
      # count action,conditions
      F 37.45 ambush,if=talent.hidden_opportunity&buff.audacity.up
      G 49.59 pistol_shot,if=talent.fan_the_hammer&talent.audacity&talent.hidden_opportunity&buff.opportunity.up&!buff.audacity.up
      H 0.00 pistol_shot,if=talent.fan_the_hammer&buff.opportunity.up&(buff.opportunity.stack>=buff.opportunity.max_stack|buff.opportunity.remains<2)
      I 0.47 pistol_shot,if=talent.fan_the_hammer&buff.opportunity.up&(combo_points.deficit>=(1+(talent.quick_draw+buff.broadside.up)*(talent.fan_the_hammer.rank+1))|combo_points<=talent.ruthlessness)
      0.00 pistol_shot,if=!talent.fan_the_hammer&buff.opportunity.up&(energy.base_deficit>energy.regen*1.5|combo_points.deficit<=1+buff.broadside.up|talent.quick_draw.enabled|talent.audacity.enabled&!buff.audacity.up)
      0.00 pool_resource,for_next=1
      0.00 ambush,if=talent.hidden_opportunity
      J 36.65 sinister_strike
      actions.cds
      # count action,conditions
      K 8.45 adrenaline_rush,if=!buff.adrenaline_rush.up&(!variable.finish_condition|!talent.improved_adrenaline_rush)|stealthed.all&talent.crackshot&talent.improved_adrenaline_rush&combo_points<=2
      0.00 sprint,if=(trinket.1.is.scroll_of_momentum|trinket.2.is.scroll_of_momentum)&buff.full_momentum.up
      0.00 blade_flurry,if=spell_targets>=2&buff.blade_flurry.remains<gcd
      0.00 blade_flurry,if=talent.deft_maneuvers&!variable.finish_condition&(spell_targets>=3&combo_points.deficit=spell_targets+buff.broadside.up|spell_targets>=5)
      L 9.15 roll_the_bones,if=variable.rtb_reroll|rtb_buffs=0
      0.00 keep_it_rolling,if=rtb_buffs>=4&(rtb_buffs.min_remains<2|buff.broadside.up)
      M 18.60 ghostly_strike,if=combo_points<cp_max_spend
      0.00 use_item,name=imperfect_ascendancy_serum,if=!stealthed.all|fight_remains<=22
      0.00 use_item,name=mad_queens_mandate,if=!stealthed.all|fight_remains<=5
      0.00 killing_spree,if=variable.finish_condition&!stealthed.all
      N 0.00 call_action_list,name=stealth_cds,if=!stealthed.all&(!talent.crackshot|cooldown.between_the_eyes.ready)
      0.00 thistle_tea,if=!buff.thistle_tea.up&(energy.base_deficit>=150|fight_remains<charges*6)
      0.00 blade_rush,if=energy.base_time_to_max>4&!stealthed.all
      O 1.50 potion,if=buff.bloodlust.react|fight_remains<30|buff.adrenaline_rush.up
      0.00 blood_fury
      0.00 berserking
      0.00 fireblood
      0.00 ancestral_call
      0.00 use_items,slots=trinket1,if=buff.between_the_eyes.up|trinket.1.has_stat.any_dps|fight_remains<=20
      0.00 use_items,slots=trinket2,if=buff.between_the_eyes.up|trinket.2.has_stat.any_dps|fight_remains<=20
      actions.finish
      # count action,conditions
      0.00 between_the_eyes,if=!talent.crackshot&(buff.between_the_eyes.remains<4|talent.improved_between_the_eyes|talent.greenskins_wickers)&!buff.greenskins_wickers.up
      P 15.47 between_the_eyes,if=talent.crackshot&(cooldown.vanish.remains>45|talent.underhanded_upper_hand&talent.without_a_trace&(buff.adrenaline_rush.remains>12|buff.adrenaline_rush.down&cooldown.adrenaline_rush.remains>45))&(raid_event.adds.remains>8|raid_event.adds.in<raid_event.adds.remains|!raid_event.adds.up)
      0.00 slice_and_dice,if=buff.slice_and_dice.remains<fight_remains&refreshable
      0.00 cold_blood
      0.00 coup_de_grace
      Q 79.74 dispatch
      actions.stealth
      # count action,conditions
      0.00 cold_blood,if=variable.finish_condition
      0.00 pool_resource,for_next=1
      R 76.85 between_the_eyes,if=variable.finish_condition&talent.crackshot&(!buff.shadowmeld.up|stealthed.rogue)
      S 2.65 dispatch,if=variable.finish_condition
      T 3.36 pistol_shot,if=talent.crackshot&talent.fan_the_hammer.rank>=2&buff.opportunity.stack>=6&(buff.broadside.up&combo_points<=1|buff.greenskins_wickers.up)
      U 44.37 ambush,if=talent.hidden_opportunity
      actions.stealth_cds
      # count action,conditions
      V 15.37 vanish,if=talent.underhanded_upper_hand&talent.subterfuge&(buff.adrenaline_rush.up|!talent.without_a_trace&talent.crackshot)&(variable.finish_condition|!talent.crackshot&(variable.ambush_condition|!talent.hidden_opportunity))
      0.00 vanish,if=!talent.underhanded_upper_hand&talent.crackshot&variable.finish_condition
      0.00 vanish,if=!talent.underhanded_upper_hand&!talent.crackshot&talent.hidden_opportunity&!buff.audacity.up&buff.opportunity.stack<buff.opportunity.max_stack&variable.ambush_condition
      0.00 vanish,if=!talent.underhanded_upper_hand&!talent.crackshot&!talent.hidden_opportunity&talent.fateful_ending&(!buff.fatebound_lucky_coin.up&(buff.fatebound_coin_tails.stack>=5|buff.fatebound_coin_heads.stack>=5)|buff.fatebound_lucky_coin.up&!cooldown.between_the_eyes.ready)
      0.00 vanish,if=!talent.underhanded_upper_hand&!talent.crackshot&!talent.hidden_opportunity&!talent.fateful_ending&talent.take_em_by_surprise&!buff.take_em_by_surprise.up
      W 2.72 shadowmeld,if=variable.finish_condition&!cooldown.vanish.ready

      Sample Sequence

      0123689AMOURUURURUVRURRTRURGVRURURMURUWSGPFQGQLFQGQFJVRKRURMURRUPGQFJQGQFJQJJVRMURRTRURPGQFQLGQMFQGQKVRRRURURUPQMGQFQGPFQGQFQGVRURMURURKRLJJJPQJJJQGQFQGVRMURTRURTPFQGQFJQGQFQGQMFQGQKLVRURURURUPQGQFJQMGQFJWSGVRRURUGRRPFQMGLQKQFQGPFGQFQGQFQGQFVRRRMURUURGQFQGQFQGQLFQGQKVRMURRURURGPQFJQJJJQMGVRURRTRURGQGLQFJQGMQFQKVRRUURURRGPFGQJJJJQGQMFQJJQGQFLJVRGRUURRRPMJQKQGQJGQFWSGPQFQGQFQMGQFJJLVRURRRTRUQGQFQGQMFQKVRURRTRURGP

      Sample Sequence Table

      Time # Name [List] Target Resources Buffs
      Pre0apply_poison
      [precombat]
      Acýs 200.0/200 100% energy
      0.0/7 0% CP
      Pre1flask
      [precombat]
      Acýs 200.0/200 100% energy
      0.0/7 0% CP
      Pre2augmentation
      [precombat]
      Acýs 200.0/200 100% energy
      0.0/7 0% CP
      Pre3food
      [precombat]
      Acýs 200.0/200 100% energy
      0.0/7 0% CP
      Pre6stealth
      [precombat]
      Acýs 200.0/200 100% energy
      0.0/7 0% CP
      Pre8roll_the_bones
      [precombat]
      Acýs 200.0/200 100% energy
      0.0/7 0% CP
      stealth, take_em_by_surprise_aura, double_jeopardy
      Pre9adrenaline_rush
      [precombat]
      Acýs 200.0/200 100% energy
      0.0/7 0% CP
      stealth, take_em_by_surprise_aura, grand_melee, roll_the_bones, double_jeopardy
      PreAslice_and_dice
      [precombat]
      Acýs 200.0/250 80% energy
      7.0/7 100% CP
      stealth, take_em_by_surprise_aura, grand_melee, roll_the_bones, edge_case, double_jeopardy, loaded_dice
      0:00.000Mghostly_strike
      [cds]
      Fluffy_Pillow 200.0/250 80% energy
      2.0/7 29% CP
      slice_and_dice, stealth, take_em_by_surprise_aura, grand_melee, roll_the_bones, alacrity, fatebound_coin_heads(2), fatebound_coin_tails(2), loaded_dice
      0:00.000Opotion
      [cds]
      Fluffy_Pillow 165.0/250 66% energy
      3.0/7 43% CP
      bloodlust, slice_and_dice, stealth, take_em_by_surprise_aura, grand_melee, roll_the_bones, alacrity, subterfuge, fatebound_coin_heads(2), fatebound_coin_tails(2), loaded_dice
      0:00.000Uambush
      [stealth]
      Fluffy_Pillow 165.0/250 66% energy
      3.0/7 43% CP
      bloodlust, slice_and_dice, stealth, take_em_by_surprise_aura, grand_melee, roll_the_bones, alacrity, subterfuge, fatebound_coin_heads(2), fatebound_coin_tails(2), loaded_dice, tempered_potion
      0:00.806Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 153.4/250 61% energy
      6.0/7 86% CP
      bloodlust, slice_and_dice, take_em_by_surprise, grand_melee, roll_the_bones, acrobatic_strikes(3), alacrity, subterfuge, fatebound_coin_heads(2), fatebound_coin_tails(2), loaded_dice, tempered_potion
      0:01.611Uambush
      [stealth]
      Fluffy_Pillow 157.2/250 63% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, grand_melee, roll_the_bones, acrobatic_strikes(5), alacrity(3), subterfuge, fatebound_coin_heads(3), loaded_dice, tempered_potion
      0:02.415Uambush
      [stealth]
      Fluffy_Pillow 136.0/250 54% energy
      4.0/7 57% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, grand_melee, roll_the_bones, acrobatic_strikes(9), alacrity(3), subterfuge, fatebound_coin_heads(3), loaded_dice, tempered_potion
      0:03.221Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 135.0/250 54% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(3), subterfuge, fatebound_coin_heads(3), loaded_dice, tempered_potion
      0:04.027Uambush
      [stealth]
      Fluffy_Pillow 159.4/250 64% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, loaded_dice, tempered_potion
      0:04.830Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 138.8/250 56% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, loaded_dice, tempered_potion
      0:05.632Uambush
      [stealth]
      Fluffy_Pillow 163.1/250 65% energy
      2.0/7 29% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, loaded_dice, tempered_potion
      0:06.436Vvanish
      [stealth_cds]
      Acýs 142.6/250 57% energy
      5.0/7 71% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, loaded_dice, tempered_potion
      0:06.436Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 142.6/250 57% energy
      5.0/7 71% CP
      bloodlust, slice_and_dice, vanish, between_the_eyes, opportunity(3), take_em_by_surprise_aura, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, double_jeopardy, loaded_dice, tempered_potion
      0:07.239Uambush
      [stealth]
      Fluffy_Pillow 147.0/250 59% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(3), loaded_dice, tempered_potion
      0:08.042Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 136.4/250 55% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(3), loaded_dice, Ascendance_Haste, tempered_potion
      0:08.848Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 160.9/250 64% energy
      6.0/7 86% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(4), loaded_dice, Ascendance_Haste, tempered_potion
      0:09.653Tpistol_shot
      [stealth]
      Fluffy_Pillow 185.4/250 74% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, loaded_dice, Ascendance_Haste, tempered_potion
      0:10.457Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 214.9/250 86% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, loaded_dice, Ascendance_Haste, tempered_potion
      0:11.262Uambush
      [stealth]
      Fluffy_Pillow 229.5/250 92% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), loaded_dice, Ascendance_Haste, tempered_potion
      0:12.066Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 218.9/250 88% energy
      5.0/7 71% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), loaded_dice, Ascendance_Haste, tempered_potion
      0:12.870Gpistol_shot
      [build]
      Fluffy_Pillow 243.4/250 97% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), loaded_dice, Ascendance_Haste, tempered_potion
      0:13.674Vvanish
      [stealth_cds]
      Acýs 250.0/250 100% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, broadside, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), audacity, loaded_dice, Ascendance_Haste, tempered_potion
      0:13.674Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 250.0/250 100% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, vanish, between_the_eyes, take_em_by_surprise_aura, broadside, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), double_jeopardy, audacity, loaded_dice, Ascendance_Haste, tempered_potion
      0:14.479Uambush
      [stealth]
      Fluffy_Pillow 250.0/250 100% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, broadside, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), audacity, loaded_dice, Ascendance_Haste, tempered_potion
      0:15.282Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 239.5/250 96% energy
      5.0/7 71% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), loaded_dice, Ascendance_Haste, tempered_potion
      0:16.085Uambush
      [stealth]
      Fluffy_Pillow 250.0/250 100% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(3), loaded_dice, Ascension_Mastery(2), tempered_potion
      0:16.890Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 239.5/250 96% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(3), loaded_dice, Ascension_Mastery(2), tempered_potion
      0:17.694Mghostly_strike
      [cds]
      Fluffy_Pillow 243.9/250 98% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(4), loaded_dice, Ascension_Mastery(2), tempered_potion
      0:17.694Uambush
      [stealth]
      Fluffy_Pillow 208.9/250 84% energy
      2.0/7 29% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(4), loaded_dice, Ascension_Mastery(2), tempered_potion
      0:18.500Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 198.4/250 79% energy
      5.0/7 71% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(4), loaded_dice, Ascension_Mastery(2), tempered_potion
      0:19.304Uambush
      [stealth]
      Fluffy_Pillow 212.8/250 85% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(5), loaded_dice, Ascension_Mastery(2), tempered_potion
      0:20.109Wshadowmeld
      [stealth_cds]
      Fluffy_Pillow 192.3/250 77% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), loaded_dice, Ascension_Mastery(2), tempered_potion
      0:20.109Sdispatch
      [stealth]
      Fluffy_Pillow 192.3/250 77% energy
      7.0/7 100% CP
      bloodlust, shadowmeld, slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), loaded_dice, Ascension_Mastery(2), tempered_potion
      0:20.914Gpistol_shot
      [build]
      Fluffy_Pillow 186.8/250 75% energy
      2.0/7 29% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(6), loaded_dice, Ascension_Mastery(2), tempered_potion
      0:21.717Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 236.2/250 94% energy
      6.0/7 86% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(6), audacity, loaded_dice, Ascension_Mastery(2), tempered_potion
      0:22.522Fambush
      [build]
      Fluffy_Pillow 240.6/250 96% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, audacity, loaded_dice, Ascension_Mastery(2), tempered_potion
      0:23.327Qdispatch
      [finish]
      Fluffy_Pillow 250.0/250 100% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, loaded_dice, Ascension_Mastery(2), tempered_potion
      0:24.132Gpistol_shot
      [build]
      Fluffy_Pillow 250.0/250 100% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, loaded_dice, Ascendance_Vers(3), tempered_potion
      0:24.937Qdispatch
      [finish]
      Fluffy_Pillow 250.0/250 100% energy
      5.0/7 71% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, audacity, loaded_dice, Ascendance_Vers(3), tempered_potion
      0:25.743Lroll_the_bones
      [cds]
      Acýs 244.5/250 98% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), audacity, loaded_dice, Ascendance_Vers(3), tempered_potion
      0:26.548Fambush
      [build]
      Fluffy_Pillow 250.0/250 100% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), audacity, Ascendance_Vers(3), tempered_potion
      0:27.353Qdispatch
      [finish]
      Fluffy_Pillow 239.5/250 96% energy
      5.0/7 71% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), Ascendance_Vers(3), tempered_potion
      0:28.158Gpistol_shot
      [build]
      Fluffy_Pillow 250.0/250 100% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, Ascendance_Vers(3), tempered_potion
      0:28.960Qdispatch
      [finish]
      Fluffy_Pillow 250.0/250 100% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, audacity, Ascendance_Vers(3), tempered_potion
      0:29.765Fambush
      [build]
      Fluffy_Pillow 244.5/250 98% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), audacity, Ascendance_Vers(3), tempered_potion
      0:30.570Jsinister_strike
      [build]
      Fluffy_Pillow 223.2/250 89% energy
      5.0/7 71% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), Ascendance_Vers(3)
      0:31.375Vvanish
      [stealth_cds]
      Acýs 216.6/250 87% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), Ascendance_Vers(3)
      0:31.375Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 216.6/250 87% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, vanish, between_the_eyes, take_em_by_surprise_aura, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), double_jeopardy, Ascendance_Vers(3)
      0:32.180Kadrenaline_rush
      [cds]
      Acýs 250.0/250 100% energy
      2.0/7 29% CP
      bloodlust, slice_and_dice, between_the_eyes, take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), Ascension_Mastery(4)
      0:32.180Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 200.0/250 80% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), edge_case, loaded_dice, Ascension_Mastery(4)
      0:32.986Uambush
      [stealth]
      Fluffy_Pillow 223.5/250 89% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(3), fatebound_coin_tails, loaded_dice, Ascension_Mastery(4)
      0:33.792Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 201.9/250 81% energy
      5.0/7 71% CP
      bloodlust, slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(3), fatebound_coin_tails, loaded_dice, Ascension_Mastery(4)
      0:34.597Mghostly_strike
      [cds]
      Fluffy_Pillow 225.4/250 90% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), loaded_dice, Ascension_Mastery(4)
      0:34.597Uambush
      [stealth]
      Fluffy_Pillow 190.4/250 76% energy
      3.0/7 43% CP
      bloodlust, slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), loaded_dice, Ascension_Mastery(4)
      0:35.402Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 178.8/250 72% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), loaded_dice, Ascension_Mastery(4)
      0:36.209Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 192.3/250 77% energy
      6.0/7 86% CP
      bloodlust, slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(3), loaded_dice, Ascension_Mastery(4)
      0:37.014Uambush
      [stealth]
      Fluffy_Pillow 195.7/250 78% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(4), loaded_dice, Ascension_Mastery(4)
      0:37.819Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 194.1/250 78% energy
      5.0/7 71% CP
      bloodlust, slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(4), loaded_dice, Ascension_Mastery(4)
      0:38.622Gpistol_shot
      [build]
      Fluffy_Pillow 197.5/250 79% energy
      1.0/7 14% CP
      bloodlust, slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, loaded_dice, Ascension_Mastery(4)
      0:39.426Qdispatch
      [finish]
      Fluffy_Pillow 215.9/250 86% energy
      7.0/7 100% CP
      bloodlust, slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, audacity, loaded_dice, Ascension_Mastery(4)
      0:40.230Fambush
      [build]
      Fluffy_Pillow 207.4/250 83% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), audacity, loaded_dice, Ascension_Crit(5)
      0:41.034Jsinister_strike
      [build]
      Fluffy_Pillow 179.2/250 72% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), loaded_dice, Ascension_Crit(5)
      0:41.838Qdispatch
      [finish]
      Fluffy_Pillow 166.1/250 66% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), loaded_dice, Ascension_Crit(5)
      0:42.644Gpistol_shot
      [build]
      Fluffy_Pillow 153.0/250 61% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), loaded_dice, Ascension_Crit(5)
      0:43.451Qdispatch
      [finish]
      Fluffy_Pillow 174.9/250 70% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), audacity, loaded_dice, Ascension_Crit(5)
      0:44.254Fambush
      [build]
      Fluffy_Pillow 161.7/250 65% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), audacity, loaded_dice, Ascension_Crit(5)
      0:45.058Jsinister_strike
      [build]
      Fluffy_Pillow 147.6/250 59% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), loaded_dice, Ascension_Crit(5)
      0:45.861Qdispatch
      [finish]
      Fluffy_Pillow 148.4/250 59% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), loaded_dice, Ascension_Crit(5)
      0:46.664Jsinister_strike
      [build]
      Fluffy_Pillow 149.2/250 60% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), loaded_dice, Ascension_Crit(5)
      0:47.470Jsinister_strike
      [build]
      Fluffy_Pillow 140.2/250 56% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), loaded_dice, Ascension_Crit(5)
      0:48.275Vvanish
      [stealth_cds]
      Acýs 141.1/250 56% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), loaded_dice, Ascendance_Vers(6)
      0:48.275Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 141.1/250 56% energy
      7.0/7 100% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise_aura, broadside, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), double_jeopardy, loaded_dice, Ascendance_Vers(6)
      0:49.080Mghostly_strike
      [cds]
      Fluffy_Pillow 161.9/250 65% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), loaded_dice, Ascendance_Vers(6)
      0:49.080Uambush
      [stealth]
      Fluffy_Pillow 126.9/250 51% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), loaded_dice, Ascendance_Vers(6)
      0:49.884Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 102.8/250 41% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), loaded_dice, Ascendance_Vers(6)
      0:50.689Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 113.7/250 45% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, loaded_dice, Ascendance_Vers(6)
      0:51.495Tpistol_shot
      [stealth]
      Fluffy_Pillow 124.6/250 50% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, loaded_dice, Ascendance_Vers(6)
      0:52.299Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 130.3/250 52% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, audacity, loaded_dice, Ascendance_Vers(6)
      0:53.103Uambush
      [stealth]
      Fluffy_Pillow 127.1/250 51% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, audacity, loaded_dice, Ascendance_Vers(6)
      0:53.908Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 119.0/250 48% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, loaded_dice, Ascendance_Vers(6)
      0:54.712Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 125.8/250 50% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), loaded_dice, Ascendance_Vers(6)
      0:55.516Gpistol_shot
      [build]
      Fluffy_Pillow 132.7/250 53% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), loaded_dice, Ascendance_Vers(6)
      0:56.320Qdispatch
      [finish]
      Fluffy_Pillow 154.6/250 62% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), audacity, loaded_dice, Ascendance_Haste(7)
      0:57.124Fambush
      [build]
      Fluffy_Pillow 151.8/250 61% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), audacity, loaded_dice, Ascendance_Haste(7)
      0:57.929Qdispatch
      [finish]
      Fluffy_Pillow 133.9/250 54% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), loaded_dice, Ascendance_Haste(7)
      0:58.733Lroll_the_bones
      [cds]
      Acýs 131.1/250 52% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), loaded_dice, Ascendance_Haste(7)
      0:59.538Gpistol_shot
      [build]
      Fluffy_Pillow 128.3/250 51% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), Ascendance_Haste(7)
      1:00.342Qdispatch
      [finish]
      Fluffy_Pillow 150.4/250 60% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), audacity, Ascendance_Haste(7)
      1:01.146Mghostly_strike
      [cds]
      Fluffy_Pillow 147.6/250 59% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(6), audacity, Ascendance_Haste(7)
      1:01.146Fambush
      [build]
      Fluffy_Pillow 112.6/250 45% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(6), audacity, Ascendance_Haste(7)
      1:01.951Qdispatch
      [finish]
      Fluffy_Pillow 84.7/250 34% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(6), Ascendance_Haste(7)
      1:02.754Gpistol_shot
      [build]
      Fluffy_Pillow 71.9/250 29% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(7), fatebound_lucky_coin, Ascendance_Haste(7)
      1:03.557Qdispatch
      [finish]
      Fluffy_Pillow 200.0/200 100% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(7), fatebound_lucky_coin, audacity, Ascendance_Haste(7)
      1:04.562Kadrenaline_rush
      [cds]
      Acýs 200.0/200 100% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, buried_treasure, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(8), fatebound_lucky_coin, audacity, Ascension_Mastery(8)
      1:04.562Vvanish
      [stealth_cds]
      Acýs 200.0/250 80% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(8), fatebound_lucky_coin, edge_case, audacity, loaded_dice, Ascension_Mastery(8)
      1:04.562Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 200.0/250 80% energy
      7.0/7 100% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise_aura, broadside, buried_treasure, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(8), fatebound_lucky_coin, edge_case, double_jeopardy, audacity, loaded_dice, Ascension_Mastery(8)
      1:05.366Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 220.9/250 88% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(10), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Mastery(8)
      1:06.171Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 221.8/250 89% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(3), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Mastery(8)
      1:06.976Uambush
      [stealth]
      Fluffy_Pillow 232.6/250 93% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(4), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Mastery(8)
      1:07.781Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 208.5/250 83% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(4), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(8)
      1:08.586Uambush
      [stealth]
      Fluffy_Pillow 209.4/250 84% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(5), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(8)
      1:09.391Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 205.3/250 82% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(5), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(8)
      1:10.196Uambush
      [stealth]
      Fluffy_Pillow 206.2/250 82% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(6), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(8)
      1:11.001Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 182.1/250 73% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(6), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(8)
      1:11.806Qdispatch
      [finish]
      Fluffy_Pillow 191.8/250 77% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Mastery(8)
      1:12.611Mghostly_strike
      [cds]
      Fluffy_Pillow 178.6/250 71% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(9)
      1:12.611Gpistol_shot
      [build]
      Fluffy_Pillow 143.6/250 57% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(9)
      1:13.415Qdispatch
      [finish]
      Fluffy_Pillow 165.5/250 66% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(9)
      1:14.220Fambush
      [build]
      Fluffy_Pillow 172.3/250 69% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(9)
      1:15.024Qdispatch
      [finish]
      Fluffy_Pillow 154.2/250 62% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, loaded_dice, Ascension_Crit(9)
      1:15.828Gpistol_shot
      [build]
      Fluffy_Pillow 141.0/250 56% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, loaded_dice, Ascension_Crit(9)
      1:16.633Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 162.9/250 65% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(9)
      1:17.438Fambush
      [build]
      Fluffy_Pillow 159.8/250 64% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(9)
      1:18.242Qdispatch
      [finish]
      Fluffy_Pillow 141.6/250 57% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), fatebound_lucky_coin, loaded_dice, Ascension_Crit(9)
      1:19.047Gpistol_shot
      [build]
      Fluffy_Pillow 128.5/250 51% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascension_Crit(9)
      1:19.851Qdispatch
      [finish]
      Fluffy_Pillow 140.3/250 56% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(9)
      1:20.656Fambush
      [build]
      Fluffy_Pillow 127.5/250 51% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      1:21.460Qdispatch
      [finish]
      Fluffy_Pillow 99.8/250 40% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      1:22.263Gpistol_shot
      [build]
      Fluffy_Pillow 97.1/250 39% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      1:23.069Vvanish
      [stealth_cds]
      Acýs 119.4/250 48% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      1:23.069Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 119.4/250 48% energy
      7.0/7 100% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, take_em_by_surprise_aura, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, double_jeopardy, audacity, loaded_dice, Ascendance_Haste(10)
      1:23.875Uambush
      [stealth]
      Fluffy_Pillow 116.7/250 47% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      1:24.679Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 89.0/250 36% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      1:25.482Mghostly_strike
      [cds]
      Fluffy_Pillow 106.3/250 43% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      1:25.482Uambush
      [stealth]
      Fluffy_Pillow 71.3/250 29% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      1:26.286Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 53.6/250 21% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      1:27.093Uambush
      [stealth]
      Fluffy_Pillow 60.9/250 24% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      1:27.896Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 33.2/250 13% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      1:28.702Kadrenaline_rush
      [cds]
      Acýs 40.1/250 16% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      1:28.702Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 200.0/250 80% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, edge_case, loaded_dice, Ascendance_Vers(10)
      1:29.506Lroll_the_bones
      [cds]
      Acýs 196.8/250 79% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      1:30.311Jsinister_strike
      [build]
      Fluffy_Pillow 193.7/250 77% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Vers(10)
      1:31.116Jsinister_strike
      [build]
      Fluffy_Pillow 190.6/250 76% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Vers(10)
      1:31.920Jsinister_strike
      [build]
      Fluffy_Pillow 197.4/250 79% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Vers(10)
      1:32.724Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 174.3/250 70% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Vers(10)
      1:33.530Qdispatch
      [finish]
      Fluffy_Pillow 171.2/250 68% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, Ascendance_Vers(10)
      1:34.334Jsinister_strike
      [build]
      Fluffy_Pillow 158.0/250 63% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Vers(10)
      1:35.138Jsinister_strike
      [build]
      Fluffy_Pillow 134.8/250 54% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Vers(10)
      1:35.942Jsinister_strike
      [build]
      Fluffy_Pillow 111.7/250 45% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Vers(10)
      1:36.745Qdispatch
      [finish]
      Fluffy_Pillow 92.5/250 37% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, Ascension_Crit(10)
      1:37.551Gpistol_shot
      [build]
      Fluffy_Pillow 83.4/250 33% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, Ascension_Crit(10)
      1:38.355Qdispatch
      [finish]
      Fluffy_Pillow 109.3/250 44% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, Ascension_Crit(10)
      1:39.159Fambush
      [build]
      Fluffy_Pillow 100.1/250 40% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, Ascension_Crit(10)
      1:39.962Qdispatch
      [finish]
      Fluffy_Pillow 106.0/250 42% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, Ascension_Crit(10)
      1:40.765Gpistol_shot
      [build]
      Fluffy_Pillow 96.8/250 39% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, Ascension_Crit(10)
      1:41.569Vvanish
      [stealth_cds]
      Acýs 112.7/250 45% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, Ascension_Crit(10)
      1:41.569Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 112.7/250 45% energy
      7.0/7 100% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, take_em_by_surprise_aura, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, double_jeopardy, audacity, Ascension_Crit(10)
      1:42.376Mghostly_strike
      [cds]
      Fluffy_Pillow 113.6/250 45% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), fatebound_lucky_coin, audacity, Ascension_Crit(10)
      1:42.376Uambush
      [stealth]
      Fluffy_Pillow 78.6/250 31% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), fatebound_lucky_coin, audacity, Ascension_Crit(10)
      1:43.180Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 54.5/250 22% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), fatebound_lucky_coin, Ascension_Crit(10)
      1:43.985Tpistol_shot
      [stealth]
      Fluffy_Pillow 75.2/250 30% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, grand_melee, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, Ascension_Crit(10)
      1:44.790Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 117.0/250 47% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, audacity, Ascension_Crit(10)
      1:45.593Uambush
      [stealth]
      Fluffy_Pillow 123.8/250 50% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, audacity, Ascension_Crit(10)
      1:46.396Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 108.2/250 43% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, Ascension_Crit(10)
      1:47.201Tpistol_shot
      [stealth]
      Fluffy_Pillow 109.1/250 44% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, Ascension_Crit(10)
      1:48.006Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 155.0/250 62% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, Ascension_Crit(10)
      1:48.811Fambush
      [build]
      Fluffy_Pillow 155.9/250 62% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, audacity, Ascension_Crit(10)
      1:49.615Qdispatch
      [finish]
      Fluffy_Pillow 131.7/250 53% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, Ascension_Crit(10)
      1:50.419Gpistol_shot
      [build]
      Fluffy_Pillow 122.6/250 49% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, Ascension_Crit(10)
      1:51.222Qdispatch
      [finish]
      Fluffy_Pillow 148.4/250 59% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, Ascension_Crit(10)
      1:52.027Fambush
      [build]
      Fluffy_Pillow 139.3/250 56% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      1:52.833Jsinister_strike
      [build]
      Fluffy_Pillow 125.2/250 50% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, Ascendance_Vers(10)
      1:53.638Qdispatch
      [finish]
      Fluffy_Pillow 106.1/250 42% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, Ascendance_Vers(10)
      1:54.444Gpistol_shot
      [build]
      Fluffy_Pillow 104.3/250 42% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(4), fatebound_lucky_coin, Ascendance_Vers(10)
      1:55.248Qdispatch
      [finish]
      Fluffy_Pillow 200.0/200 100% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, take_em_by_surprise, broadside, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(4), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      1:56.252Fambush
      [build]
      Fluffy_Pillow 193.2/200 97% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, take_em_by_surprise, broadside, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(5), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      1:57.258Qdispatch
      [finish]
      Fluffy_Pillow 171.4/200 86% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(5), fatebound_lucky_coin, Ascendance_Vers(10)
      1:58.263Gpistol_shot
      [build]
      Fluffy_Pillow 174.6/200 87% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(6), fatebound_lucky_coin, Ascendance_Vers(10)
      1:59.268Qdispatch
      [finish]
      Fluffy_Pillow 192.8/200 96% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, take_em_by_surprise, broadside, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(6), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      2:00.272Mghostly_strike
      [cds]
      Fluffy_Pillow 176.0/200 88% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, take_em_by_surprise, ruthless_precision, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(7), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      2:00.272Fambush
      [build]
      Fluffy_Pillow 141.0/200 70% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, take_em_by_surprise, ruthless_precision, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(7), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      2:01.277Qdispatch
      [finish]
      Fluffy_Pillow 119.2/200 60% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, ruthless_precision, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(7), fatebound_lucky_coin, Ascendance_Vers(10)
      2:02.281Gpistol_shot
      [build]
      Fluffy_Pillow 111.2/200 56% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, opportunity(3), broadside, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, Ascendance_Vers(10)
      2:03.285Qdispatch
      [finish]
      Fluffy_Pillow 117.7/200 59% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, broadside, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      2:04.290Kadrenaline_rush
      [cds]
      Acýs 99.3/200 50% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, broadside, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      2:04.290Lroll_the_bones
      [cds]
      Acýs 99.3/250 40% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, broadside, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, edge_case, audacity, loaded_dice, Ascendance_Vers(10)
      2:05.173Vvanish
      [stealth_cds]
      Acýs 106.1/250 42% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, broadside, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, edge_case, audacity, Ascendance_Vers(10)
      2:05.173Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 106.1/250 42% energy
      7.0/7 100% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, take_em_by_surprise_aura, broadside, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, edge_case, double_jeopardy, audacity, Ascendance_Vers(10)
      2:05.976Uambush
      [stealth]
      Fluffy_Pillow 102.9/250 41% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(4), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      2:06.781Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 74.8/250 30% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(4), fatebound_coin_tails(2), fatebound_lucky_coin, Ascendance_Vers(10)
      2:07.587Uambush
      [stealth]
      Fluffy_Pillow 81.7/250 33% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(3), fatebound_lucky_coin, Ascendance_Vers(10)
      2:08.392Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 63.5/250 25% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(3), fatebound_lucky_coin, Ascension_Crit(10)
      2:09.195Uambush
      [stealth]
      Fluffy_Pillow 70.3/250 28% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, Ascension_Crit(10)
      2:10.000Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 52.2/250 21% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, Ascension_Crit(10)
      2:10.806Uambush
      [stealth]
      Fluffy_Pillow 69.1/250 28% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, Ascension_Crit(10)
      2:11.610Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 40.9/250 16% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, Ascension_Crit(10)
      2:12.416Qdispatch
      [finish]
      Fluffy_Pillow 47.8/250 19% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, Ascension_Crit(10)
      2:13.220Gpistol_shot
      [build]
      Fluffy_Pillow 38.7/250 15% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, Ascension_Crit(10)
      2:14.025Qdispatch
      [finish]
      Fluffy_Pillow 64.6/250 26% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, Ascension_Crit(10)
      2:14.829Fambush
      [build]
      Fluffy_Pillow 55.4/250 22% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, audacity, Ascension_Crit(10)
      2:16.115Jsinister_strike
      [build]
      Fluffy_Pillow 46.9/250 19% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Haste(10)
      2:17.260Qdispatch
      [finish]
      Fluffy_Pillow 39.3/250 16% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Haste(10)
      2:18.065Mghostly_strike
      [cds]
      Fluffy_Pillow 40.7/250 16% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, Ascendance_Haste(10)
      2:18.763Gpistol_shot
      [build]
      Fluffy_Pillow 38.5/250 15% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, Ascendance_Haste(10)
      2:19.569Qdispatch
      [finish]
      Fluffy_Pillow 54.9/250 22% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      2:20.627Fambush
      [build]
      Fluffy_Pillow 53.4/250 21% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      2:21.825Jsinister_strike
      [build]
      Fluffy_Pillow 46.6/250 19% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, Ascendance_Haste(10)
      2:22.630Wshadowmeld
      [stealth_cds]
      Fluffy_Pillow 33.9/250 14% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, Ascendance_Haste(10)
      2:22.793Sdispatch
      [stealth]
      Fluffy_Pillow 38.5/250 15% energy
      7.0/7 100% CP
      shadowmeld, slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, Ascendance_Haste(10)
      2:23.599Gpistol_shot
      [build]
      Fluffy_Pillow 35.8/250 14% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(4), fatebound_lucky_coin, Ascendance_Haste(10)
      2:24.402Vvanish
      [stealth_cds]
      Acýs 57.8/250 23% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(4), fatebound_lucky_coin, audacity, Ascension_Mastery(10)
      2:24.402Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 57.8/250 23% energy
      6.0/7 86% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, take_em_by_surprise_aura, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(4), fatebound_lucky_coin, double_jeopardy, audacity, Ascension_Mastery(10)
      2:25.206Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 54.7/250 22% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(6), fatebound_lucky_coin, audacity, Ascension_Mastery(10)
      2:26.011Uambush
      [stealth]
      Fluffy_Pillow 51.5/250 21% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, audacity, Ascension_Mastery(10)
      2:26.816Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 33.4/250 13% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, Ascension_Mastery(10)
      2:27.619Uambush
      [stealth]
      Fluffy_Pillow 50.2/250 20% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), fatebound_lucky_coin, Ascension_Mastery(10)
      2:28.424Gpistol_shot
      [build]
      Fluffy_Pillow 22.1/250 9% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), fatebound_lucky_coin, Ascension_Mastery(10)
      2:29.230Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 44.0/250 18% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), fatebound_lucky_coin, audacity, Ascension_Mastery(10)
      2:30.034Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 50.8/250 20% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(3), fatebound_lucky_coin, audacity, Ascension_Mastery(10)
      2:30.838Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 57.7/250 23% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, audacity, Ascension_Mastery(10)
      2:31.644Fambush
      [build]
      Fluffy_Pillow 74.6/250 30% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, Ascension_Mastery(10)
      2:32.449Qdispatch
      [finish]
      Fluffy_Pillow 56.7/250 23% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, Ascendance_Haste(10)
      2:33.252Mghostly_strike
      [cds]
      Fluffy_Pillow 43.9/250 18% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, Ascendance_Haste(10)
      2:33.933Gpistol_shot
      [build]
      Fluffy_Pillow 27.8/250 11% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, Ascendance_Haste(10)
      2:34.737Lroll_the_bones
      [cds]
      Acýs 40.1/250 16% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      2:35.541Qdispatch
      [finish]
      Fluffy_Pillow 47.4/250 19% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      2:36.346Kadrenaline_rush
      [cds]
      Acýs 200.0/200 100% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      2:36.346Qdispatch
      [finish]
      Fluffy_Pillow 200.0/250 80% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, edge_case, audacity, loaded_dice, Ascendance_Haste(10)
      2:37.152Fambush
      [build]
      Fluffy_Pillow 197.3/250 79% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_coin_tails, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      2:37.957Qdispatch
      [finish]
      Fluffy_Pillow 189.6/250 76% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      2:38.761Gpistol_shot
      [build]
      Fluffy_Pillow 176.9/250 71% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      2:39.566Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 189.2/250 76% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      2:40.370Fambush
      [build]
      Fluffy_Pillow 186.5/250 75% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      2:41.175Gpistol_shot
      [build]
      Fluffy_Pillow 168.8/250 68% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      2:41.979Qdispatch
      [finish]
      Fluffy_Pillow 191.1/250 76% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      2:42.783Fambush
      [build]
      Fluffy_Pillow 178.4/250 71% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(4), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      2:43.588Qdispatch
      [finish]
      Fluffy_Pillow 154.7/250 62% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(4), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      2:44.392Gpistol_shot
      [build]
      Fluffy_Pillow 156.0/250 62% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      2:45.195Qdispatch
      [finish]
      Fluffy_Pillow 170.3/250 68% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), broadside, buried_treasure, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      2:46.060Fambush
      [build]
      Fluffy_Pillow 181.4/250 73% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), broadside, buried_treasure, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      2:46.925Qdispatch
      [finish]
      Fluffy_Pillow 157.5/250 63% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), broadside, buried_treasure, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      2:47.791Gpistol_shot
      [build]
      Fluffy_Pillow 158.7/250 63% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), broadside, buried_treasure, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      2:48.658Qdispatch
      [finish]
      Fluffy_Pillow 164.5/250 66% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, broadside, buried_treasure, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Vers(10)
      2:49.543Fambush
      [build]
      Fluffy_Pillow 165.8/250 66% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, broadside, buried_treasure, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Vers(10)
      2:50.426Vvanish
      [stealth_cds]
      Acýs 152.0/250 61% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), broadside, buried_treasure, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      2:50.426Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 152.0/250 61% energy
      7.0/7 100% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise_aura, broadside, buried_treasure, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, double_jeopardy, loaded_dice, Ascendance_Vers(10)
      2:51.232Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 150.7/250 60% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(4), fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      2:52.033Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 147.5/250 59% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      2:52.838Mghostly_strike
      [cds]
      Fluffy_Pillow 164.4/250 66% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      2:52.838Uambush
      [stealth]
      Fluffy_Pillow 139.4/250 56% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      2:53.643Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 111.2/250 44% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      2:54.449Uambush
      [stealth]
      Fluffy_Pillow 138.1/250 55% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      2:55.253Uambush
      [stealth]
      Fluffy_Pillow 110.0/250 44% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      2:56.056Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 81.8/250 33% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      2:56.860Gpistol_shot
      [build]
      Fluffy_Pillow 78.6/250 31% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      2:57.662Qdispatch
      [finish]
      Fluffy_Pillow 110.4/250 44% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      2:58.467Fambush
      [build]
      Fluffy_Pillow 117.3/250 47% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      2:59.271Qdispatch
      [finish]
      Fluffy_Pillow 89.1/250 36% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:00.076Gpistol_shot
      [build]
      Fluffy_Pillow 76.0/250 30% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:00.880Qdispatch
      [finish]
      Fluffy_Pillow 97.8/250 39% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      3:01.684Fambush
      [build]
      Fluffy_Pillow 94.7/250 38% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      3:02.488Qdispatch
      [finish]
      Fluffy_Pillow 200.0/200 100% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:03.492Gpistol_shot
      [build]
      Fluffy_Pillow 183.2/200 92% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:04.496Qdispatch
      [finish]
      Fluffy_Pillow 200.0/200 100% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, take_em_by_surprise, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Vers(10)
      3:05.499Lroll_the_bones
      [cds]
      Acýs 193.2/200 97% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, take_em_by_surprise, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(6), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Vers(10)
      3:06.504Fambush
      [build]
      Fluffy_Pillow 186.4/200 93% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, take_em_by_surprise, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(6), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      3:07.509Qdispatch
      [finish]
      Fluffy_Pillow 154.6/200 77% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(6), fatebound_lucky_coin, Ascendance_Vers(10)
      3:08.512Gpistol_shot
      [build]
      Fluffy_Pillow 137.7/200 69% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(7), fatebound_lucky_coin, Ascendance_Vers(10)
      3:09.516Qdispatch
      [finish]
      Fluffy_Pillow 165.9/200 83% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, take_em_by_surprise, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(7), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      3:10.522Kadrenaline_rush
      [cds]
      Acýs 149.0/200 74% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(8), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      3:10.522Vvanish
      [stealth_cds]
      Acýs 149.0/250 60% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(8), fatebound_lucky_coin, edge_case, audacity, loaded_dice, Ascendance_Vers(10)
      3:10.522Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 149.0/250 60% energy
      7.0/7 100% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, take_em_by_surprise_aura, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(8), fatebound_lucky_coin, edge_case, double_jeopardy, audacity, loaded_dice, Ascendance_Vers(10)
      3:11.327Mghostly_strike
      [cds]
      Fluffy_Pillow 145.8/250 58% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(10), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Vers(10)
      3:11.327Uambush
      [stealth]
      Fluffy_Pillow 110.8/250 44% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(10), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Vers(10)
      3:12.133Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 92.7/250 37% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(10), fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      3:12.938Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 89.6/250 36% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(3), fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      3:13.744Uambush
      [stealth]
      Fluffy_Pillow 86.5/250 35% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(4), fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      3:14.548Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 58.3/250 23% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(4), fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      3:15.353Uambush
      [stealth]
      Fluffy_Pillow 65.2/250 26% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(5), fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      3:16.159Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 47.1/250 19% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(5), fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      3:16.965Gpistol_shot
      [build]
      Fluffy_Pillow 44.0/250 18% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Vers(10)
      3:17.770Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 55.9/250 22% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Vers(10)
      3:18.574Qdispatch
      [finish]
      Fluffy_Pillow 52.7/250 21% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Vers(10)
      3:19.380Fambush
      [build]
      Fluffy_Pillow 59.6/250 24% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Vers(10)
      3:20.799Jsinister_strike
      [build]
      Fluffy_Pillow 48.1/250 19% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:21.605Qdispatch
      [finish]
      Fluffy_Pillow 39.1/250 16% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:22.621Jsinister_strike
      [build]
      Fluffy_Pillow 46.8/250 19% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:23.426Jsinister_strike
      [build]
      Fluffy_Pillow 47.6/250 19% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:24.544Jsinister_strike
      [build]
      Fluffy_Pillow 48.6/250 19% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:25.349Qdispatch
      [finish]
      Fluffy_Pillow 39.5/250 16% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:26.154Mghostly_strike
      [cds]
      Fluffy_Pillow 60.4/250 24% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:26.327Gpistol_shot
      [build]
      Fluffy_Pillow 31.0/250 12% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:27.132Vvanish
      [stealth_cds]
      Acýs 66.8/250 27% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      3:27.132Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 66.8/250 27% energy
      6.0/7 86% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, take_em_by_surprise_aura, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, double_jeopardy, audacity, loaded_dice, Ascension_Crit(10)
      3:27.938Uambush
      [stealth]
      Fluffy_Pillow 87.8/250 35% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      3:28.741Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 74.0/250 30% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      3:29.545Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 81.6/250 33% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      3:30.349Tpistol_shot
      [stealth]
      Fluffy_Pillow 88.9/250 36% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      3:31.155Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 111.2/250 44% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      3:31.961Uambush
      [stealth]
      Fluffy_Pillow 118.5/250 47% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      3:32.766Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 110.8/250 44% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      3:33.569Gpistol_shot
      [build]
      Fluffy_Pillow 128.1/250 51% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      3:34.374Qdispatch
      [finish]
      Fluffy_Pillow 130.4/250 52% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      3:35.177Gpistol_shot
      [build]
      Fluffy_Pillow 117.7/250 47% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      3:35.983Lroll_the_bones
      [cds]
      Acýs 140.0/250 56% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      3:36.790Qdispatch
      [finish]
      Fluffy_Pillow 137.4/250 55% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      3:37.594Fambush
      [build]
      Fluffy_Pillow 124.7/250 50% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      3:38.399Jsinister_strike
      [build]
      Fluffy_Pillow 107.0/250 43% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, Ascendance_Haste(10)
      3:39.204Qdispatch
      [finish]
      Fluffy_Pillow 84.3/250 34% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, Ascendance_Haste(10)
      3:40.006Gpistol_shot
      [build]
      Fluffy_Pillow 81.5/250 33% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, Ascendance_Haste(10)
      3:40.811Mghostly_strike
      [cds]
      Fluffy_Pillow 113.8/250 46% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      3:40.827Qdispatch
      [finish]
      Fluffy_Pillow 79.3/250 32% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      3:41.631Fambush
      [build]
      Fluffy_Pillow 66.5/250 27% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      3:42.434Qdispatch
      [finish]
      Fluffy_Pillow 200.0/200 100% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), fatebound_lucky_coin, Ascendance_Haste(10)
      3:43.437Kadrenaline_rush
      [cds]
      Acýs 200.0/200 100% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Haste(10)
      3:43.437Vvanish
      [stealth_cds]
      Acýs 200.0/250 80% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, edge_case, loaded_dice, Ascendance_Haste(10)
      3:43.437Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 200.0/250 80% energy
      7.0/7 100% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise_aura, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, edge_case, double_jeopardy, loaded_dice, Ascendance_Haste(10)
      3:44.242Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 207.2/250 83% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), fatebound_coin_tails(3), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(10)
      3:45.047Uambush
      [stealth]
      Fluffy_Pillow 204.0/250 82% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(4), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(10)
      3:45.851Uambush
      [stealth]
      Fluffy_Pillow 175.9/250 70% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(4), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(10)
      3:46.655Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 147.7/250 59% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(4), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(10)
      3:47.458Uambush
      [stealth]
      Fluffy_Pillow 144.5/250 58% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Mastery(10)
      3:48.262Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 116.4/250 47% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Mastery(10)
      3:49.066Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 123.2/250 49% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(10)
      3:49.870Gpistol_shot
      [build]
      Fluffy_Pillow 120.1/250 48% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascension_Mastery(10)
      3:50.675Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 141.9/250 57% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, audacity, loaded_dice, Ascension_Mastery(10)
      3:51.481Fambush
      [build]
      Fluffy_Pillow 138.8/250 56% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, loaded_dice, Ascension_Mastery(10)
      3:52.285Gpistol_shot
      [build]
      Fluffy_Pillow 124.7/250 50% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:53.090Qdispatch
      [finish]
      Fluffy_Pillow 150.6/250 60% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:53.895Jsinister_strike
      [build]
      Fluffy_Pillow 151.5/250 61% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:54.698Jsinister_strike
      [build]
      Fluffy_Pillow 132.3/250 53% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:55.502Jsinister_strike
      [build]
      Fluffy_Pillow 133.2/250 53% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:56.305Jsinister_strike
      [build]
      Fluffy_Pillow 124.0/250 50% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:57.110Qdispatch
      [finish]
      Fluffy_Pillow 114.9/250 46% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:57.915Gpistol_shot
      [build]
      Fluffy_Pillow 105.8/250 42% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      3:58.719Qdispatch
      [finish]
      Fluffy_Pillow 121.6/250 49% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      3:59.523Mghostly_strike
      [cds]
      Fluffy_Pillow 112.3/250 45% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      3:59.523Fambush
      [build]
      Fluffy_Pillow 77.3/250 31% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      4:00.326Qdispatch
      [finish]
      Fluffy_Pillow 63.3/250 25% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(3), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:01.129Jsinister_strike
      [build]
      Fluffy_Pillow 64.6/250 26% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(4), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:01.934Jsinister_strike
      [build]
      Fluffy_Pillow 65.9/250 26% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, skull_and_crossbones, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(4), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:02.738Qdispatch
      [finish]
      Fluffy_Pillow 47.2/250 19% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(4), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:03.543Gpistol_shot
      [build]
      Fluffy_Pillow 48.3/250 19% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), broadside, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(5), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:04.409Qdispatch
      [finish]
      Fluffy_Pillow 64.4/250 26% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, broadside, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(5), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      4:05.274Fambush
      [build]
      Fluffy_Pillow 55.5/250 22% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(6), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      4:06.140Lroll_the_bones
      [cds]
      Acýs 31.7/250 13% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, buried_treasure, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(6), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:07.542Jsinister_strike
      [build]
      Fluffy_Pillow 59.0/250 24% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(6), fatebound_lucky_coin, Ascendance_Haste(10)
      4:08.407Vvanish
      [stealth_cds]
      Acýs 40.1/250 16% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(6), fatebound_lucky_coin, Ascendance_Haste(10)
      4:08.407Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 40.1/250 16% energy
      7.0/7 100% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise_aura, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(6), fatebound_lucky_coin, double_jeopardy, Ascendance_Haste(10)
      4:09.213Gpistol_shot
      [build]
      Fluffy_Pillow 41.5/250 17% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(8), fatebound_lucky_coin, Ascendance_Haste(10)
      4:10.017Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 57.8/250 23% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(8), fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      4:10.822Uambush
      [stealth]
      Fluffy_Pillow 59.1/250 24% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, audacity, Ascendance_Haste(10)
      4:11.880Uambush
      [stealth]
      Fluffy_Pillow 53.8/250 22% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, Ascendance_Haste(10)
      4:12.683Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 40.0/250 16% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, Ascendance_Haste(10)
      4:13.489Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 51.4/250 21% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Haste(10)
      4:14.295Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 52.8/250 21% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, Ascendance_Haste(10)
      4:15.100Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 64.1/250 26% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, Ascendance_Haste(10)
      4:15.903Mghostly_strike
      [cds]
      Fluffy_Pillow 200.0/200 100% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, take_em_by_surprise, buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, Ascendance_Haste(10)
      4:15.903Jsinister_strike
      [build]
      Fluffy_Pillow 165.0/200 82% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, take_em_by_surprise, buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, Ascendance_Haste(10)
      4:16.907Qdispatch
      [finish]
      Fluffy_Pillow 143.6/200 72% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, Ascendance_Haste(10)
      4:17.910Kadrenaline_rush
      [cds]
      Acýs 152.1/200 76% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Haste(10)
      4:17.910Qdispatch
      [finish]
      Fluffy_Pillow 152.1/250 61% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, edge_case, loaded_dice, Ascendance_Haste(10)
      4:18.716Gpistol_shot
      [build]
      Fluffy_Pillow 143.5/250 57% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:19.520Qdispatch
      [finish]
      Fluffy_Pillow 179.8/250 72% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:20.325Jsinister_strike
      [build]
      Fluffy_Pillow 181.1/250 72% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:21.128Gpistol_shot
      [build]
      Fluffy_Pillow 162.4/250 65% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:21.934Qdispatch
      [finish]
      Fluffy_Pillow 198.8/250 80% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      4:22.739Fambush
      [build]
      Fluffy_Pillow 200.1/250 80% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      4:23.544Wshadowmeld
      [stealth_cds]
      Fluffy_Pillow 176.4/250 71% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:23.544Sdispatch
      [stealth]
      Fluffy_Pillow 176.4/250 71% energy
      7.0/7 100% CP
      shadowmeld, slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, ruthless_precision, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:24.350Gpistol_shot
      [build]
      Fluffy_Pillow 177.6/250 71% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      4:25.153Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 183.4/250 73% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      4:25.957Qdispatch
      [finish]
      Fluffy_Pillow 194.3/250 78% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails, fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      4:26.762Fambush
      [build]
      Fluffy_Pillow 195.2/250 78% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, take_em_by_surprise, broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      4:27.565Qdispatch
      [finish]
      Fluffy_Pillow 171.0/250 68% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      4:28.369Gpistol_shot
      [build]
      Fluffy_Pillow 171.9/250 69% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      4:29.174Qdispatch
      [finish]
      Fluffy_Pillow 185.9/250 74% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      4:30.058Fambush
      [build]
      Fluffy_Pillow 177.1/250 71% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), broadside, buried_treasure, grand_melee, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Crit(10)
      4:30.940Qdispatch
      [finish]
      Fluffy_Pillow 163.3/250 65% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      4:31.823Mghostly_strike
      [cds]
      Fluffy_Pillow 164.5/250 66% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      4:31.823Gpistol_shot
      [build]
      Fluffy_Pillow 129.5/250 52% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      4:32.707Qdispatch
      [finish]
      Fluffy_Pillow 175.8/250 70% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Mastery(10)
      4:33.592Fambush
      [build]
      Fluffy_Pillow 167.1/250 67% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, audacity, loaded_dice, Ascension_Mastery(10)
      4:34.476Jsinister_strike
      [build]
      Fluffy_Pillow 143.3/250 57% energy
      4.0/7 57% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(10)
      4:35.360Jsinister_strike
      [build]
      Fluffy_Pillow 134.6/250 54% energy
      5.0/7 71% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, buried_treasure, grand_melee, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(10)
      4:36.242Lroll_the_bones
      [cds]
      Acýs 135.3/250 54% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), true_bearing, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, loaded_dice, Ascension_Mastery(10)
      4:37.126Vvanish
      [stealth_cds]
      Acýs 152.1/250 61% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, Ascension_Mastery(10)
      4:37.126Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 152.1/250 61% energy
      7.0/7 100% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise_aura, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, double_jeopardy, Ascension_Mastery(10)
      4:37.932Uambush
      [stealth]
      Fluffy_Pillow 149.0/250 60% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, true_bearing, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), fatebound_lucky_coin, Ascension_Mastery(10)
      4:38.736Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 130.8/250 52% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails(2), fatebound_lucky_coin, Ascension_Mastery(10)
      4:39.540Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 127.7/250 51% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, Ascension_Mastery(10)
      4:40.345Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 124.5/250 50% energy
      6.0/7 86% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(2), fatebound_lucky_coin, Ascendance_Vers(10)
      4:41.151Tpistol_shot
      [stealth]
      Fluffy_Pillow 131.4/250 53% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, Ascendance_Vers(10)
      4:41.955Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 163.3/250 65% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      4:42.758Uambush
      [stealth]
      Fluffy_Pillow 170.1/250 68% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads, fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      4:43.564Qdispatch
      [finish]
      Fluffy_Pillow 142.0/250 57% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, Ascendance_Vers(10)
      4:44.367Gpistol_shot
      [build]
      Fluffy_Pillow 200.0/200 100% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, Ascendance_Vers(10)
      4:45.372Qdispatch
      [finish]
      Fluffy_Pillow 200.0/200 100% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(2), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      4:46.377Fambush
      [build]
      Fluffy_Pillow 193.2/200 97% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, audacity, Ascendance_Vers(10)
      4:47.382Qdispatch
      [finish]
      Fluffy_Pillow 171.4/200 86% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(3), fatebound_lucky_coin, Ascendance_Vers(10)
      4:48.387Gpistol_shot
      [build]
      Fluffy_Pillow 154.6/200 77% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, Ascension_Crit(10)
      4:49.392Qdispatch
      [finish]
      Fluffy_Pillow 162.8/200 81% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(4), fatebound_lucky_coin, audacity, Ascension_Crit(10)
      4:50.396Mghostly_strike
      [cds]
      Fluffy_Pillow 146.0/200 73% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), fatebound_lucky_coin, audacity, Ascension_Crit(10)
      4:50.396Fambush
      [build]
      Fluffy_Pillow 111.0/200 55% energy
      3.0/7 43% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), fatebound_lucky_coin, audacity, Ascension_Crit(10)
      4:51.400Qdispatch
      [finish]
      Fluffy_Pillow 89.2/200 45% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(5), fatebound_lucky_coin, Ascension_Crit(10)
      4:52.405Kadrenaline_rush
      [cds]
      Acýs 72.4/200 36% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(6), fatebound_lucky_coin, Ascension_Crit(10)
      4:52.405Vvanish
      [stealth_cds]
      Acýs 72.4/250 29% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(6), fatebound_lucky_coin, edge_case, loaded_dice, Ascension_Crit(10)
      4:52.405Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 72.4/250 29% energy
      7.0/7 100% CP
      slice_and_dice, vanish, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise_aura, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads(6), fatebound_lucky_coin, edge_case, double_jeopardy, loaded_dice, Ascension_Crit(10)
      4:53.211Uambush
      [stealth]
      Fluffy_Pillow 69.3/250 28% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(8), fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      4:54.016Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 41.1/250 16% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(8), fatebound_coin_tails(2), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      4:54.820Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 38.0/250 15% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(9), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      4:55.624Tpistol_shot
      [stealth]
      Fluffy_Pillow 34.8/250 14% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(10), fatebound_lucky_coin, loaded_dice, Ascension_Crit(10)
      4:56.428Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 86.9/250 35% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_heads(10), fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      4:57.235Uambush
      [stealth]
      Fluffy_Pillow 94.3/250 38% energy
      2.0/7 29% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)
      4:58.041Rbetween_the_eyes
      [stealth]
      Fluffy_Pillow 66.6/250 27% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), subterfuge, fatebound_coin_tails, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:58.845Gpistol_shot
      [build]
      Fluffy_Pillow 63.9/250 26% energy
      1.0/7 14% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(6), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, loaded_dice, Ascendance_Haste(10)
      4:59.649Pbetween_the_eyes
      [finish]
      Fluffy_Pillow 86.2/250 34% energy
      7.0/7 100% CP
      slice_and_dice, between_the_eyes, adrenaline_rush, opportunity(3), take_em_by_surprise, broadside, skull_and_crossbones, roll_the_bones, acrobatic_strikes(10), alacrity(5), fatebound_coin_heads, fatebound_lucky_coin, audacity, loaded_dice, Ascendance_Haste(10)

      Stats

      Level Bonus (80) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
      Strength14647-214645146450
      Agility176472395743833718863 (16835)
      Stamina86452019043118136386275
      Intellect12000012360120000
      Spirit00000
      Health380862036272600
      Energy2002000
      Combo Points770
      Spell Power12360120000
      Crit18.05%18.05%4932
      Haste9.65%9.65%5651
      Versatility18.27%11.65%6745
      Attack Power4253739275938
      Mastery26.26%22.66%3212
      Armor162871628716287
      Run Speed900
      Leech3.00%3.00%0

      Gear

      Source Slot Average Item Level: 562.00
      Local Head Underscout's Cap of the Quickblade (underscouts_cap)
      ilevel: 561, stats: { 1,977 Armor, +8,479 Sta, +1,835 AgiInt, +389 Crit, +972 Vers }
      Local Neck Flickering Glowtorc
      ilevel: 554, stats: { +4,620 Sta, +2,073 Crit, +1,014 Vers }
      Local Shoulders Underscout's Shoulderguards of the Peerless (underscouts_shoulderguards)
      ilevel: 561, stats: { 1,813 Armor, +6,359 Sta, +1,376 AgiInt, +729 Crit, +292 Mastery }
      Local Shirt Ooze-Soaked Shirt
      ilevel: 1
      Local Chest Seraphic Wraps of the Ordained
      ilevel: 554, stats: { 2,547 Armor, +8,213 Sta, +524 Haste, +809 Vers, +1,719 AgiInt }
      Local Waist Lockstitch Sash of the Feverflare (lockstitch_sash)
      ilevel: 584, stats: { 1,830 Armor, +8,186 Sta, +1,705 AgiInt, +407 Haste, +733 Mastery }
      Local Legs Underscout's Trousers of the Feverflare (underscouts_trousers)
      ilevel: 564, stats: { 2,342 Armor, +8,595 Sta, +1,887 AgiInt, +882 Haste, +490 Mastery }
      Local Feet Underscout's Striders of the Fireflash (underscouts_striders)
      ilevel: 561, stats: { 1,648 Armor, +6,359 Sta, +1,376 AgiInt, +437 Crit, +583 Haste }
      Local Wrists Treasure-Seeker's Bindings
      ilevel: 567, stats: { 1,498 Armor, +4,902 Sta, +423 Haste, +356 Mastery, +1,091 AgiInt }
      Local Hands Lockstitch Grips of the Quickblade (lockstitch_grips)
      ilevel: 577, stats: { 1,767 Armor, +7,311 Sta, +1,597 AgiInt, +780 Crit, +312 Vers }
      Local Finger1 Wick's Golden Loop
      ilevel: 541, stats: { +4,355 Sta, +1,910 Haste, +1,061 Vers }
      Local Finger2 Gem-Studded Band of the Harmonious (gemstudded_band)
      ilevel: 567, stats: { +4,902 Sta, +1,100 Mastery, +2,108 Vers }
      Local Trinket1 Sigil of Algari Concordance
      ilevel: 535, stats: { +1,369 StrAgiInt }
      item effects: { equip: Sigil of Algari Concordance }
      Local Trinket2 Darkmoon Deck: Ascension
      ilevel: 577, stats: { +2,024 StrAgiInt }
      item effects: { equip: Ascendance }
      Local Back Candlebearer's Shroud
      ilevel: 541, stats: { 865 Armor, +4,355 Sta, +253 Crit, +469 Vers, +856 StrAgiInt }
      Local Main Hand Ancient Forged Blade of the Fireflash (ancient_forged_blade)
      ilevel: 584, weapon: { 2,519 - 4,199, 2.6 }, stats: { +1,136 Agi, +5,457 Sta, +271 Crit, +489 Haste }, temporary_enchant: Ironclaw Sharpened Weapon
      Local Off Hand Underscout's Kukri of the Feverflare (underscouts_kukri)
      ilevel: 558, weapon: { 1,368 - 2,282, 1.8 }, stats: { +892 Agi, +4,182 Sta, +433 Haste, +241 Mastery }, temporary_enchant: Ironclaw Sharpened Weapon
      Local Tabard Nightfallen Tabard
      ilevel: 40

      Profile

      rogue="Acýs"
      source=blizzard
      origin="https://worldofwarcraft.com/en-gb/character/antonidas/ac%C3%BDs"
      spec=outlaw
      level=80
      race=night_elf
      timeofday=night
      role=attack
      position=back
      talents=CQQA27SZpS4XnmFfcXRqkppuwDAMwwYmZwMzwMMMzMzMjZmplZMLzAAAAAAgttxM8AzMjFmZZ2GAAAAzMDwAbwMGNmFAbTYxMA

      # Default consumables
      potion=tempered_potion_3
      flask=flask_of_tempered_versatility_3
      food=feast_of_the_divine_day
      augmentation=crystallized
      temporary_enchant=main_hand:ironclaw_whetstone_3/off_hand:ironclaw_whetstone_3

      # Executed before combat begins. Accepts non-harmful actions only.
      actions.precombat=apply_poison,nonlethal=none,lethal=instant
      actions.precombat+=/flask
      actions.precombat+=/augmentation
      actions.precombat+=/food
      actions.precombat+=/snapshot_stats
      actions.precombat+=/use_item,name=imperfect_ascendancy_serum
      actions.precombat+=/stealth,precombat_seconds=2
      actions.precombat+=/adrenaline_rush,precombat_seconds=2,if=talent.improved_adrenaline_rush&talent.keep_it_rolling&talent.loaded_dice
      actions.precombat+=/roll_the_bones,precombat_seconds=2
      actions.precombat+=/adrenaline_rush,precombat_seconds=1,if=talent.improved_adrenaline_rush
      actions.precombat+=/slice_and_dice,precombat_seconds=1

      # Executed every time the actor is available.
      actions=stealth
      actions+=/kick
      actions+=/variable,name=rtb_reroll,value=rtb_buffs.will_lose=(rtb_buffs.will_lose.buried_treasure+rtb_buffs.will_lose.grand_melee&spell_targets.blade_flurry<2&raid_event.adds.in>12&raid_event.adds.count<2)
      actions+=/variable,name=rtb_reroll,if=talent.loaded_dice,value=rtb_buffs.will_lose=buff.loaded_dice.up
      actions+=/variable,name=rtb_reroll,value=variable.rtb_reroll&rtb_buffs.longer=0|rtb_buffs.normal=0&rtb_buffs.longer>=1&rtb_buffs<6&rtb_buffs.max_remains<=39&!stealthed.all&buff.loaded_dice.up
      actions+=/variable,name=rtb_reroll,op=reset,if=!(raid_event.adds.remains>12|raid_event.adds.up&(raid_event.adds.in-raid_event.adds.remains)<6|target.time_to_die>12)|fight_remains<12
      actions+=/variable,name=ambush_condition,value=(talent.hidden_opportunity|combo_points.deficit>=2+talent.improved_ambush+buff.broadside.up)&energy>=50
      actions+=/variable,name=finish_condition,value=effective_combo_points>=cp_max_spend-1-(stealthed.all&talent.crackshot|(talent.hand_of_fate|talent.flawless_form)&talent.hidden_opportunity&(buff.audacity.up|buff.opportunity.up))
      actions+=/variable,name=blade_flurry_sync,value=spell_targets.blade_flurry<2&raid_event.adds.in>20|buff.blade_flurry.remains>gcd
      actions+=/call_action_list,name=cds
      actions+=/call_action_list,name=stealth,if=stealthed.all
      actions+=/run_action_list,name=finish,if=variable.finish_condition
      actions+=/call_action_list,name=build
      actions+=/arcane_torrent,if=energy.base_deficit>=15+energy.regen
      actions+=/arcane_pulse
      actions+=/lights_judgment
      actions+=/bag_of_tricks

      actions.build=ambush,if=talent.hidden_opportunity&buff.audacity.up
      actions.build+=/pistol_shot,if=talent.fan_the_hammer&talent.audacity&talent.hidden_opportunity&buff.opportunity.up&!buff.audacity.up
      actions.build+=/pistol_shot,if=talent.fan_the_hammer&buff.opportunity.up&(buff.opportunity.stack>=buff.opportunity.max_stack|buff.opportunity.remains<2)
      actions.build+=/pistol_shot,if=talent.fan_the_hammer&buff.opportunity.up&(combo_points.deficit>=(1+(talent.quick_draw+buff.broadside.up)*(talent.fan_the_hammer.rank+1))|combo_points<=talent.ruthlessness)
      actions.build+=/pistol_shot,if=!talent.fan_the_hammer&buff.opportunity.up&(energy.base_deficit>energy.regen*1.5|combo_points.deficit<=1+buff.broadside.up|talent.quick_draw.enabled|talent.audacity.enabled&!buff.audacity.up)
      actions.build+=/pool_resource,for_next=1
      actions.build+=/ambush,if=talent.hidden_opportunity
      actions.build+=/sinister_strike

      actions.cds=adrenaline_rush,if=!buff.adrenaline_rush.up&(!variable.finish_condition|!talent.improved_adrenaline_rush)|stealthed.all&talent.crackshot&talent.improved_adrenaline_rush&combo_points<=2
      actions.cds+=/sprint,if=(trinket.1.is.scroll_of_momentum|trinket.2.is.scroll_of_momentum)&buff.full_momentum.up
      actions.cds+=/blade_flurry,if=spell_targets>=2&buff.blade_flurry.remains<gcd
      actions.cds+=/blade_flurry,if=talent.deft_maneuvers&!variable.finish_condition&(spell_targets>=3&combo_points.deficit=spell_targets+buff.broadside.up|spell_targets>=5)
      actions.cds+=/roll_the_bones,if=variable.rtb_reroll|rtb_buffs=0
      actions.cds+=/keep_it_rolling,if=rtb_buffs>=4&(rtb_buffs.min_remains<2|buff.broadside.up)
      actions.cds+=/ghostly_strike,if=combo_points<cp_max_spend
      actions.cds+=/use_item,name=imperfect_ascendancy_serum,if=!stealthed.all|fight_remains<=22
      actions.cds+=/use_item,name=mad_queens_mandate,if=!stealthed.all|fight_remains<=5
      actions.cds+=/killing_spree,if=variable.finish_condition&!stealthed.all
      actions.cds+=/call_action_list,name=stealth_cds,if=!stealthed.all&(!talent.crackshot|cooldown.between_the_eyes.ready)
      actions.cds+=/thistle_tea,if=!buff.thistle_tea.up&(energy.base_deficit>=150|fight_remains<charges*6)
      actions.cds+=/blade_rush,if=energy.base_time_to_max>4&!stealthed.all
      actions.cds+=/potion,if=buff.bloodlust.react|fight_remains<30|buff.adrenaline_rush.up
      actions.cds+=/blood_fury
      actions.cds+=/berserking
      actions.cds+=/fireblood
      actions.cds+=/ancestral_call
      actions.cds+=/use_items,slots=trinket1,if=buff.between_the_eyes.up|trinket.1.has_stat.any_dps|fight_remains<=20
      actions.cds+=/use_items,slots=trinket2,if=buff.between_the_eyes.up|trinket.2.has_stat.any_dps|fight_remains<=20

      actions.finish=between_the_eyes,if=!talent.crackshot&(buff.between_the_eyes.remains<4|talent.improved_between_the_eyes|talent.greenskins_wickers)&!buff.greenskins_wickers.up
      actions.finish+=/between_the_eyes,if=talent.crackshot&(cooldown.vanish.remains>45|talent.underhanded_upper_hand&talent.without_a_trace&(buff.adrenaline_rush.remains>12|buff.adrenaline_rush.down&cooldown.adrenaline_rush.remains>45))&(raid_event.adds.remains>8|raid_event.adds.in<raid_event.adds.remains|!raid_event.adds.up)
      actions.finish+=/slice_and_dice,if=buff.slice_and_dice.remains<fight_remains&refreshable
      actions.finish+=/cold_blood
      actions.finish+=/coup_de_grace
      actions.finish+=/dispatch

      actions.stealth=cold_blood,if=variable.finish_condition
      actions.stealth+=/pool_resource,for_next=1
      actions.stealth+=/between_the_eyes,if=variable.finish_condition&talent.crackshot&(!buff.shadowmeld.up|stealthed.rogue)
      actions.stealth+=/dispatch,if=variable.finish_condition
      actions.stealth+=/pistol_shot,if=talent.crackshot&talent.fan_the_hammer.rank>=2&buff.opportunity.stack>=6&(buff.broadside.up&combo_points<=1|buff.greenskins_wickers.up)
      actions.stealth+=/ambush,if=talent.hidden_opportunity

      actions.stealth_cds=vanish,if=talent.underhanded_upper_hand&talent.subterfuge&(buff.adrenaline_rush.up|!talent.without_a_trace&talent.crackshot)&(variable.finish_condition|!talent.crackshot&(variable.ambush_condition|!talent.hidden_opportunity))
      actions.stealth_cds+=/vanish,if=!talent.underhanded_upper_hand&talent.crackshot&variable.finish_condition
      actions.stealth_cds+=/vanish,if=!talent.underhanded_upper_hand&!talent.crackshot&talent.hidden_opportunity&!buff.audacity.up&buff.opportunity.stack<buff.opportunity.max_stack&variable.ambush_condition
      actions.stealth_cds+=/vanish,if=!talent.underhanded_upper_hand&!talent.crackshot&!talent.hidden_opportunity&talent.fateful_ending&(!buff.fatebound_lucky_coin.up&(buff.fatebound_coin_tails.stack>=5|buff.fatebound_coin_heads.stack>=5)|buff.fatebound_lucky_coin.up&!cooldown.between_the_eyes.ready)
      actions.stealth_cds+=/vanish,if=!talent.underhanded_upper_hand&!talent.crackshot&!talent.hidden_opportunity&!talent.fateful_ending&talent.take_em_by_surprise&!buff.take_em_by_surprise.up
      actions.stealth_cds+=/shadowmeld,if=variable.finish_condition&!cooldown.vanish.ready

      head=underscouts_cap,id=224602,bonus_id=10288/6652/10876/1682/10844/1488
      neck=flickering_glowtorc,id=221103,bonus_id=11338/10386/6652/10395/10393
      shoulders=underscouts_shoulderguards,id=224607,bonus_id=10288/6652/1683/10844/1488
      back=candlebearers_shroud,id=221109,bonus_id=10385/10387/6652/10375,drop_level=78
      chest=seraphic_wraps_of_the_ordained,id=221130,bonus_id=10385/10387/6652/10375,drop_level=80
      shirt=oozesoaked_shirt,id=98084
      tabard=nightfallen_tabard,id=140575
      wrists=treasureseekers_bindings,id=211020,bonus_id=10286/6652/10877/11215/10375/3146
      hands=lockstitch_grips,id=224676,bonus_id=10295/6652/1676/1649/10254
      waist=lockstitch_sash,id=224680,bonus_id=10281/6652/10876/1702/1656/10255/10377
      legs=underscouts_trousers,id=224603,bonus_id=10287/6652/1698/10844/1491
      feet=underscouts_striders,id=224600,bonus_id=10288/6652/1694/10844/1488
      finger1=wicks_golden_loop,id=221099,bonus_id=10385/10387/6652/10395/10392,drop_level=78
      finger2=gemstudded_band,id=224660,bonus_id=10286/6652/10395/10393/1782/1639
      trinket1=sigil_of_algari_concordance,id=219295,bonus_id=10385/10387/6652,drop_level=77
      trinket2=darkmoon_deck_ascension,id=222680
      main_hand=ancient_forged_blade,id=224702,bonus_id=10281/6652/1695/1656/10255
      off_hand=underscouts_kukri,id=224632,bonus_id=10289/6652/1698/10844/1485

      # Gear Summary
      # gear_ilvl=561.63
      # gear_agility=18863
      # gear_stamina=86275
      # gear_attack_power=938
      # gear_crit_rating=4932
      # gear_haste_rating=5651
      # gear_mastery_rating=3212
      # gear_versatility_rating=6745
      # gear_armor=16287

      Simulation & Raid Information

      Iterations: 10023
      Threads: 24
      Confidence: 95.00%
      Fight Length (fixed time): 240 - 360 ( 300.0 )

      Performance:

      Total Events Processed: 47124468
      Max Event Queue: 163
      Sim Seconds: 3007016
      CPU Seconds: 80.2403
      Physical Seconds: 12.4552
      Speed Up: 37475

      Settings:

      World Lag: 100 ms ( stddev = 10 ms )
      Queue Lag: 5 ms ( stddev = 1 ms )

      Raw Ability Summary

      Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
      Acýs Acýs adrenaline_rush 13750 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 33.69sec 0 300.01sec
      Acýs Acýs ambush 8676 15028110 50092 16.36 117368 246048 81.8 81.8 51.5% 0.0% 0.0% 0.0% 3.71sec 21468707 300.01sec
      Acýs Acýs ambush_hidden_opportunity 385897 4390693 14635 4.77 117359 246345 0.0 23.9 51.7% 0.0% 0.0% 0.0% 0.00sec 6272413 300.01sec
      Acýs Acýs ambush_hidden_opportunity_audacity 8676 3732479 12441 4.04 117824 247199 0.0 20.2 51.6% 0.0% 0.0% 0.0% 0.00sec 5332107 300.01sec
      Acýs Acýs augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
      Acýs Acýs auto_attack 0 0 0 0.00 0 0 19.1 0.0 0.0% 0.0% 0.0% 0.0% 16.57sec 0 300.01sec
      Acýs Acýs auto_attack_mh 0 12454596 41514 76.19 26683 53366 381.0 381.0 39.0% 16.4% 0.0% 0.0% 0.92sec 17792262 300.01sec
      Acýs Acýs auto_attack_oh 1 6022103 20073 109.94 8933 17864 549.7 549.7 39.0% 16.4% 0.0% 0.0% 0.63sec 8602996 300.01sec
      Acýs Acýs between_the_eyes 315341 41331242 137766 18.46 144830 579146 92.3 92.3 69.7% 0.0% 0.0% 0.0% 3.24sec 59044572 300.01sec
      Acýs Acýs dispatch_crackshot 2098 9047284 30156 15.36 80299 160554 0.0 76.8 46.8% 0.0% 0.0% 0.0% 0.00sec 12924679 300.01sec
      Acýs Acýs dispatch 2098 19441774 64803 16.48 161162 322106 82.4 82.4 46.5% 0.0% 0.0% 0.0% 3.39sec 27773935 300.01sec
      Acýs Acýs fate_intertwined 456306 6604786 22015 14.84 89018 0 74.2 74.2 0.0% 0.0% 0.0% 0.0% 4.01sec 6604786 300.01sec
      Acýs Acýs flask 431973 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
      Acýs Acýs food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
      Acýs Acýs ghostly_strike 196937 3317773 11059 3.72 114857 241126 18.6 18.6 50.3% 0.0% 0.0% 0.0% 16.66sec 23263466 300.01sec
      Acýs Acýs hand_of_fate 452536 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
      Acýs Acýs fatebound_coin_tails 452538 30671656 102235 20.14 208062 415485 100.7 100.7 46.5% 0.0% 0.0% 0.0% 3.26sec 30671656 300.01sec
      Acýs Acýs lucky_coin 461818 1841734 6139 0.89 284735 568713 4.4 4.4 46.2% 0.0% 0.0% 0.0% 43.95sec 1841734 300.01sec
      Acýs Acýs instant_poison 315585 4897211 16323 118.46 5637 11266 0.0 592.3 46.7% 0.0% 0.0% 0.0% 0.00sec 4897211 300.01sec
      Acýs Acýs main_gauche 86392 13278751 44261 40.58 44514 89231 0.0 202.9 46.8% 0.0% 0.0% 0.0% 0.00sec 18969625 300.01sec
      Acýs Acýs pistol_shot 185763 6450288 21500 10.68 76939 161399 53.4 53.4 51.9% 0.0% 0.0% 0.0% 5.47sec 9214687 300.01sec
      Acýs Acýs pistol_shot_fan_the_hammer 185763 12889590 42964 21.36 76869 161242 0.0 106.8 52.0% 0.0% 0.0% 0.0% 0.00sec 18413681 300.01sec
      Acýs Acýs potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
      Acýs Acýs roll_the_bones 315508 0 0 0.00 0 0 10.2 0.0 0.0% 0.0% 0.0% 0.0% 31.75sec 0 300.01sec
      Acýs Acýs shadowmeld 58984 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 126.56sec 0 300.01sec
      Acýs Acýs sigil_of_algari_concordance 443378 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 73.51sec 0 300.01sec
      Acýs Acýs_silvervein thunder_bolt_silvervein 452335 1843912 40240 16.03 108365 216786 12.2 12.2 39.0% 0.0% 0.0% 0.0% 14.69sec 1843912 45.82sec
      Acýs Acýs_silvervein thundering_bolt 452445 667253 14562 4.06 154874 309818 3.1 3.1 38.8% 0.0% 0.0% 0.0% 73.24sec 667253 45.82sec
      Acýs Acýs sinister_strike 193315 2917324 9724 7.33 50962 106813 36.6 36.6 51.3% 0.0% 0.0% 0.0% 7.26sec 4167601 300.01sec
      Acýs Acýs sinister_strike_extra_attack 197834 1411312 4704 3.54 50984 106845 0.0 17.7 51.5% 0.0% 0.0% 0.0% 0.00sec 2016157 300.01sec
      Acýs Acýs slice_and_dice 315496 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
      Acýs Acýs stealth 1784 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
      Acýs Acýs vanish 1856 0 0 0.00 0 0 15.4 0.0 0.0% 0.0% 0.0% 0.0% 19.66sec 0 300.01sec

      Fluffy_Pillow : 0 dps

      Results, Spec and Gear

      Resource Out In Waiting APM Active
      Health637,771.60.00.00%0.0100.0%

      Scale Factors for other metrics

      Charts

      Abilities

      Buffs

      Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
      Ghostly Strike17.70.917.4s16.6s12.4s73.00%74.78%56.4 (56.4)17.0

      Buff Details

      • buff initial source:Acýs
      • cooldown name:buff_ghostly_strike
      • max_stacks:1
      • base duration:12.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.15
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:pandemic
      • stack behavior:default
      • tick behavior:clip
      • tick_time behavior:unhasted
      • period:3.00

      Trigger Details

      • interval_min/max:0.0s / 108.6s
      • trigger_min/max:7.2s / 43.8s
      • trigger_pct:100.00%
      • duration_min/max:0.0s / 107.9s
      • uptime_min/max:54.96% / 88.54%

      Stack Uptimes

      • ghostly_strike_1:73.00%

      Spelldata

      • id:196937
      • name:Ghostly Strike
      • tooltip:Taking {$s3=15}% increased damage from the Rogue's abilities.
      • description:Strikes an enemy, dealing {$s1=0} Physical damage and causing the target to take {$s3=15}% increased damage from your abilities for {$d=12 seconds}. |cFFFFFFFFAwards {$s2=1} combo {$=}lpoint:points;.|r
      • max_stacks:0
      • duration:12.00
      • cooldown:90.00
      • default_chance:0.00%
      Constant Buffs
      Arcane Intellect

      Buff Details

      • buff initial source:
      • cooldown name:buff_arcane_intellect
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.03
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:1459
      • name:Arcane Intellect
      • tooltip:Intellect increased by $w1%.
      • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
      • max_stacks:0
      • duration:3600.00
      • cooldown:0.00
      • default_chance:0.00%
      Battle Shout

      Buff Details

      • buff initial source:
      • cooldown name:buff_battle_shout
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:15.00
      • default_chance:100.00%
      • default_value:0.05
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:6673
      • name:Battle Shout
      • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
      • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
      • max_stacks:0
      • duration:3600.00
      • cooldown:15.00
      • default_chance:0.00%
      bleeding

      Buff Details

      • buff initial source:Fluffy_Pillow
      • cooldown name:buff_bleeding
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:-0.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00
      Chaos Brand

      Buff Details

      • buff initial source:Fluffy_Pillow
      • cooldown name:buff_chaos_brand
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:5.00
      • default_chance:100.00%
      • default_value:0.03
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:1490
      • name:Chaos Brand
      • tooltip:Magic damage taken increased by {$s1=3}%.
      • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
      • max_stacks:0
      • duration:-0.00
      • cooldown:0.00
      • default_chance:0.00%
      Hunter's Mark

      Buff Details

      • buff initial source:Fluffy_Pillow
      • cooldown name:buff_hunters_mark
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.05
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:pandemic
      • stack behavior:default
      • tick behavior:clip
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:257284
      • name:Hunter's Mark
      • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
      • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
      • max_stacks:0
      • duration:-0.00
      • cooldown:0.00
      • default_chance:0.00%
      Mark of the Wild

      Buff Details

      • buff initial source:
      • cooldown name:buff_mark_of_the_wild
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.03
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:1126
      • name:Mark of the Wild
      • tooltip:Versatility increased by $w1%.
      • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
      • max_stacks:0
      • duration:3600.00
      • cooldown:0.00
      • default_chance:0.00%
      Mortal Wounds

      Buff Details

      • buff initial source:Fluffy_Pillow
      • cooldown name:buff_mortal_wounds
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:101.00%
      • default_value:0.50
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:115804
      • name:Mortal Wounds
      • tooltip:Healing effects received reduced by {$=}w1%.
      • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
      • max_stacks:0
      • duration:10.00
      • cooldown:0.00
      • default_chance:101.00%
      Mystic Touch

      Buff Details

      • buff initial source:Fluffy_Pillow
      • cooldown name:buff_mystic_touch
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:5.00
      • default_chance:100.00%
      • default_value:0.05
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:113746
      • name:Mystic Touch
      • tooltip:Physical damage taken increased by {$=}w1%.
      • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
      • max_stacks:0
      • duration:-0.00
      • cooldown:0.00
      • default_chance:0.00%
      Power Word: Fortitude

      Buff Details

      • buff initial source:
      • cooldown name:buff_power_word_fortitude
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.00
      • default_chance:100.00%
      • default_value:0.05
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:21562
      • name:Power Word: Fortitude
      • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
      • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
      • max_stacks:0
      • duration:3600.00
      • cooldown:0.00
      • default_chance:0.00%
      Skyfury

      Buff Details

      • buff initial source:
      • cooldown name:buff_skyfury
      • max_stacks:1
      • base duration:0.00
      • duration modifier:1.00
      • base cooldown:0.10
      • default_chance:20.00%
      • default_value:2.00
      • activated:true
      • reactable:false
      • reverse:false
      • refresh behavior:duration
      • stack behavior:default
      • tick behavior:none
      • tick_time behavior:unhasted
      • period:0.00

      Spelldata

      • id:462854
      • name:Skyfury
      • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
      • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
      • max_stacks:0
      • duration:3600.00
      • cooldown:0.00
      • default_chance:20.00%

      Resources

      Change Start Gain/s Loss/s Overflow End (Avg) Min Max

      Statistics & Data Analysis

      Fight Length
      Fluffy_Pillow Fight Length
      Count 9999
      Mean 300.01
      Minimum 240.01
      Maximum 359.99
      Spread ( max - min ) 119.98
      Range [ ( max - min ) / 2 * 100% ] 20.00%
      DPS
      Fluffy_Pillow Damage Per Second
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%
      Priority Target DPS
      Fluffy_Pillow Priority Target Damage Per Second
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%
      DPS(e)
      Fluffy_Pillow Damage Per Second (Effective)
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%
      Damage
      Fluffy_Pillow Damage
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%
      DTPS
      Fluffy_Pillow Damage Taken Per Second
      Count 9999
      Mean 660898.15
      Minimum 504378.20
      Maximum 799039.02
      Spread ( max - min ) 294660.82
      Range [ ( max - min ) / 2 * 100% ] 22.29%
      Standard Deviation 36864.1416
      5th Percentile 599287.35
      95th Percentile 720155.32
      ( 95th Percentile - 5th Percentile ) 120867.96
      Mean Distribution
      Standard Deviation 368.6598
      95.00% Confidence Interval ( 660175.59 - 661620.71 )
      Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
      Approx. Iterations needed for ( always use n>=50 )
      1% Error 120
      0.1% Error 11952
      0.1 Scale Factor Error with Delta=300 11600907
      0.05 Scale Factor Error with Delta=300 46403626
      0.01 Scale Factor Error with Delta=300 1160090633
      HPS
      Fluffy_Pillow Healing Per Second
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%
      HPS(e)
      Fluffy_Pillow Healing Per Second (Effective)
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%
      Heal
      Fluffy_Pillow Heal
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%
      HTPS
      Fluffy_Pillow Healing Taken Per Second
      Count 9999
      Mean 0.00
      Minimum 0.00
      Maximum 0.00
      Spread ( max - min ) 0.00
      Range [ ( max - min ) / 2 * 100% ] 0.00%

      Action Priority List

      actions.precombat Executed before combat begins. Accepts non-harmful actions only.
      # count action,conditions
      0 0.00 snapshot_stats

      Stats

      Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
      Strength00000
      Agility00000
      Stamina00000
      Intellect00000
      Spirit00000
      Health02170957440
      Melee Crit5.00%5.00%0
      Spell Crit0.00%0.00%0
      Haste0.00%0.00%0
      Versatility0.00%0.00%0
      Mitigation Versatility0.00%0.00%0
      Mastery0.00%0.00%0
      Armor428574285742857
      Run Speed700
      Tank-Miss3.00%3.00%0
      Tank-Dodge3.00%3.00%0
      Tank-Parry3.00%3.00%0
      Tank-Block3.00%3.00%0
      Tank-Crit0.00%0.00%0

      Gear

      Source Slot Average Item Level: 0.00

      Profile

      tank_dummy="Fluffy_Pillow"
      source=default
      spec=unknown
      level=83
      race=humanoid
      role=tank
      position=front

      # This default action priority list is automatically created based on your character.
      # It is a attempt to provide you with a action list that is both simple and practicable,
      # while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
      # Feel free to edit, adapt and improve it to your own needs.
      # SimulationCraft is always looking for updates and improvements to the default action lists.

      # Executed before combat begins. Accepts non-harmful actions only.
      actions.precombat=snapshot_stats

      # Executed every time the actor is available.


      # Gear Summary
      # gear_ilvl=0.00

      APM

      Average number of actions executed per minute.

      APS

      Average absorption per active player duration.

      Constant Buffs

      Buffs received prior to combat and present the entire fight.

      Execute

      Average number of times an action is executed per iteration.

      Crit

      Average crit damage.

      Crit%

      Percentage of executes that resulted in critical strikes.

      DPE

      Average damage per execution of an individual action.

      DPET

      Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

      DPR

      Average damage per resource point spent.

      DPS

      Average damage per active player duration.

      DPSE

      Average damage per fight duration.

      DTPS

      Average damage taken per second per active player duration.

      HPS

      Average healing (and absorption) per active player duration.

      HPSE

      Average healing (and absorption) per fight duration.

      HPE

      Average healing (or absorb) per execution of an individual action.

      HPET

      Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

      HPR

      Average healing (or absorb) per resource point spent.

      Count

      Average count of impacts per iteration.

      Dodge%

      Percentage of executes that resulted in dodges.

      DPS%

      Percentage of total DPS contributed by a particular action.

      HPS%

      Percentage of total HPS (including absorb) contributed by a particular action.

      Type

      Direct or Periodic damage.

      Dynamic Buffs

      Temporary buffs received during combat, perhaps multiple times.

      Buff Benefit

      The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

      Glance%

      Percentage of executes that resulted in glancing blows.

      Block%

      Percentage of executes that resulted in blocking blows.

      Id

      Associated spell-id for this ability.

      Ability

      Name of the ability.

      Total

      Total damage for this ability during the fight.

      Hit

      Average non-crit damage.

      Interval

      Average time between executions of a particular action.

      Avg

      Average direct damage per execution.

      Miss%

      Percentage of executes that resulted in misses, dodges or parries.

      Origin

      The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

      Parry%

      Percentage of executes that resulted in parries.

      RPS In

      Average primary resource points generated per second.

      RPS Out

      Average primary resource points consumed per second.

      Scale Factors

      Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

      Gear Amount

      Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

      Stats Raid Buffed

      Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

      Stats Unbuffed

      Amount after class modifiers and effects, but before buff modifiers.

      Ticks

      Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

      Ticks Crit

      Average crit tick damage.

      Ticks Crit%

      Percentage of ticks that resulted in critical strikes.

      Ticks Hit

      Average non-crit tick damage.

      Ticks Miss%

      Percentage of ticks that resulted in misses, dodges or parries.

      Ticks Uptime%

      Percentage of total time that DoT is ticking on target.

      Ticks Avg

      Average damage per tick.

      Timeline Distribution

      The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

      Waiting

      This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

      Scale Factor Ranking

      This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

      Uptime Average Duration

      The average duration of an instance of the tracked uptime.

      Max Spike Damage

      Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

      Error

      Estimator for the 95.00% confidence interval.

      Range

      This is the range of values containing 95.00% of the data, roughly centered on the mean.

      Fight Length

      Fight Length: 300.00
      Vary Combat Length: 0.20

      Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.