Thyraelius missing 'use_item' action for item "fyralath_the_dreamrender" (slot=main_hand)
Disable this warning by adding 'use_item' actions into the action priority list for the actor(s), or add "use_item_verification=0" to your list of options passed to Simulationcraft.

SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.2.56819 Live (hotfix 2024-10-02/56819, git build f13a16ce35)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Thyraelius : 431,059 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
431,059.5431,059.5199.4 / 0.046%40,311.3 / 9.4%445,752.5
Resource Out In Waiting APM Active
Holy Power1.01.02.74%54.9100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/thyraelius
TalentCYEAE74QAafj6bdTrgpLZS4VlDAAAwAAjJW2mZ2W2mZsZmZbxsNAAAAAAMmoZGGYmxMmlxwMDjZZmlthBYGsswGAAAyMTbzysNDAYDA
Scale Factors for Thyraelius Damage Per Second
Wdps Str Mastery Haste Crit Vers
Scale Factors 55.09 10.03 6.93 5.91 5.63 5.06
Normalized 5.49 1.00 0.69 0.59 0.56 0.50
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.14 0.13 0.12 0.12 0.12 0.12
Ranking
  • Wdps > Str > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, Strength=10.03, CritRating=5.63, HasteRating=5.91, MasteryRating=6.93, Versatility=5.06, Dps=55.09 )

Scale Factors for other metrics

Scale Factors for Thyraelius Priority Target Damage Per Second
Wdps Str Mastery Haste Crit Vers
Scale Factors 55.09 10.03 6.93 5.91 5.63 5.06
Normalized 5.49 1.00 0.69 0.59 0.56 0.50
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.14 0.13 0.12 0.12 0.12 0.12
Ranking
  • Wdps > Str > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, Strength=10.03, CritRating=5.63, HasteRating=5.91, MasteryRating=6.93, Versatility=5.06, Dps=55.09 )
Scale Factors for Thyraelius Damage Per Second (Effective)
Wdps Str Mastery Haste Crit Vers
Scale Factors 55.09 10.03 6.93 5.91 5.63 5.06
Normalized 5.49 1.00 0.69 0.59 0.56 0.50
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Str > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, Strength=10.03, CritRating=5.63, HasteRating=5.91, MasteryRating=6.93, Versatility=5.06, Dps=55.09 )
Scale Factors for Thyraelius Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Thyraelius Fight Length
Str Vers Haste Wdps Crit Mastery
Scale Factors -0.00 -0.00 -0.00 0.00 0.00 0.00
Normalized 1.00 0.98 0.03 -0.96 -0.98 -2.97
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Str > Vers > Haste > Wdps > Crit > Mastery
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, Strength=0.00, CritRating=-0.00, HasteRating=0.00, MasteryRating=-0.00, Versatility=0.00, Dps=-0.00 )
Scale Factors for Raid Damage Per Second
Wdps Str Mastery Haste Crit Vers
Scale Factors 55.09 10.03 6.93 5.91 5.63 5.06
Normalized 5.49 1.00 0.69 0.59 0.56 0.50
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.14 0.13 0.12 0.12 0.12 0.12
Ranking
  • Wdps > Str > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Thyraelius-Retribution": Class=Paladin, Spec=Retribution, Strength=10.03, CritRating=5.63, HasteRating=5.91, MasteryRating=6.93, Versatility=5.06, Dps=55.09 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Thyraelius431,059
Blade of Justice 30,5517.1%61.84.80s148,116137,184Direct61.8124,806256,471148,11717.7%

Stats Details: Blade Of Justice

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage61.8461.840.000.000.001.07970.00009,160,075.149,160,075.140.00%137,184.38137,184.38
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.30%50.893074124,806.30100,172183,732124,825.90116,134132,9316,351,9866,351,9860.00%
crit17.70%10.95124256,471.04205,352376,650256,689.46209,534324,2512,808,0892,808,0890.00%

Action Details: Blade Of Justice

  • id:184575
  • school:holy
  • range:12.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:184575
  • name:Blade of Justice
  • school:holy
  • tooltip:
  • description:{$?s403826=true}[Pierce enemies][Pierce an enemy] with a blade of light, dealing {$s1=0} Holy damage{$?s403826=true}[ to your target and {$404358s1=0} Holy damage to nearby enemies.][.] |cFFFFFFFFGenerates {$s2=1} Holy Power.|r

Action Priority List

    generators
    [Q]:61.85
  • if_expr:holy_power<=3|!talent.holy_blade

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationRetribution Paladin1370273SET1.000
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370276SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin13702719SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
(blade_of_justice_) Consecration 0 (6,341)0.0% (1.5%)21.613.93s87,8910

Stats Details: Blade Of Justice Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage21.630.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Blade Of Justice Consecration

  • id:26573
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=true}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=false}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
    (blade_of_justice_) Consecration 6,3411.5%0.00.00s00Periodic351.24,5639,3695,41417.7%0.0%

Stats Details: Blade Of Justice Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00351.240.000.00000.00001,901,509.881,901,509.880.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.29%289.041963944,562.733,7146,9164,562.894,3554,7821,318,7941,318,7940.00%
crit17.71%62.20291089,368.707,61313,9649,372.808,60510,240582,716582,7160.00%

Action Details: Blade Of Justice Consecration Tick

  • id:81297
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:11.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Divine Storm 12,486 (14,115)2.9% (3.3%)19.615.23s215,567620,598Direct19.6 (39.3)160,686330,420190,67417.7% (17.6%)

Stats Details: Divine Storm

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.6319.630.000.000.000.34740.00003,743,871.663,743,871.660.00%620,598.38620,598.38
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.33%16.16629160,685.5596,165293,546160,702.50136,331188,6452,597,3092,597,3090.00%
crit17.67%3.47012330,420.33197,137594,893322,168.540556,5431,146,5621,146,5620.00%

Action Details: Divine Storm

  • id:53385
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Unleashes a whirl of divine energy, dealing {$?s405289=true}[{$=}{{$s1=0}*1.05} Radiant][{$s1=0} Holy] damage to all nearby enemies. Deals reduced damage beyond {$s2=5} targets.

Action Priority List

    finishers
    [J]:6.18
  • if_expr:variable.ds_castable&!buff.hammer_of_light_ready.up&(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Divine Storm (_tempest) 1,6290.4%19.615.23s24,8860Direct19.620,97443,17124,88617.6%

Stats Details: Divine Storm Tempest

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage19.6319.630.000.000.000.00000.0000488,609.30488,609.300.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.37%16.1762820,973.7716,72431,24720,976.0718,16123,736339,218339,2180.00%
crit17.63%3.4601243,171.0434,28564,05741,939.72063,982149,392149,3920.00%

Action Details: Divine Storm Tempest

  • id:224239
  • school:holyfire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:224239
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:{$@spelldesc53385=Unleashes a whirl of divine energy, dealing {$?s405289=true}[{$=}{{$s1=0}*1.05} Radiant][{$s1=0} Holy] damage to all nearby enemies. Deals reduced damage beyond {$s2=5} targets.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Divine Toll 0 (10,032)0.0% (2.3%)5.856.32s516,048454,255

Stats Details: Divine Toll

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.820.000.000.000.001.13610.00000.000.000.00%454,254.98454,254.98

Action Details: Divine Toll

  • id:375576
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:375576
  • name:Divine Toll
  • school:holy
  • tooltip:
  • description:Instantly cast {$?a137029=false}[Holy Shock]?a137028[Avenger's Shield]?a137027[Judgment][Holy Shock, Avenger's Shield, or Judgment] on up to {$s1=5} targets within {$=}A2 yds.{$?=}(a384027|a386738|a387893)[ After casting Divine Toll, you instantly cast ][]{$?=}(a387893&c1)[Holy Shock]?(a386738&c2)[Avenger's Shield]?(a384027&c3)[Judgment][]{$?a387893=true}[ every {$387895t1=5} sec. This effect lasts {$387895d=15 seconds}.][]{$?a384027=true}[ every {$384029t1=5} sec. This effect lasts {$384029d=15 seconds}.][]{$?a386738=true}[ every {$386730t1=5} sec. This effect lasts {$386730d=15 seconds}.][]{$?=}c3[ Divine Toll's Judgment deals {$326011s1=100}% increased damage.][]{$?=}c2[ Generates {$s5=1} Holy Power per target hit.][]

Action Priority List

    generators
    [N]:5.82
  • if_expr:holy_power<=2&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)&(cooldown.avenging_wrath.remains>15|cooldown.crusade.remains>15|talent.radiant_glory|fight_remains<8)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Global CooldownPaladin1370268SET1.000
    (divine_toll_) Judgment 3,8880.9%5.856.32s200,1950Direct5.8169,748347,107200,28617.2%

Stats Details: Divine Toll Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.825.820.000.000.000.00000.00001,165,890.301,165,890.300.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.79%4.8207169,747.51146,895240,760169,692.160199,508818,187818,1870.00%
crit17.21%1.0005347,106.92301,134478,361230,791.890478,361347,703347,7030.00%

Action Details: Divine Toll Judgment

  • id:20271
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.610542
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05
  • base_multiplier:3.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=false}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    (divine_resonance_) Judgment 6,1431.4%17.017.29s108,3740Direct17.091,060188,965108,43417.7%

Stats Details: Divine Resonance Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.9716.960.000.000.000.00000.00001,839,460.631,839,460.630.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.26%13.9672191,060.4573,447141,80591,055.0576,564107,4601,270,8501,270,8500.00%
crit17.74%3.01010188,964.59150,567290,701181,786.780283,992568,611568,6110.00%

Action Details: Divine Resonance Judgment

  • id:20271
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.610542
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05
  • base_multiplier:1.50

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=false}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Empyrean Hammer 71,03516.5%377.10.79s56,4980Direct377.1 (377.1)47,62897,99156,49817.6% (17.6%)

Stats Details: Empyrean Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage377.11377.110.000.000.000.00000.000021,305,548.7821,305,548.780.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.39%310.6921841047,627.9531,84683,80147,630.1045,19750,26114,797,42114,797,4210.00%
crit17.61%66.423311497,990.5365,285169,37598,051.4088,971108,8586,508,1286,508,1280.00%

Action Details: Empyrean Hammer

  • id:431398
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:431398
  • name:Empyrean Hammer
  • school:holy
  • tooltip:
  • description:A Holy Hammer called down from the skies to deal {$s1=0} Holy damage to its target.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Execution Sentence 33,7537.8%9.731.47s1,039,3961,377,607Direct9.71,039,41201,039,4120.0%

Stats Details: Execution Sentence

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.749.740.000.000.000.75450.000010,122,654.7810,122,654.780.00%1,377,606.801,377,606.80
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%9.748121,039,412.13306,4812,228,7931,039,715.96876,1911,278,08910,122,65510,122,6550.00%

Action Details: Execution Sentence

  • id:387113
  • school:holy
  • range:150.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:387113
  • name:Execution Sentence
  • school:holy
  • tooltip:
  • description:{$@spelldesc343527=A hammer slowly falls from the sky upon the target, after {$d=8 seconds}, they suffer {$s2=20}% of the damage taken from your abilities as Holy damage during that time. {$?s406158=false} [|cFFFFFFFFGenerates {$406158s1=3} Holy Power.][]}

Action Priority List

    cooldowns
    [H]:9.74
  • if_expr:(!buff.crusade.up&cooldown.crusade.remains>15|buff.crusade.stack=10|cooldown.avenging_wrath.remains<0.75|cooldown.avenging_wrath.remains>15|talent.radiant_glory)&(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(target.time_to_die>8&!talent.executioners_will|target.time_to_die>12)&cooldown.wake_of_ashes.remains<gcd

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Expurgation 26,8936.2%61.84.80s130,3630Periodic131.351,712106,57261,42117.7%94.6%

Stats Details: Expurgation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage61.840.00131.26131.2656.690.00002.16288,062,197.678,062,197.670.00%28,397.620.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.30%108.047414351,711.6812254,20751,723.3239,50766,4845,586,6215,586,6210.00%
crit17.70%23.23345106,571.9148492,360106,678.9373,338163,3282,475,5772,475,5770.00%

Action Details: Expurgation

  • id:383346
  • school:holyfire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.229500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.05
  • base_multiplier:1.21
  • dot_duration:9.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:383346
  • name:Expurgation
  • school:holyfire
  • tooltip:Suffering {$=}w1 {$?s403665=false}[Holy][Radiant] damage every {$t1=3} sec.{$?s406545=false}[ Holy damage taken from {$@=}auracaster increased by {$=}w2%.][]
  • description:{$@spelldesc383344=Your Blade of Justice causes the target to burn for {$383346=}o1 {$?s403665=false}[Holy][Radiant] damage over {$383346d=9 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Final Verdict 71,73016.6%91.23.26s235,841211,888Direct91.2198,659408,411235,83917.7%

Stats Details: Final Verdict

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage91.1891.180.000.000.001.11300.000021,503,021.5221,503,021.520.00%211,887.92211,887.92
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.27%75.0147105198,659.30121,454365,188198,669.38182,792213,23214,901,76614,901,7660.00%
crit17.73%16.16234408,411.47248,980734,672408,630.24321,586504,2266,601,2556,601,2550.00%

Action Details: Final Verdict

  • id:383328
  • school:holy
  • range:12.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:383328
  • name:Final Verdict
  • school:holy
  • tooltip:
  • description:Unleashes a powerful weapon strike that deals {$s1=0} {$?s403664=false}[Holystrike][Holy] damage to an enemy target, Final Verdict has a {$s2=15}% chance to reset the cooldown of Hammer of Wrath and make it usable on any target, regardless of their health.

Action Priority List

    finishers
    [K]:91.18
  • if_expr:(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hammer of Light 41,6779.7%15.619.55s799,935674,485Direct15.6677,1011,388,755800,87317.4%

Stats Details: Hammer Of Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.6415.620.000.000.001.18600.000012,511,031.5012,511,031.500.00%674,485.50674,485.50
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.61%12.91519677,100.77397,2391,148,516676,831.18559,514805,8458,738,6048,738,6040.00%
crit17.39%2.720101,388,754.93814,3412,313,3611,307,671.0802,165,0533,772,4273,772,4270.00%

Action Details: Hammer Of Light

  • id:427453
  • school:holy
  • range:14.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:427453
  • name:Hammer of Light
  • school:holy
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$429826s1=0} Holy damage and {$=}{{$429826s1=0}/2} Holy damage up to 4 nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.

Action Priority List

    finishers
    [I]:15.64

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hammer of Wrath 8,5992.0%20.514.25s125,694116,271Direct20.5 (20.5)106,086217,434125,75817.7% (17.7%)

Stats Details: Hammer Of Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage20.5220.510.000.000.001.08110.00002,579,476.422,579,476.420.00%116,271.19116,271.19
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.33%16.89530106,085.6283,847155,958106,099.6693,178119,1711,791,4751,791,4750.00%
crit17.67%3.62012217,433.64171,887319,715212,409.410315,935788,001788,0010.00%

Action Details: Hammer Of Wrath

  • id:24275
  • school:holy
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$=}<damage> {$?s403664=false}[Holystrike][Holy] damage. Only usable on enemies that have less than 20% health{$?s326730=true}[, or during Avenging Wrath][]. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    generators
    [R]:20.52
  • if_expr:(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationRetribution Paladin1370273SET1.000
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin4123147PCT16.0%
Spell Direct AmountRetribution Paladin4123148PCT-14.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Cooldown Duration (Category)Paladin1370266SET1.000
Highlord's Judgment 11,8322.7%33.58.95s105,7880Direct33.589,829180,377105,78717.6%

Stats Details: Highlords Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage33.5433.540.000.000.000.00000.00003,548,055.123,548,055.120.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.38%27.6384989,829.3082,096119,36789,803.9783,70996,2072,481,8702,481,8700.00%
crit17.62%5.91021180,376.86164,192235,980179,913.720234,4411,066,1851,066,1850.00%

Action Details: Highlords Judgment

  • id:383921
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383921
  • name:Highlord's Judgment
  • school:holy
  • tooltip:
  • description:Blasts the target with the Light, dealing {$s1=0} Holy damage.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Judgment 15,3163.6%41.77.20s110,155102,573Direct41.792,737190,578110,20017.8%

Stats Details: Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage41.6841.660.000.000.001.07390.00004,591,559.284,591,559.280.00%102,572.59102,572.59
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.15%34.23185092,737.3473,447141,07092,743.9886,005100,3123,174,1583,174,1580.00%
crit17.85%7.44019190,578.41150,567289,194190,544.930272,8841,417,4011,417,4010.00%

Action Details: Judgment

  • id:20271
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.610542
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05
  • base_multiplier:1.50

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=false}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Action Priority List

    generators
    [P]:41.69
  • if_expr:holy_power<=3|!talent.boundless_judgment

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Mark of Fyr'alath 4,0590.9%978.80.38s1,2440Periodic136.67,56415,1488,90917.7%99.6%

Stats Details: Mark Of Fyralath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage978.820.00136.63136.63977.820.00002.18631,217,237.311,217,237.310.00%4,075.050.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.27%112.40771497,564.227,3328,7087,563.857,4177,809850,207850,2070.00%
crit17.73%24.2374615,148.0914,66317,41515,150.3814,70615,893367,030367,0300.00%

Action Details: Mark Of Fyralath

  • id:414532
  • school:shadowflame
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:6168.16
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:414532
  • name:Mark of Fyr'alath
  • school:shadowflame
  • tooltip:Suffering {$s1=12575} Shadowflame damage every {$t1=3} sec.
  • description:{$@spelldesc420248=Your attacks apply Mark of Fyr'alath, dealing {$414532=}o1 Shadowflame damage over {$414532d=15 seconds}. Upon activation, Fyr'alath draws in the flames from all marks to increase its damage by {$s1=10}%.}
melee 0 (22,603)0.0% (5.2%)152.01.97s44,59824,138

Stats Details: Melee

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage151.970.000.000.000.001.84760.00000.000.000.00%24,138.4924,138.49

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
    Crusading Strikes (crusading_strike) 12,5282.9%152.01.97s24,7170Direct152.020,83342,80324,71717.7%

Stats Details: Crusading Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage151.97151.970.000.000.000.00000.00003,756,302.375,366,140.8830.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.32%125.118916420,833.4817,45830,85520,834.5119,90221,8972,606,3783,723,39330.00%
crit17.68%26.8795442,803.3135,78863,25342,817.9138,39048,9391,149,9251,642,74830.00%

Action Details: Crusading Strike

  • id:408385
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:408385
  • name:Crusading Strikes
  • school:physical
  • tooltip:
  • description:Strike the target for {$=}<damage> {$?s403664=false} [Holystrike][Physical] damage. |cFFFFFFFFGenerates {$s2=1} Holy Power every other attack.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
    Seal of the Crusader 10,0752.3%152.01.97s19,8810Direct152.016,76134,42319,88017.7%

Stats Details: Seal Of The Crusader

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage151.97151.970.000.000.000.00000.00003,021,326.893,021,326.890.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.34%125.138616416,761.2813,68325,56416,761.1015,84117,6462,097,3212,097,3210.00%
crit17.66%26.8495134,422.8828,05052,40734,438.1530,15438,983924,006924,0060.00%

Action Details: Seal Of The Crusader

  • id:385723
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:385723
  • name:Seal of the Crusader
  • school:holy
  • tooltip:{$@=}spellaura385728
  • description:{$@spelldesc385728=Your auto attacks deal {$=}{{$385723s1=0}*(1+{$s2=0}/100)} additional Holy damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Searing Light 3,1740.7%5.152.68s186,2730Direct5.1157,022322,736186,28117.7%

Stats Details: Searing Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.115.110.000.000.000.00000.0000952,119.44952,119.440.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.35%4.21012157,021.56129,301241,584156,089.710234,742660,950660,9500.00%
crit17.65%0.9006322,735.60265,068494,670195,340.550493,600291,170291,1700.00%

Action Details: Searing Light

  • id:407478
  • school:holyfire
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:407478
  • name:Searing Light
  • school:holyfire
  • tooltip:
  • description:Calls down a explosion of Holy Fire dealing {$s2=0} Radiant damage to all nearby enemies and leaving a Consecration in its wake.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
(searing_light_) Consecration 0 (1,669)0.0% (0.4%)5.152.68s97,9240

Stats Details: Searing Light Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.110.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Searing Light Consecration

  • id:26573
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=true}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=false}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
    (searing_light_) Consecration 1,6690.4%0.00.00s00Periodic89.04,7369,7315,62217.7%0.0%

Stats Details: Searing Light Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.0089.030.000.00000.0000500,532.13500,532.130.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.26%73.2401804,735.883,7146,9394,719.9106,329346,855346,8550.00%
crit17.74%15.790469,731.437,61314,2259,683.81013,069153,677153,6770.00%

Action Details: Searing Light Consecration Tick

  • id:81297
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:11.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Shield of Vengeance (_proc) 20,4294.7%4.964.85s1,253,2530Direct4.91,253,24901,253,2490.0%

Stats Details: Shield Of Vengeance Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.904.900.000.000.000.00000.00006,136,287.926,136,287.920.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%4.90461,253,248.861,236,0691,336,7281,252,982.231,236,0691,298,2446,136,2886,136,2880.00%

Action Details: Shield Of Vengeance Proc

  • id:184689
  • school:holy
  • range:8.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1336727.81
  • base_dd_max:1336727.81
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:184689
  • name:Shield of Vengeance
  • school:holy
  • tooltip:
  • description:{$@spelldesc184662=Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.}
Touch of Light (_dmg) 2,3280.5%23.212.58s30,0690Direct23.225,35552,08830,06817.6%

Stats Details: Touch Of Light Dmg

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage23.2223.220.000.000.000.00000.0000698,222.32698,222.320.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.37%19.1373625,355.0920,52438,34725,352.2721,61629,144484,935484,9350.00%
crit17.63%4.0901552,087.7942,07478,20351,240.88078,098213,287213,2870.00%

Action Details: Touch Of Light Dmg

  • id:385354
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:385354
  • name:Touch of Light
  • school:holy
  • tooltip:
  • description:{$@spelldesc385349=Your spells and abilities have a chance to cause your target to erupt in a blinding light dealing {$385354s1=0} Holy damage or healing an ally for {$385352s1=0} health.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Wake of Ashes 9,405 (34,922)2.2% (8.1%)10.031.54s1,051,319851,303Direct10.0 (90.1)238,729490,851283,21917.6% (17.8%)

Stats Details: Wake Of Ashes

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.969.960.000.000.001.23500.00002,820,864.392,820,864.390.00%851,303.32851,303.32
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.35%8.20212238,728.94210,187340,836238,681.84213,636267,7001,958,1141,958,1140.00%
crit17.65%1.7607490,850.66430,883691,480418,299.300691,480862,750862,7500.00%

Action Details: Wake Of Ashes

  • id:255937
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:3.0

Spelldata

  • id:255937
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.

Action Priority List

    generators
    [M]:9.96
  • if_expr:(!talent.lights_guidance|holy_power>=2&talent.lights_guidance)&(cooldown.avenging_wrath.remains>6|cooldown.crusade.remains>6|talent.radiant_glory)&(!talent.execution_sentence|cooldown.execution_sentence.remains>4|target.time_to_die<8)&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Truth's Wake 12,9143.0%10.031.54s388,6110Periodic60.354,008111,07964,18817.8%35.3%

Stats Details: Truths Wake

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.960.0060.3060.300.000.00001.75473,870,523.863,870,523.860.00%36,581.670.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.16%49.54356554,008.091680,31354,035.0949,22559,5992,675,6662,675,6660.00%
crit17.84%10.76126111,079.4935164,642110,986.5518,976156,5101,194,8571,194,8570.00%

Action Details: Truths Wake

  • id:403695
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.544000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.05
  • base_multiplier:1.10
  • dot_duration:9.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:403695
  • name:Truth's Wake
  • school:holyfire
  • tooltip:{$?=}(s403696)[Burning for {$=}w2 damage every {$t2=3} sec and movement speed reduced by {$s1=50}%.] [Movement speed reduced by {$s1=50}%.]
  • description:Burns the targets for an additional {$=}o2 Radiant damage over {$d=9 seconds}, and slows them by {$s1=50}%.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Wake of Ashes (seething_flames_0) 6,2431.4%9.931.54s188,3330Direct9.9158,506324,700188,34017.9%

Stats Details: Seething Flames 0

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.949.940.000.000.000.00000.00001,872,463.061,872,463.060.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.05%8.16212158,505.57140,070220,521158,482.06141,133173,6391,293,0731,293,0730.00%
crit17.95%1.7807324,700.46287,144439,042278,587.630439,042579,390579,3900.00%

Action Details: Seething Flames 0

  • id:405345
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:405345
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:{$@spelldesc255937=Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Wake of Ashes (seething_flames_1) 6,3601.5%9.931.54s192,1400Direct9.9161,851333,186192,14317.7%

Stats Details: Seething Flames 1

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.939.930.000.000.000.00000.00001,907,179.481,907,179.480.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.32%8.17212161,850.93140,070234,851161,866.15140,235188,6171,322,5341,322,5340.00%
crit17.68%1.7507333,186.21287,144481,445284,943.060481,445584,646584,6460.00%

Action Details: Seething Flames 1

  • id:405350
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:405350
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:{$@spelldesc255937=Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Simple Action Stats Execute Interval
Thyraelius
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thyraelius
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thyraelius
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
The Sushi Special 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457302
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thyraelius
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5302.22s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [D]:1.48
  • if_expr:buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up|fight_remains<30
Sacrosanct Crusade (_heal) 15.619.55s

Stats Details: Sacrosanct Crusade Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal15.640.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sacrosanct Crusade Heal

  • id:461885
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thyraelius
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:224936.40
  • base_dd_max:224936.40
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461885
  • name:Sacrosanct Crusade
  • school:holy
  • tooltip:
  • description:{$@spelldesc431730={$?a137028=false}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=false}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=false}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=false}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
Shield of Vengeance 4.964.01s

Stats Details: Shield Of Vengeance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb4.904.900.000.000.000.60040.00000.000.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%4.90460.00000.0000000.00%

Action Details: Shield Of Vengeance

  • id:184662
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.7500
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:62.999
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thyraelius
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs {$=}w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.

Action Priority List

    cooldowns
    [G]:3.90
  • if_expr:fight_remains>15&(!talent.execution_sentence|!debuff.execution_sentence.up)
signet_of_the_priory 2.7125.90s

Stats Details: Signet Of The Priory

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.720.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Signet Of The Priory

  • id:443531
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:443531
  • name:Bolstering Light
  • school:physical
  • tooltip:{$?=}e2[Critical Strike]?e3[Haste]?e4[Mastery]?e5[Versatility][Highest secondary stat] increased by {$=}w1.
  • description:Raise your signet to the Light, increasing your highest secondary stat by {$450877s2=8731} for {$d=20 seconds}. Your act inspires nearby signetbearers within your party, granting them {$450877s1=230} of the same stat for {$450882d=20 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blessing of Dawn72.54.74.1s3.9s1.5s36.98%64.24%0.0 (0.0)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_blessing_of_dawn
  • max_stacks:2
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 15.4s
  • trigger_min/max:0.9s / 11.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.4s
  • uptime_min/max:27.26% / 45.82%

Stack Uptimes

  • blessing_of_dawn_1:35.60%
  • blessing_of_dawn_2:1.38%

Spelldata

  • id:385127
  • name:Blessing of Dawn
  • tooltip:Your next Holy Power spending ability deals {$s1=20}% additional increased damage and healing.
  • description:Your next Holy Power spending ability deals {$s1=20}% additional increased damage and healing. This effect stacks.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blessing of Dusk1.270.9153.1s4.1s239.1s98.43%0.00%70.9 (70.9)0.2

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_blessing_of_dusk
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 341.1s
  • trigger_min/max:0.6s / 13.8s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 355.5s
  • uptime_min/max:96.53% / 98.80%

Stack Uptimes

  • blessing_of_dusk_1:98.43%

Spelldata

  • id:385126
  • name:Blessing of Dusk
  • tooltip:Damage taken reduced by {$=}w1%{$?s385129=true}[, armor increased by {$=}w2%, and Holy Power generating abilities cool down {$=}w3% faster.][.]
  • description:Damage taken reduced by {$s1=4}%{$?s385129=true}&c2[, armor increased by {$s2=10}%, and Holy Power generating abilities cool down {$s3=10}% faster]?s385129[ and your Holy Power generating abilities also grant an absorb shield for {$s9=10}% of damage or healing dealt.][] For {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bolstering Light (Crit)0.70.0157.3s157.3s19.4s4.37%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_bolstering_light_Crit
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:4178.76

Trigger Details

  • interval_min/max:120.6s / 265.8s
  • trigger_min/max:120.6s / 265.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s
  • uptime_min/max:0.00% / 20.56%

Stack Uptimes

  • bolstering_light_Crit_1:4.37%

Spelldata

  • id:443531
  • name:Bolstering Light
  • tooltip:{$?=}e2[Critical Strike]?e3[Haste]?e4[Mastery]?e5[Versatility][Highest secondary stat] increased by {$=}w1.
  • description:Raise your signet to the Light, increasing your highest secondary stat by {$450877s2=8731} for {$d=20 seconds}. Your act inspires nearby signetbearers within your party, granting them {$450877s1=230} of the same stat for {$450882d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Bolstering Light (Haste)0.70.0159.2s159.2s19.4s4.35%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_bolstering_light_Haste
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:4178.76

Trigger Details

  • interval_min/max:120.8s / 262.4s
  • trigger_min/max:120.8s / 262.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:0.00% / 20.59%

Stack Uptimes

  • bolstering_light_Haste_1:4.36%

Spelldata

  • id:443531
  • name:Bolstering Light
  • tooltip:{$?=}e2[Critical Strike]?e3[Haste]?e4[Mastery]?e5[Versatility][Highest secondary stat] increased by {$=}w1.
  • description:Raise your signet to the Light, increasing your highest secondary stat by {$450877s2=8731} for {$d=20 seconds}. Your act inspires nearby signetbearers within your party, granting them {$450877s1=230} of the same stat for {$450882d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Bolstering Light (Mastery)0.70.0158.1s158.1s19.4s4.32%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_bolstering_light_Mastery
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4178.76

Trigger Details

  • interval_min/max:120.3s / 265.1s
  • trigger_min/max:120.3s / 265.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:0.00% / 20.45%

Stack Uptimes

  • bolstering_light_Mastery_1:4.32%

Spelldata

  • id:443531
  • name:Bolstering Light
  • tooltip:{$?=}e2[Critical Strike]?e3[Haste]?e4[Mastery]?e5[Versatility][Highest secondary stat] increased by {$=}w1.
  • description:Raise your signet to the Light, increasing your highest secondary stat by {$450877s2=8731} for {$d=20 seconds}. Your act inspires nearby signetbearers within your party, granting them {$450877s1=230} of the same stat for {$450882d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Bolstering Light (Vers)0.70.0152.4s152.4s19.4s4.42%0.00%0.0 (0.0)0.6

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_bolstering_light_Vers
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:4178.76

Trigger Details

  • interval_min/max:120.4s / 261.8s
  • trigger_min/max:120.4s / 261.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s
  • uptime_min/max:0.00% / 20.76%

Stack Uptimes

  • bolstering_light_Vers_1:4.42%

Spelldata

  • id:443531
  • name:Bolstering Light
  • tooltip:{$?=}e2[Critical Strike]?e3[Haste]?e4[Mastery]?e5[Versatility][Highest secondary stat] increased by {$=}w1.
  • description:Raise your signet to the Light, increasing your highest secondary stat by {$450877s2=8731} for {$d=20 seconds}. Your act inspires nearby signetbearers within your party, granting them {$450877s1=230} of the same stat for {$450882d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Burnout2.70.0125.8s125.8s54.5s49.18%0.00%0.0 (0.0)2.2

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_burnout
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:-812.83

Trigger Details

  • interval_min/max:120.1s / 141.6s
  • trigger_min/max:120.1s / 141.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 60.0s
  • uptime_min/max:42.26% / 55.36%

Stack Uptimes

  • burnout_1:49.18%

Spelldata

  • id:426897
  • name:Burnout
  • tooltip:Haste decreased by {$=}w1.
  • description:{$@spelldesc423611=Draw power from the remnants of the Embersoul, gaining {$423021s1=15722} {$=}pri for {$d=20 seconds}, decaying every {$t3=2} sec. Once this effect ends, become Burned Out, losing {$423021s2=1915} Haste for 60 sec before recovering. When circumstances are dire your soul ignites, granting this bonus again without decaying. This effect may only occur once per combat.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Crusade16.561.918.6s3.8s9.6s52.63%57.89%31.7 (85.8)15.9

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_crusade
  • max_stacks:10
  • base duration:27.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 41.4s
  • trigger_min/max:0.2s / 29.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:46.12% / 59.42%

Stack Uptimes

  • crusade_1:9.94%
  • crusade_4:4.81%
  • crusade_6:7.51%
  • crusade_7:1.23%
  • crusade_9:7.52%
  • crusade_10:21.62%

Spelldata

  • id:231895
  • name:Crusade
  • tooltip:{$?=}{$=}w1>0&{$=}w3>0[Damage done and haste increased by {$=}<damage>%.]?{$=}w1>0[Damage done increased by {$=}{{$=}w1}%.][Haste increased by {$=}<damage>%.]{$?=}{$=}w4>0[ Hammer of Wrath may be cast on any target.][]{$?s53376=false}[ Exploding with Holy light for {$326731s1=0} damage to nearby enemies.][]
  • description:Call upon the Light and begin a crusade, increasing your haste {$?s384376=true}[and damage ][]by {$=}{{$s5=30}/10}% for {$d=27 seconds}. Each Holy Power spent during Crusade increases haste {$?s384376=true}[and damage ][]by an additional {$=}{{$s5=30}/10}%. Maximum {$u=10} stacks.{$?s53376=false}[ While active, each Holy Power spent causes you to explode with Holy light for {$326731s1=0} damage to nearby enemies.][]{$?s384376=true}[ Hammer of Wrath may be cast on any target.][]
  • max_stacks:10
  • duration:27.00
  • cooldown:120.00
  • default_chance:100.00%
Divine Purpose11.20.124.4s24.3s2.5s9.28%10.23%0.1 (0.1)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 256.4s
  • trigger_min/max:0.8s / 256.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.9s
  • uptime_min/max:0.00% / 25.27%

Stack Uptimes

  • divine_purpose_1:9.28%

Spelldata

  • id:408458
  • name:Divine Purpose
  • tooltip:Your next Holy Power ability is free and deals {$s2=10}% increased damage and healing.
  • description:{$@spelldesc408459=Holy Power spending abilities have a {$s1=10}% chance to make your next Holy Power spending ability free and deal {$408458s2=10}% increased damage and healing.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Resonance5.80.056.4s56.3s14.7s28.54%0.00%11.4 (11.4)5.6

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_divine_resonance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:54.5s / 76.1s
  • trigger_min/max:54.5s / 76.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:24.51% / 31.25%

Stack Uptimes

  • divine_resonance_1:28.54%

Spelldata

  • id:355455
  • name:Divine Resonance
  • tooltip:Casting {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$t1=5} sec for {$s2=15} sec.
  • description:{$@spelldesc355098=After casting Divine Toll, you instantly cast {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$355455t1=5} sec. This effect lasts {$355455s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Empyrean Legacy13.50.023.0s23.0s2.0s9.14%14.77%0.0 (0.0)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_empyrean_legacy
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 37.3s
  • trigger_min/max:20.0s / 37.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.6s
  • uptime_min/max:5.17% / 16.24%

Stack Uptimes

  • empyrean_legacy_1:9.14%

Spelldata

  • id:387178
  • name:Empyrean Legacy
  • tooltip:Your next {$?=}c3[Single target Holy Power ability automatically triggers Divine Storm][Word of Glory automatically triggers Light of Dawn] with {$387170s2=25}% increased effectiveness.
  • description:{$@spelldesc387170=Judgment empowers your next {$?=}c3[Single target Holy Power ability to automatically activate Divine Storm][Word of Glory to automatically activate Light of Dawn] with {$s2=25}% increased effectiveness. This effect can only occur every {$387441d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Empyrean Legacy (_cooldown)13.50.023.0s23.0s19.4s87.29%79.02%0.0 (0.0)12.7

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_empyrean_legacy_cooldown
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 37.3s
  • trigger_min/max:20.0s / 37.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:76.36% / 94.18%

Stack Uptimes

  • empyrean_legacy_cooldown_1:87.29%

Spelldata

  • id:387441
  • name:Empyrean Legacy
  • tooltip:Cannot benefit from Empyrean Legacy.
  • description:{$@spelldesc387170=Judgment empowers your next {$?=}c3[Single target Holy Power ability to automatically activate Divine Storm][Word of Glory to automatically activate Light of Dawn] with {$s2=25}% increased effectiveness. This effect can only occur every {$387441d=20 seconds}.}
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Empyrean Power7.40.235.2s34.4s1.7s4.19%36.75%0.2 (0.2)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_empyrean_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 295.6s
  • trigger_min/max:1.1s / 295.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.4s
  • uptime_min/max:0.00% / 13.56%

Stack Uptimes

  • empyrean_power_1:4.19%

Spelldata

  • id:326733
  • name:Empyrean Power
  • tooltip:Your next Divine Storm is free and deals {$=}w1% additional damage.
  • description:{$@spelldesc326732={$?s404542=true}[Crusading Strikes has a {$s2=5}%][Crusader Strike has a {$s1=15}%] chance to make your next Divine Storm free and deal {$326733s1=15}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:326732
  • name:Empyrean Power
  • tooltip:
  • description:{$?s404542=true}[Crusading Strikes has a {$s2=5}%][Crusader Strike has a {$s1=15}%] chance to make your next Divine Storm free and deal {$326733s1=15}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Final Verdict11.12.625.9s20.8s6.3s23.18%18.20%2.6 (2.6)0.9

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_final_verdict
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 218.2s
  • trigger_min/max:0.8s / 218.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.7s
  • uptime_min/max:0.50% / 52.75%

Stack Uptimes

  • final_verdict_1:23.18%

Spelldata

  • id:337228
  • name:Final Verdict
  • tooltip:Hammer of Wrath can be used on any target.
  • description:{$@spelldesc336872=Unleashes a powerful weapon strike that deals {$s1=0} Holy damage to an enemy target. Has a {$s2=15}% chance to activate Hammer of Wrath and reset its cooldown.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of Alchemical Chaos (Crit)2.10.6112.3s77.1s35.2s25.04%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 349.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 228.0s
  • uptime_min/max:0.00% / 83.28%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.04%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6111.2s76.2s35.3s24.99%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 339.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 88.50%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.99%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6112.0s76.6s35.4s25.07%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 349.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 223.7s
  • uptime_min/max:0.00% / 92.80%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.07%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6112.1s77.3s35.1s24.90%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 351.9s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 78.18%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.90%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance (hammer_of_light_free)5.80.048.7s48.7s1.9s3.71%2.89%0.0 (0.0)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_hammer_of_light_free
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • hammer_of_light_free_1:3.71%

Spelldata

  • id:433732
  • name:Light's Deliverance
  • tooltip:
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=false}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hammer of Light (_ready)10.00.031.5s31.5s1.2s4.09%11.42%0.0 (0.0)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_hammer_of_light_ready
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.0s / 42.3s
  • trigger_min/max:30.0s / 42.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.3s
  • uptime_min/max:3.52% / 4.55%

Stack Uptimes

  • hammer_of_light_ready_1:4.09%

Spelldata

  • id:427453
  • name:Hammer of Light
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$429826s1=0} Holy damage and {$=}{{$429826s1=0}/2} Holy damage up to 4 nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance6.7370.447.8s0.8s43.4s97.48%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_lights_deliverance
  • max_stacks:60
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:34.2s / 68.2s
  • trigger_min/max:0.0s / 9.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.3s
  • uptime_min/max:93.56% / 98.89%

Stack Uptimes

  • lights_deliverance_1:1.20%
  • lights_deliverance_2:1.34%
  • lights_deliverance_3:0.83%
  • lights_deliverance_4:0.72%
  • lights_deliverance_5:0.87%
  • lights_deliverance_6:0.65%
  • lights_deliverance_7:0.58%
  • lights_deliverance_8:1.52%
  • lights_deliverance_9:1.38%
  • lights_deliverance_10:1.47%
  • lights_deliverance_11:1.96%
  • lights_deliverance_12:1.61%
  • lights_deliverance_13:1.56%
  • lights_deliverance_14:2.00%
  • lights_deliverance_15:1.59%
  • lights_deliverance_16:1.62%
  • lights_deliverance_17:2.00%
  • lights_deliverance_18:1.61%
  • lights_deliverance_19:1.61%
  • lights_deliverance_20:2.04%
  • lights_deliverance_21:1.59%
  • lights_deliverance_22:1.55%
  • lights_deliverance_23:1.88%
  • lights_deliverance_24:1.73%
  • lights_deliverance_25:1.52%
  • lights_deliverance_26:1.67%
  • lights_deliverance_27:1.77%
  • lights_deliverance_28:1.57%
  • lights_deliverance_29:1.66%
  • lights_deliverance_30:1.77%
  • lights_deliverance_31:1.66%
  • lights_deliverance_32:1.65%
  • lights_deliverance_33:1.77%
  • lights_deliverance_34:1.76%
  • lights_deliverance_35:1.73%
  • lights_deliverance_36:1.83%
  • lights_deliverance_37:1.84%
  • lights_deliverance_38:1.76%
  • lights_deliverance_39:1.78%
  • lights_deliverance_40:1.71%
  • lights_deliverance_41:1.70%
  • lights_deliverance_42:1.63%
  • lights_deliverance_43:1.64%
  • lights_deliverance_44:1.62%
  • lights_deliverance_45:1.62%
  • lights_deliverance_46:1.64%
  • lights_deliverance_47:1.69%
  • lights_deliverance_48:1.72%
  • lights_deliverance_49:1.80%
  • lights_deliverance_50:1.87%
  • lights_deliverance_51:1.90%
  • lights_deliverance_52:1.96%
  • lights_deliverance_53:2.00%
  • lights_deliverance_54:2.03%
  • lights_deliverance_55:2.05%
  • lights_deliverance_56:2.08%
  • lights_deliverance_57:2.07%
  • lights_deliverance_58:2.04%
  • lights_deliverance_59:2.02%
  • lights_deliverance_60:0.05%

Spelldata

  • id:433674
  • name:Light's Deliverance
  • tooltip:{$?=}{$=}W1=={$=}U[Ready to deliver Light's justice.][Building up Light's Deliverance. At {$u=60} stacks, your next Hammer of Light cast will activate another Hammer of Light for free.]
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=false}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:60
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sacrosanct Crusade12.513.124.8s11.7s12.0s49.89%51.20%13.1 (13.1)11.9

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_sacrosanct_crusade
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.0s / 50.1s
  • trigger_min/max:0.8s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.4s
  • uptime_min/max:43.93% / 56.66%

Stack Uptimes

  • sacrosanct_crusade_1:49.89%

Spelldata

  • id:461867
  • name:Sacrosanct Crusade
  • tooltip:Absorbs {$=}w1 damage.
  • description:{$@spelldesc431730={$?a137028=false}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=false}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=false}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=false}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sanctification64.40.083.2s4.7s112.5s99.29%98.63%0.0 (0.0)1.7

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_sanctification
  • max_stacks:20
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 358.5s
  • trigger_min/max:0.0s / 19.4s
  • trigger_pct:99.86%
  • duration_min/max:0.0s / 359.9s
  • uptime_min/max:94.96% / 100.00%

Stack Uptimes

  • sanctification_1:31.79%
  • sanctification_2:34.13%
  • sanctification_3:22.74%
  • sanctification_4:9.80%
  • sanctification_5:0.84%
  • sanctification_6:0.00%

Spelldata

  • id:433671
  • name:Sanctification
  • tooltip:Empyrean Hammer damage increased by {$=}w1%
  • description:{$@spelldesc432977=Casting Judgment increases the damage of Empyrean Hammer by {$433671s1=10}% for {$433671d=10 seconds}. Multiple applications may overlap.}
  • max_stacks:20
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Shake the Heavens9.06.634.6s34.6s27.1s81.18%83.35%124.4 (117.8)8.1

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_shake_the_heavens
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • shake_the_heavens_1:81.18%

Spelldata

  • id:431536
  • name:Shake the Heavens
  • tooltip:Casting Empyrean Hammer on a nearby target every $t sec.
  • description:{$@spelldesc431533=After casting Hammer of Light, you call down an Empyrean Hammer on a nearby target every {$431536=}T sec, for {$431536d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Shield of Vengeance4.94.964.9s27.3s10.0s16.30%0.00%4.9 (4.9)4.9

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:63.0s / 71.9s
  • trigger_min/max:0.0s / 71.9s
  • trigger_pct:100.00%
  • duration_min/max:10.0s / 10.0s
  • uptime_min/max:14.04% / 18.69%

Stack Uptimes

  • shield_of_vengeance_1:16.30%

Spelldata

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs {$=}w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Soul Ignition2.90.0125.3s125.3s19.4s19.07%0.00%28.4 (28.4)2.7

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_soul_ignition
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:8579.87
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stat Details

  • stat:strength
  • amount:8579.87

Trigger Details

  • interval_min/max:120.0s / 141.6s
  • trigger_min/max:120.0s / 141.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:15.62% / 22.71%

Stack Uptimes

  • soul_ignition_1:19.07%

Spelldata

  • id:423611
  • name:Soul Ignition
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Draw power from the remnants of the Embersoul, gaining {$423021s1=15722} {$=}pri for {$d=20 seconds}, decaying every {$t3=2} sec. Once this effect ends, become Burned Out, losing {$423021s2=1915} Haste for 60 sec before recovering. When circumstances are dire your soul ignites, granting this bonus again without decaying. This effect may only occur once per combat.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Tempered Potion1.50.0302.4s302.4s27.5s13.31%0.00%0.0 (0.0)1.2

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 318.5s
  • trigger_min/max:300.0s / 318.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.91% / 18.07%

Stack Uptimes

  • tempered_potion_1:13.31%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Undisputed Ruling13.62.022.6s19.5s6.4s29.15%30.01%2.0 (2.0)13.3

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_undisputed_ruling
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • undisputed_ruling_1:29.15%

Spelldata

  • id:432629
  • name:Undisputed Ruling
  • tooltip:Haste increased by {$=}w1%
  • description:{$@spelldesc432626=Hammer of Light applies Judgment to its targets, and increases your Haste by {$432629s1=12}% for {$432629d=6 seconds}.{$?a137028=false}[ Additionally, Eye of Tyr grants {$s2=3} Holy Power.][]}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion4.31.260.8s45.4s16.5s23.61%0.00%1.2 (1.2)4.0

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1742.15
  • stat:speed_rating
  • amount:555.47

Trigger Details

  • interval_min/max:15.0s / 206.0s
  • trigger_min/max:0.0s / 206.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.0s
  • uptime_min/max:4.66% / 58.43%

Stack Uptimes

  • wafting_devotion_1:23.61%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
The Sushi Special

Buff Details

  • buff initial source:Thyraelius
  • cooldown name:buff_the_sushi_special
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:470.00

Spelldata

  • id:461957
  • name:Well Fed
  • tooltip:Mastery increased by {$=}w9.
  • description:Increases Mastery by {$s1=0} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
reset_aa_cast15.612.019.019.5s1.0s41.1s
Art of War33.014.057.08.9s1.1s112.9s
Divine Purpose11.30.030.024.3s0.8s256.4s
Empyrean Power7.60.022.034.4s1.1s295.6s
Uptime Avg % Min Max Avg Dur Min Max
Holy Power Cap18.93%11.34%29.25%1.2s0.0s8.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Searing Light15.8690.000329.42193.9730.142353.742
(blade_of_justice_) Consecration0.3150.00014.5606.8305.05322.730
(searing_light_) Consecration33.5680.000329.421202.22655.188353.742
Shield of Vengeance1.4910.0008.8579.4020.00036.473
Execution Sentence1.4110.00413.31315.2603.07541.328
Blade of Justice0.4530.00016.40328.1573.86573.161
Wake of Ashes1.5540.00012.34515.5343.83036.273
Divine Toll1.4530.00021.5128.5360.13533.748
Hammer of Wrath6.5690.00092.170137.89225.237245.391
Judgment1.3650.00016.38557.15427.95693.598

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Thyraelius
Blade of JusticeHoly Power61.8461.8221.11%1.000.020.03%
Crusading StrikesHoly Power75.7464.8222.13%0.8610.9214.42%
Hammer of WrathHoly Power20.5220.527.00%1.000.000.02%
JudgmentHoly Power64.48121.7841.58%1.897.185.57%
Wake of AshesHoly Power9.9623.978.18%2.415.9119.77%
Usage Type Count Total Tot% Avg RPE APR
Thyraelius
Final VerdictHoly Power91.18244.1784.19%2.682.6888,065.13
Hammer of LightHoly Power15.6445.8415.81%2.932.93272,901.13
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Holy Power0.00.980.9724.02.90.05.0

Statistics & Data Analysis

Fight Length
Thyraelius Fight Length
Count 9999
Mean 300.00
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Thyraelius Damage Per Second
Count 9999
Mean 431059.46
Minimum 398524.36
Maximum 471038.90
Spread ( max - min ) 72514.54
Range [ ( max - min ) / 2 * 100% ] 8.41%
Standard Deviation 10174.0983
5th Percentile 414500.04
95th Percentile 448129.87
( 95th Percentile - 5th Percentile ) 33629.84
Mean Distribution
Standard Deviation 101.7461
95.00% Confidence Interval ( 430860.04 - 431258.88 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2140
0.1 Scale Factor Error with Delta=300 883641
0.05 Scale Factor Error with Delta=300 3534562
0.01 Scale Factor Error with Delta=300 88364033
Priority Target DPS
Thyraelius Priority Target Damage Per Second
Count 9999
Mean 431059.46
Minimum 398524.36
Maximum 471038.90
Spread ( max - min ) 72514.54
Range [ ( max - min ) / 2 * 100% ] 8.41%
Standard Deviation 10174.0983
5th Percentile 414500.04
95th Percentile 448129.87
( 95th Percentile - 5th Percentile ) 33629.84
Mean Distribution
Standard Deviation 101.7461
95.00% Confidence Interval ( 430860.04 - 431258.88 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2140
0.1 Scale Factor Error with Delta=300 883641
0.05 Scale Factor Error with Delta=300 3534562
0.01 Scale Factor Error with Delta=300 88364033
DPS(e)
Thyraelius Damage Per Second (Effective)
Count 9999
Mean 431059.46
Minimum 398524.36
Maximum 471038.90
Spread ( max - min ) 72514.54
Range [ ( max - min ) / 2 * 100% ] 8.41%
Damage
Thyraelius Damage
Count 9999
Mean 129276021.15
Minimum 98134963.16
Maximum 168646293.47
Spread ( max - min ) 70511330.31
Range [ ( max - min ) / 2 * 100% ] 27.27%
DTPS
Thyraelius Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Thyraelius Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Thyraelius Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Thyraelius Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Thyraelius Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 shield_of_vengeance
5 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
6 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
7 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%cooldown.crusade.duration=0|cooldown.crusade.duration%%trinket.1.cooldown.duration=0|trinket.1.cooldown.duration%%cooldown.avenging_wrath.duration=0|cooldown.avenging_wrath.duration%%trinket.1.cooldown.duration=0)
8 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%cooldown.crusade.duration=0|cooldown.crusade.duration%%trinket.2.cooldown.duration=0|trinket.2.cooldown.duration%%cooldown.avenging_wrath.duration=0|cooldown.avenging_wrath.duration%%trinket.2.cooldown.duration=0)
9 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 auto_attack
0.00 rebuke
B 0.00 call_action_list,name=cooldowns
C 0.00 call_action_list,name=generators
actions.cooldowns
# count action,conditions
D 1.48 potion,if=buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up|fight_remains<30
0.00 invoke_external_buff,name=power_infusion,if=buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up
0.00 lights_judgment,if=spell_targets.lights_judgment>=2|!raid_event.adds.exists|raid_event.adds.in>75|raid_event.adds.up
0.00 fireblood,if=buff.avenging_wrath.up|buff.crusade.up&buff.crusade.stack=10|debuff.execution_sentence.up
0.00 use_item,slot=trinket1,if=((buff.avenging_wrath.up&cooldown.avenging_wrath.remains>40|buff.crusade.up&buff.crusade.stack=10)&!talent.radiant_glory|talent.radiant_glory&(!talent.execution_sentence&cooldown.wake_of_ashes.remains=0|debuff.execution_sentence.up))&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
E 2.94 use_item,slot=trinket2,if=((buff.avenging_wrath.up&cooldown.avenging_wrath.remains>40|buff.crusade.up&buff.crusade.stack=10)&!talent.radiant_glory|talent.radiant_glory&(!talent.execution_sentence&cooldown.wake_of_ashes.remains=0|debuff.execution_sentence.up))&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
F 2.72 use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!buff.crusade.up&cooldown.crusade.remains>20|!buff.avenging_wrath.up&cooldown.avenging_wrath.remains>20)
0.00 use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!buff.crusade.up&cooldown.crusade.remains>20|!buff.avenging_wrath.up&cooldown.avenging_wrath.remains>20)
G 3.90 shield_of_vengeance,if=fight_remains>15&(!talent.execution_sentence|!debuff.execution_sentence.up)
H 9.74 execution_sentence,if=(!buff.crusade.up&cooldown.crusade.remains>15|buff.crusade.stack=10|cooldown.avenging_wrath.remains<0.75|cooldown.avenging_wrath.remains>15|talent.radiant_glory)&(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(target.time_to_die>8&!talent.executioners_will|target.time_to_die>12)&cooldown.wake_of_ashes.remains<gcd
0.00 avenging_wrath,if=(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&talent.divine_auxiliary&(cooldown.execution_sentence.remains=0|cooldown.final_reckoning.remains=0))&(!raid_event.adds.up|target.time_to_die>10)
0.00 crusade,if=holy_power>=5&time<5|holy_power>=3&time>5
0.00 final_reckoning,if=(holy_power>=4&time<8|holy_power>=3&time>=8|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(cooldown.avenging_wrath.remains>10|cooldown.crusade.remains&(!buff.crusade.up|buff.crusade.stack>=10)|talent.radiant_glory&(buff.avenging_wrath.up|talent.crusade&cooldown.wake_of_ashes.remains<gcd))&(!raid_event.adds.exists|raid_event.adds.up|raid_event.adds.in>40)
actions.finishers
# count action,conditions
0.00 variable,name=ds_castable,value=(spell_targets.divine_storm>=2|buff.empyrean_power.up|!talent.final_verdict&talent.tempest_of_the_lightbringer)&!buff.empyrean_legacy.up&!(buff.divine_arbiter.up&buff.divine_arbiter.stack>24)
I 15.64 hammer_of_light
0.00 divine_hammer,if=holy_power=5
J 6.18 divine_storm,if=variable.ds_castable&!buff.hammer_of_light_ready.up&(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
0.00 justicars_vengeance,if=(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
K 91.18 templars_verdict,if=(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
actions.generators
# count action,conditions
L 0.00 call_action_list,name=finishers,if=holy_power=5|holy_power=4&buff.divine_resonance.up
0.00 templar_slash,if=buff.templar_strikes.remains<gcd*2
0.00 blade_of_justice,if=!dot.expurgation.ticking&talent.holy_flames
M 9.96 wake_of_ashes,if=(!talent.lights_guidance|holy_power>=2&talent.lights_guidance)&(cooldown.avenging_wrath.remains>6|cooldown.crusade.remains>6|talent.radiant_glory)&(!talent.execution_sentence|cooldown.execution_sentence.remains>4|target.time_to_die<8)&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)
N 5.82 divine_toll,if=holy_power<=2&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)&(cooldown.avenging_wrath.remains>15|cooldown.crusade.remains>15|talent.radiant_glory|fight_remains<8)
O 0.00 call_action_list,name=finishers,if=holy_power>=3&buff.crusade.up&buff.crusade.stack<10
0.00 templar_slash,if=buff.templar_strikes.remains<gcd&spell_targets.divine_storm>=2
0.00 blade_of_justice,if=(holy_power<=3|!talent.holy_blade)&(spell_targets.divine_storm>=2&talent.blade_of_vengeance)
0.00 hammer_of_wrath,if=(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)&(target.health.pct<35&talent.vengeful_wrath|buff.blessing_of_anshe.up)
0.00 templar_strike
P 41.69 judgment,if=holy_power<=3|!talent.boundless_judgment
Q 61.85 blade_of_justice,if=holy_power<=3|!talent.holy_blade
R 20.52 hammer_of_wrath,if=(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)
0.00 templar_slash
S 0.00 call_action_list,name=finishers,if=(target.health.pct<=20|buff.avenging_wrath.up|buff.crusade.up|buff.empyrean_power.up)
0.00 crusader_strike,if=cooldown.crusader_strike.charges_fractional>=1.75&(holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2)
T 0.00 call_action_list,name=finishers
0.00 hammer_of_wrath,if=holy_power<=3|target.health.pct>20|!talent.vanguards_momentum
0.00 crusader_strike
0.00 arcane_torrent

Sample Sequence

012456789ANHDEMIPKQKQPKKQKPKQRKQKPKRFQPKQKRJPHKMIKKPQQKKPKRQKRPKIQKPKNKKQK