SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.2.56647 Live (hotfix 2024-09-20/56647, git build 0846de0d54)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Priest

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-20 Periodic damage increased by 4%
Shadow Priest (effect#2) base_value 10.00 6.00
2024-09-20 Direct damage increased by 4%
Shadow Priest (effect#1) base_value 10.00 6.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Raid Summary

Raid Event List
0 heal,name=tank_heal,amount=4000000,cooldown=5.0,duration=0,player_if=role.tank

DPS Scale Factors (dps increase per unit stat)

Profile Str Sta Crit Haste Mastery Vers Wdps wowhead
Nêreus 5.19 0.03 4.10 3.33 3.16 3.10 29.11 wowhead

Nêreus : 271,662 dps, 734,742 dtps, 239,511 hps (105,146 aps)

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
271,662.5271,662.5207.5 / 0.076%41,293.8 / 15.2%-1.0
HPS HPS(e) HPS Error HPS Range HPR
134,365.3134,365.3339.5 / 0.253%67,558.5 / 50.3%-1.0
APS APS Error APS Range APR
105,145.7939.7 / 0.894%37,312.2 / 35.5%-1.0
DTPS DTPS Error DTPS Range
734,741.8565.22 / 0.08%112,808 / 15.4%
Resource Out In Waiting APM Active
Mana0.00.00.11%70.6100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/n%C3%AAreus
TalentCIEAE74QAafj6bdTrgpLZS4VlvxMjxyMWMzMzM22MzMmZxYMDAAAAAAAAAAaLmZmxMzgZYGbwYGAwYAAYwMAAAQAmZW2WaZmxiZA
Scale Factors for Nêreus Damage Per Second
Wdps Str Crit Haste Mastery Vers Sta
Scale Factors 29.11 5.19 4.10 3.33 3.16 3.10 0.03
Normalized 5.61 1.00 0.79 0.64 0.61 0.60 0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.14 0.13 0.13 0.13 0.13 0.13 0.13
Ranking
  • Wdps > Str > Crit > Haste > Mastery ~= Vers > Sta
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=5.19, Stamina=0.03, CritRating=4.10, HasteRating=3.33, MasteryRating=3.16, Versatility=3.10, Dps=29.11 )

Scale Factors for other metrics

Scale Factors for Nêreus Priority Target Damage Per Second
Wdps Str Crit Haste Mastery Vers Sta
Scale Factors 29.11 5.19 4.10 3.33 3.16 3.10 0.03
Normalized 5.61 1.00 0.79 0.64 0.61 0.60 0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.14 0.13 0.13 0.13 0.13 0.13 0.13
Ranking
  • Wdps > Str > Crit > Haste > Mastery ~= Vers > Sta
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=5.19, Stamina=0.03, CritRating=4.10, HasteRating=3.33, MasteryRating=3.16, Versatility=3.10, Dps=29.11 )
Scale Factors for Nêreus Damage Per Second (Effective)
Wdps Str Crit Haste Mastery Vers Sta
Scale Factors 29.11 5.19 4.10 3.33 3.16 3.10 0.03
Normalized 5.61 1.00 0.79 0.64 0.61 0.60 0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Str > Crit > Haste > Mastery > Vers > Sta
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=5.19, Stamina=0.03, CritRating=4.10, HasteRating=3.33, MasteryRating=3.16, Versatility=3.10, Dps=29.11 )
Scale Factors for Nêreus Healing Per Second
Wdps Haste Str Mastery Vers Sta Crit
Scale Factors 8.31 0.91 0.74 -0.06 -0.12 -0.22 -0.41
Normalized 11.22 1.23 1.00 -0.09 -0.16 -0.30 -0.55
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.22 0.21 0.21 0.21 0.21 0.21 0.21
Ranking
  • Wdps > Haste ~= Str > Mastery ~= Vers ~= Sta ~= Crit
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=0.74, Stamina=-0.22, CritRating=-0.41, HasteRating=0.91, MasteryRating=-0.06, Versatility=-0.12, Dps=8.31 )
Scale Factors for Nêreus Healing Per Second (Effective)
Wdps Haste Str Mastery Vers Sta Crit
Scale Factors 8.31 0.91 0.74 -0.06 -0.12 -0.22 -0.41
Normalized 11.22 1.23 1.00 -0.09 -0.16 -0.30 -0.55
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Haste > Str > Mastery > Vers > Sta > Crit
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=0.74, Stamina=-0.22, CritRating=-0.41, HasteRating=0.91, MasteryRating=-0.06, Versatility=-0.12, Dps=8.31 )
Scale Factors for Nêreus Absorb Per Second
Wdps Str Haste Vers Crit Sta Mastery
Scale Factors 5.75 0.99 0.87 0.54 0.35 0.18 -0.00
Normalized 5.81 1.00 0.88 0.55 0.35 0.18 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.59 0.58 0.57 0.58 0.60 0.57 0.52
Ranking
  • Wdps > Str ~= Haste ~= Vers ~= Crit ~= Sta ~= Mastery
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=0.99, Stamina=0.18, CritRating=0.35, HasteRating=0.87, MasteryRating=-0.00, Versatility=0.54, Dps=5.75 )
Scale Factors for Healing + Absorb per second
Wdps Haste Str Vers Sta Crit Mastery
Scale Factors 14.06 1.78 1.73 0.42 -0.04 -0.06 -0.07
Normalized 8.12 1.03 1.00 0.24 -0.03 -0.04 -0.04
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.63 0.60 0.61 0.61 0.61 0.63 0.56
Ranking
  • Wdps > Haste ~= Str > Vers ~= Sta ~= Crit ~= Mastery
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=1.73, Stamina=-0.04, CritRating=-0.06, HasteRating=1.78, MasteryRating=-0.07, Versatility=0.42, Dps=14.06 )
Scale Factors for Nêreus Damage Taken Per Second
Vers Crit Mastery Wdps Str Haste Sta
Scale Factors -6.69 -6.17 -6.03 -5.59 -4.96 -2.07 -0.48
Normalized 1.35 1.24 1.21 1.13 1.00 0.42 0.10
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.35 0.35 0.34 0.35 0.34 0.35 0.35
Ranking
  • Vers > Crit ~= Mastery > Wdps > Str > Haste > Sta
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=4.96, Stamina=0.48, CritRating=6.17, HasteRating=2.07, MasteryRating=6.03, Versatility=6.69, Dps=5.59 )
Scale Factors for Nêreus Damage Taken
Vers Crit Mastery Wdps Str Haste Sta
Scale Factors -1994.51 -1849.53 -1802.58 -1674.82 -1476.63 -610.70 -135.32
Normalized 1.35 1.25 1.22 1.13 1.00 0.41 0.09
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Vers > Crit > Mastery > Wdps > Str > Haste > Sta
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=1476.63, Stamina=135.32, CritRating=1849.53, HasteRating=610.70, MasteryRating=1802.58, Versatility=1994.51, Dps=1674.82 )
Scale Factors for Nêreus Healing Taken Per Second
Vers Crit Mastery Wdps Str Haste Sta
Scale Factors -6.02 -5.51 -5.42 -4.88 -4.38 -2.01 -0.46
Normalized 1.38 1.26 1.24 1.11 1.00 0.46 0.11
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Vers > Crit > Mastery > Wdps > Str > Haste > Sta
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=4.38, Stamina=0.46, CritRating=5.51, HasteRating=2.01, MasteryRating=5.42, Versatility=6.02, Dps=4.88 )
Scale Factors for Nêreus Fight Length
Str Haste Mastery Sta Wdps Vers Crit
Scale Factors 0.00 0.00 0.00 -0.00 -0.00 -0.00 -0.00
Normalized 1.00 0.49 0.01 -0.01 -0.52 -0.52 -0.52
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Str > Haste > Mastery > Sta > Wdps > Vers > Crit
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=0.00, Stamina=-0.00, CritRating=-0.00, HasteRating=0.00, MasteryRating=0.00, Versatility=-0.00, Dps=-0.00 )
Scale Factors for Raid Damage Per Second
Wdps Str Crit Haste Mastery Vers Sta
Scale Factors 29.11 5.19 4.10 3.33 3.16 3.10 0.03
Normalized 5.61 1.00 0.79 0.64 0.61 0.60 0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.14 0.13 0.13 0.13 0.13 0.13 0.13
Ranking
  • Wdps > Str > Crit > Haste > Mastery ~= Vers > Sta
Pawn string ( Pawn: v1: "Nêreus-Protection": Class=Paladin, Spec=Protection, Strength=5.19, Stamina=0.03, CritRating=4.10, HasteRating=3.33, MasteryRating=3.16, Versatility=3.10, Dps=29.11 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Nêreus271,662
Avenger's Shield 26,605 (29,237)9.8% (10.8%)38.37.77s228,699196,538Direct38.3 (76.6)170,608366,623208,18019.2% (19.2%)

Stats Details: Avengers Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage38.2938.280.000.000.001.16370.00007,969,065.807,969,065.800.00%196,537.95196,537.95
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.84%30.951746170,607.61135,283258,860170,628.02157,134184,3225,279,6175,279,6170.00%
crit19.16%7.34019366,623.29275,054519,174367,622.640492,3812,689,4492,689,4490.00%

Action Details: Avengers Shield

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=true}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Action Priority List

    standard
    [R]:38.30
  • if_expr:!talent.lights_guidance.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    Tyr's Enforcer (avengers_shield) 2,6331.0%38.37.77s20,6020Direct38.316,94635,97020,60119.2%

Stats Details: Tyrs Enforceravengers Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage38.2838.280.000.000.000.00000.0000788,665.21788,665.210.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.78%30.93174516,946.0214,14423,08716,949.1215,86918,070524,071524,0710.00%
crit19.22%7.3601835,970.3128,87746,04536,048.97044,837264,594264,5940.00%

Action Details: Tyrs Enforceravengers Shield

  • id:378286
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:378286
  • name:Tyr's Enforcer
  • school:holy
  • tooltip:
  • description:{$@spelldesc378285=Your Avenger's Shield is imbued with holy fire, causing it to deal {$=}<dmg> Holy damage to all enemies within {$378286=}A1 yards of each target hit.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Blessed Hammer 0 (9,083)0.0% (3.3%)56.95.15s47,86140,256

Stats Details: Blessed Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage56.890.000.000.000.001.18890.00000.000.000.00%40,256.2340,256.23

Action Details: Blessed Hammer

  • id:204019
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Spelldata

  • id:204019
  • name:Blessed Hammer
  • school:holy
  • tooltip:
  • description:Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    standard
    [V]:56.89

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown Duration (Category)Paladin1370265SET1.000
    Blessed Hammer (_tick) 9,0833.3%0.00.00s00Periodic113.420,19442,15924,01917.4%0.0%

Stats Details: Blessed Hammer Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00113.360.000.00000.00002,722,770.342,722,770.340.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.59%93.626312920,194.3817,20627,88920,193.9619,18721,3521,890,5821,890,5820.00%
crit17.41%19.7453942,159.3734,89355,10542,189.1738,12046,755832,189832,1890.00%

Action Details: Blessed Hammer Tick

  • id:204301
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:9.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:204301
  • name:Blessed Hammer
  • school:holy
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Consecration 0 (21,819)0.0% (8.0%)23.812.93s275,008241,252

Stats Details: Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage23.770.000.000.000.001.14000.00000.000.000.00%241,252.21241,252.21

Action Details: Consecration

  • id:26573
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:4.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=false}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=false}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Action Priority List

    standard
    [S]:20.14
  • if_expr:!consecration.up
    standard
    [X]:2.63

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    Consecration (_tick) 7,3852.7%0.00.00s00Periodic349.55,23711,0506,33218.8%0.0%

Stats Details: Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00349.450.000.00000.00002,212,746.062,212,746.060.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit81.17%283.642033775,237.354,3977,1775,238.695,0385,5291,485,5521,485,5520.00%
crit18.83%65.813210011,049.998,79414,54611,057.9110,35911,922727,194727,1940.00%

Action Details: Consecration Tick

  • id:81297
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
    Divine Guidance 14,4345.3%22.513.09s192,1930Direct22.5156,176355,497192,21318.1%

Stats Details: Divine Guidance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.5122.510.000.000.000.00000.00004,325,430.014,325,430.010.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.93%18.44928156,175.6236,092279,292156,432.59107,446194,4472,879,4832,879,4830.00%
crit18.07%4.07012355,497.2272,444558,830353,840.120549,4051,445,9471,445,9470.00%

Action Details: Divine Guidance

  • id:433808
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:433808
  • name:Divine Guidance
  • school:holy
  • tooltip:
  • description:{$@spelldesc433106=For each Holy Power ability cast, your next Consecration deals {$=}<value> damage or healing immediately, split across all enemies and allies.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Digestive Venom 10,8184.0%3.2108.73s996,4390Periodic31.577,337155,489102,55332.3%21.0%

Stats Details: Digestive Venom

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.240.0031.4731.470.000.00002.00003,227,091.663,227,091.660.00%51,274.950.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit67.74%21.32113777,336.6474,64684,15777,350.9074,64680,5771,648,5871,648,5870.00%
crit32.26%10.15123155,489.43149,293168,314155,572.82149,293168,3141,578,5051,578,5050.00%

Action Details: Digestive Venom

  • id:444264
  • school:nature
  • range:6.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:64078.64
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:444264
  • name:Digestive Venom
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every {$=}T1 sec.
  • description:Inject an enemy with digestive venom, dealing {$444258s1=261626} Nature damage over 20 sec. While active, your attacks and abilities against the target restore {$444258s2=13627} health. Cannot occur more than every 1 sec. Overhealing from this effect permanently increases your maximum health by the same amount, becoming an absorb shield upon leaving combat.
Divine Toll 0 (17,334)0.0% (6.4%)5.460.48s954,357813,748

Stats Details: Divine Toll

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.430.000.000.000.001.17300.00000.000.000.00%813,747.80813,747.80

Action Details: Divine Toll

  • id:375576
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:375576
  • name:Divine Toll
  • school:holy
  • tooltip:
  • description:Instantly cast {$?a137029=false}[Holy Shock]?a137028[Avenger's Shield]?a137027[Judgment][Holy Shock, Avenger's Shield, or Judgment] on up to {$s1=5} targets within {$=}A2 yds.{$?=}(a384027|a386738|a387893)[ After casting Divine Toll, you instantly cast ][]{$?=}(a387893&c1)[Holy Shock]?(a386738&c2)[Avenger's Shield]?(a384027&c3)[Judgment][]{$?a387893=true}[ every {$387895t1=5} sec. This effect lasts {$387895d=15 seconds}.][]{$?a384027=true}[ every {$384029t1=5} sec. This effect lasts {$384029d=15 seconds}.][]{$?a386738=true}[ every {$386730t1=5} sec. This effect lasts {$386730d=15 seconds}.][]{$?=}c3[ Divine Toll's Judgment deals {$326011s1=100}% increased damage.][]{$?=}c2[ Generates {$s5=1} Holy Power per target hit.][]

Action Priority List

    standard
    [P]:5.43
  • if_expr:(!raid_event.adds.exists|raid_event.adds.in>10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Hasted Global CooldownPaladin1370268SET1.000
    Avenger's Shield (_dt) 3,862 (4,274)1.4% (1.6%)5.460.48s234,9550Direct5.4 (10.9)165,834349,023212,33225.4% (25.3%)

Stats Details: Avengers Shield Dt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.435.430.000.000.000.00000.00001,153,407.981,153,407.980.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit74.62%4.0506165,834.09137,069206,498165,317.780192,683672,142672,1420.00%
crit25.38%1.3805349,023.21275,124404,058282,191.440404,058481,266481,2660.00%

Action Details: Avengers Shield Dt

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=true}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
        Tyr's Enforcer (avengers_shield_dt) 4130.2%5.460.47s22,7070Direct5.417,75637,36422,70825.3%

Stats Details: Tyrs Enforceravengers Shield Dt

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.435.430.000.000.000.00000.0000123,346.49123,346.490.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit74.75%4.060617,755.9214,84722,03917,704.84020,68772,09472,0940.00%
crit25.25%1.370537,363.6129,69343,78930,019.39042,73851,25251,2520.00%

Action Details: Tyrs Enforceravengers Shield Dt

  • id:378286
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:378286
  • name:Tyr's Enforcer
  • school:holy
  • tooltip:
  • description:{$@spelldesc378285=Your Avenger's Shield is imbued with holy fire, causing it to deal {$=}<dmg> Holy damage to all enemies within {$378286=}A1 yards of each target hit.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
    Avenger's Shield (_dr) 11,857 (13,059)4.4% (4.8%)15.818.30s247,4220Direct15.8 (31.6)175,284371,844224,73725.2% (25.1%)

Stats Details: Avengers Shield Dr

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.8015.790.000.000.000.00000.00003,549,103.243,549,103.240.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit74.83%11.82418175,284.44137,527255,390175,334.98155,797199,8572,071,2882,071,2880.00%
crit25.17%3.97011371,843.95278,216517,720368,806.800500,7611,477,8151,477,8150.00%

Action Details: Avengers Shield Dr

  • id:31935
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:31935
  • name:Avenger's Shield
  • school:holy
  • tooltip:Silenced.
  • description:Hurls your shield at an enemy target, dealing {$s1=0} Holy damage, interrupting and silencing the non-Player target for {$d=3 seconds}, and then jumping to {$=}{{$=}x1-1} additional nearby enemies. {$?a209389=true}[ Shields you for {$209388d=8 seconds}, absorbing {$209389s1=60}% as much damage as it dealt.][]{$?a378285=true}[ Deals {$=}<dmg> additional damage to all enemies within {$378286=}A1 yds of each target hit.][]

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
        Tyr's Enforcer (avengers_shield_dr) 1,2030.4%15.818.30s22,8070Direct15.817,81037,70322,80825.1%

Stats Details: Tyrs Enforceravengers Shield Dr

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.7915.790.000.000.000.00000.0000360,157.01360,157.010.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit74.88%11.8241817,809.6414,39023,02317,802.4215,96119,398210,579210,5790.00%
crit25.12%3.9701337,702.5228,78045,42837,450.55044,537149,578149,5780.00%

Action Details: Tyrs Enforceravengers Shield Dr

  • id:378286
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:378286
  • name:Tyr's Enforcer
  • school:holy
  • tooltip:
  • description:{$@spelldesc378285=Your Avenger's Shield is imbued with holy fire, causing it to deal {$=}<dmg> Holy damage to all enemies within {$378286=}A1 yards of each target hit.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Eye of Tyr 7,4012.7%6.747.48s331,838280,556Direct6.7271,928577,191331,86319.6%

Stats Details: Eye Of Tyr

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.676.670.000.000.001.18280.00002,214,707.982,214,707.980.00%280,555.86280,555.86
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.38%5.3618271,927.73230,583351,991271,671.75242,938326,1421,458,7731,458,7730.00%
crit19.62%1.3106577,191.26453,291704,089450,990.040704,089755,934755,9340.00%

Action Details: Eye Of Tyr

  • id:387174
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:387174
  • name:Eye of Tyr
  • school:holy
  • tooltip:Dealing {$s1=25}% less damage to the Paladin.
  • description:Releases a blinding flash from your shield, causing {$s2=0} Holy damage to all nearby enemies within {$=}A1 yds and reducing all damage they deal to you by {$s1=25}% for {$d=6 seconds}.

Action Priority List

    standard
    [T]:6.67
  • if_expr:(talent.inmost_light.enabled&raid_event.adds.in>=45|spell_targets.shield_of_the_righteous>=3)&!talent.lights_deliverance.enabled

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Hammer of Wrath 20,4807.6%22.414.33s274,316239,632Direct22.4210,345441,864274,55827.7%

Stats Details: Hammer Of Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.3822.360.000.000.001.14470.00006,140,332.436,140,332.430.00%239,632.08239,632.08
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit72.26%16.16527210,344.56166,900266,131210,596.56189,675228,6343,399,3093,399,3090.00%
crit27.74%6.20015441,864.15339,337533,758442,450.020498,0522,741,0232,741,0230.00%

Action Details: Hammer Of Wrath

  • id:24275
  • school:holy
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$=}<damage> {$?s403664=false}[Holystrike][Holy] damage. Only usable on enemies that have less than 20% health{$?s326730=true}[, or during Avenging Wrath][]. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    standard
    [N]:22.38

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Hasted Global CooldownProtection Paladin1370285SET1.000
Spell Direct AmountProtection Paladin13702818PCT68.0%
Hasted Cooldown Duration (Category)Paladin1370266SET1.000
Holy Shield 2,2300.8%44.16.68s15,1260Direct44.112,08625,64915,13322.5%

Stats Details: Holy Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage44.1444.120.000.000.000.00000.0000667,687.72667,687.720.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.54%34.21156012,086.019,99216,03112,086.8111,28413,104413,491413,4910.00%
crit22.46%9.9102425,649.1419,98431,97225,667.86029,337254,196254,1960.00%

Action Details: Holy Shield

  • id:157122
  • school:holy
  • range:100.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:157122
  • name:Holy Shield
  • school:holy
  • tooltip:
  • description:{$@spelldesc152261=Your block chance is increased by {$s1=20}%, you are able to block spells, and your successful blocks deal {$157122s1=0} Holy damage to your attacker.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Judgment 54,978 (65,832)20.3% (24.2%)79.83.76s247,138210,755Direct79.7 (95.2)169,808359,140206,56219.4% (20.2%)

Stats Details: Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage79.7579.720.000.000.001.17260.000016,467,505.9316,467,505.930.00%210,755.45210,755.45
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.59%64.244188169,808.41144,254230,789169,835.66161,496179,09510,908,89510,908,8950.00%
crit19.41%15.48331359,139.51288,508462,873359,648.81317,574415,1465,558,6115,558,6110.00%

Action Details: Judgment

  • id:275779
  • school:holy
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:11.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:0.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.08
  • base_multiplier:1.50

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275779
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target, dealing {$s1=0} Holy damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability][].{$?a315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Action Priority List

    standard
    [O]:6.23
  • if_expr:charges>=2|full_recharge_time<=gcd.max
  • target_if_expr:debuff.judgment.remains
    standard
    [Q]:73.52
  • target_if_expr:debuff.judgment.remains

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Modify Recharge Time% (Category)Protection Paladin1370283SET-0.500
Hasted Global CooldownProtection Paladin1370285SET1.000
Hasted Cooldown Duration (Category)Protection Paladin1370286SET1.000
Spell Direct AmountProtection Paladin13702811PCT-14.0%
    Hammer and Anvil 10,8534.0%15.518.79s209,4770Direct15.5164,743349,361209,45824.2%

Stats Details: Hammer And Anvil

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.4815.480.000.000.000.00000.00003,242,133.253,242,133.250.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit75.77%11.73228164,742.93136,428215,311164,936.71146,791190,0901,932,0121,932,0120.00%
crit24.23%3.75012349,361.26273,768429,416342,797.670408,5771,310,1211,310,1210.00%

Action Details: Hammer And Anvil

  • id:433717
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:433717
  • name:Hammer and Anvil
  • school:holy
  • tooltip:
  • description:{$@spelldesc433583=Imbue your weapon with the power of the Light, increasing your Stamina by {$433584s1=3}% and causing your Holy Power abilities to sometimes unleash a burst of healing around a target. Lasts {$433584d=3600 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
melee 18,6896.9%178.82.01s31,31715,583Direct178.825,80054,52131,31719.2%

Stats Details: Melee

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage178.82178.820.000.000.002.00970.00005,600,075.188,000,099.4030.00%15,582.5115,582.51
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.79%144.479919625,799.5421,58235,22925,805.5724,72427,2243,727,4045,324,85830.00%
crit19.21%34.35156254,521.1443,16570,25954,568.3350,30259,4491,872,6712,675,24230.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Sacred Weapon (_proc_damage) 11,2264.1%20.114.19s166,5540Direct20.1131,546279,672166,54823.6%

Stats Details: Sacred Weapon Proc Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage20.1220.120.000.000.000.00000.00003,351,638.133,351,638.130.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit76.37%15.37232131,546.38105,528171,766131,688.91117,286148,7922,021,5902,021,5900.00%
crit23.63%4.76014279,671.58219,015343,533277,908.610331,1991,330,0481,330,0480.00%

Action Details: Sacred Weapon Proc Damage

  • id:432616
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:432616
  • name:Sacred Weapon
  • school:holy
  • tooltip:
  • description:{$@spelldesc432502=While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Shield of the Righteous 33,830 (54,788)12.5% (20.1%)84.33.57s194,1560Direct84.3 (115.7)98,110194,666120,15022.8% (26.2%)

Stats Details: Shield Of The Righteous

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage84.2884.280.000.000.000.00000.000010,126,864.3210,126,864.320.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit77.17%65.04389498,110.3439,230205,52898,184.8787,345110,5006,381,4206,381,4200.00%
crit22.83%19.24534194,665.7881,210408,367194,878.64146,532242,4203,745,4443,745,4440.00%

Action Details: Shield Of The Righteous

  • id:53600
  • school:holy
  • range:5.0
  • travel_speed:0.0000
  • radius:6.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53600
  • name:Shield of the Righteous
  • school:holy
  • tooltip:
  • description:Slams enemies in front of you with your shield, causing {$s1=0} Holy damage, and increasing your Armor by {$?=}c1[{$=}{{$132403s1=160}*{$=}INT/100}][{$=}{{$132403s1=160}*{$=}STR/100}] for {$132403d=4.500 seconds}.{$?a386568=false}[ {$@spelldesc386568=When Shield of the Righteous expires, gain {$386556s1=10}% block chance and deal {$386553s1=0} Holy damage to all attackers for {$386556d=4 seconds}.}][]{$?a280373=true}[ {$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}][]

Action Priority List

    standard
    [L]:84.28
  • if_expr:(((!talent.righteous_protector.enabled|cooldown.righteous_protector_icd.remains=0)&holy_power>2)|buff.bastion_of_light.up|buff.divine_purpose.up)&!((buff.hammer_of_light_ready.up|buff.hammer_of_light_free.up))

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Hasted Cooldown DurationProtection Paladin1370284SET1.000
Hasted Global CooldownProtection Paladin1370285SET1.000
    Forge's Reckoning 20,9587.7%31.48.39s198,5970Direct31.4146,992294,366198,66835.1%

Stats Details: Forges Reckoning

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage31.4131.390.000.000.000.00000.00006,237,018.216,237,018.210.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit64.93%20.38833146,992.00131,409171,766147,001.73138,973157,6802,996,1572,996,1570.00%
crit35.07%11.01123294,365.70257,456338,928294,501.90275,214319,4293,240,8613,240,8610.00%

Action Details: Forges Reckoning

  • id:447258
  • school:holy
  • range:100.0
  • travel_speed:30.0000
  • radius:5.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:447258
  • name:Forge's Reckoning
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} damage to enemy targets. Reduced above {$s2=5} targets.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin1370281PCT26.0%
Spell Periodic AmountProtection Paladin1370282PCT26.0%
Spidersting 2,7261.0%11.020.42s74,8170Periodic96.67,21614,5158,50517.7%25.3%

Stats Details: Spidersting

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.980.0096.5896.582.960.00000.7861821,556.94821,556.940.00%10,820.920.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.34%79.52251667,215.89749,7937,099.654,84619,406573,943573,9430.00%
crit17.66%17.0614514,514.972688,52114,270.837,76243,015247,614247,6140.00%

Action Details: Spidersting

  • id:452229
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:6896.11
  • base_td_mult:1.00
  • base_multiplier:0.66
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:452229
  • name:Spidersting
  • school:nature
  • tooltip:Suffering {$=}w1 Nature damage every second.
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Nêreus 239511
blessed_hammer_absorb 6,4842.7%0.00.00s00Direct96.720,111020,1110.0%

Stats Details: Blessed Hammer Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0096.710.000.000.000.00000.00001,944,902.300.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%96.716712720,110.9117,97423,96720,110.5419,40621,0861,944,90200.00%
bulwark_of_order_absorb 25,33410.6%0.00.00s00Direct55.5136,7840136,7840.0%

Stats Details: Bulwark Of Order Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0055.460.000.000.000.00000.00007,585,847.360.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%55.463872136,783.851,010645,403137,098.71112,644173,5267,585,84700.00%
Divine Guidance (_heal) 12,9995.4%22.513.09s173,1320Direct22.5139,662324,111173,12718.1%

Stats Details: Divine Guidance Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal22.5122.510.000.000.000.00000.00003,896,443.054,155,130.346.23%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.86%18.421028139,662.170267,063139,878.7189,010186,2132,572,6812,763,1876.92%
crit18.14%4.08013324,110.730524,441323,384.010508,0021,323,7621,391,9444.95%

Action Details: Divine Guidance Heal

  • id:433807
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:1
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:433807
  • name:Divine Guidance
  • school:holy
  • tooltip:
  • description:{$@spelldesc433106=For each Holy Power ability cast, your next Consecration deals {$=}<value> damage or healing immediately, split across all enemies and allies.}
holy_bulwark_absorb 56,17923.5%0.00.00s00Direct71.4235,6260235,6260.0%

Stats Details: Holy Bulwark Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0071.440.000.000.000.00000.000016,825,185.120.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%71.4432136235,625.863781,998,666235,746.63212,660296,02816,825,18500.00%
Judgment of Light 12,6545.3%222.51.35s17,0560Direct222.514,12329,62717,05618.9%

Stats Details: Judgment Of Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal222.48222.480.000.000.000.00000.00003,794,722.553,799,408.660.12%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit81.08%180.4013124014,123.49019,11614,126.6913,52914,8232,547,8422,549,6440.07%
crit18.92%42.09187029,626.74337,80429,647.0827,58032,0721,246,8801,249,7650.23%

Action Details: Judgment Of Light

  • id:183811
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.175000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:183811
  • name:Judgment of Light
  • school:holy
  • tooltip:
  • description:{$@spelldesc183778=Judgment causes the next {$196941=}N successful attacks against the target to heal the attacker for {$183811s1=0}. {$@=}switch<{$s2=1}>[][This effect can only occur once every {$s1=1} sec on each target.]}
Leech 5,8632.4%255.21.17s6,8770Direct255.26,87606,8760.0%

Stats Details: Leech

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal255.22255.220.000.000.000.00000.00001,755,188.841,885,869.336.93%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%255.222033096,876.50-057,6786,888.395,9158,0551,755,1891,885,8696.96%

Action Details: Leech

  • id:143924
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:143924
  • name:Leech
  • school:physical
  • tooltip:
  • description:Health leeched.
moment_of_glory_absorb 16,9767.1%0.00.00s00Direct36.1140,3960140,3960.0%

Stats Details: Moment Of Glory Absorb

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb0.0036.120.000.000.000.00000.00005,071,283.930.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%36.122447140,396.4001,692,807141,062.95104,458228,8875,071,28400.00%
Sacred Weapon (_proc_heal) 18,3767.7%19.814.07s278,0010Direct19.8230,321479,064277,98319.2%

Stats Details: Sacred Weapon Proc Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal19.8119.810.000.000.000.00000.00005,507,354.605,765,637.844.48%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit80.83%16.01336230,320.780320,476230,581.71155,276274,4683,688,2843,847,9254.10%
crit19.17%3.80012479,063.640640,952468,357.390620,0611,819,0711,917,7135.04%

Action Details: Sacred Weapon Proc Heal

  • id:441590
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:5
  • split_aoe_damage:false
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:441590
  • name:Sacred Weapon
  • school:holy
  • tooltip:
  • description:{$@spelldesc432502=While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.}
Tasty Juices 9,2363.8%54.95.17s50,1660Direct54.937,81875,52750,05532.4%

Stats Details: Tasty Juices

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal54.9554.950.000.000.000.00000.00002,756,603.212,810,147.321.91%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.55%37.12186037,817.99040,53037,892.6136,29339,9101,406,8181,431,9261.77%
crit32.45%17.8353375,526.85081,05975,691.4166,75480,3571,349,7851,378,2212.08%

Action Details: Tasty Juices

  • id:446805
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:33375.13
  • base_dd_max:33375.13
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:446805
  • name:Tasty Juices
  • school:nature
  • tooltip:
  • description:{$@spelldesc444264=Inject an enemy with digestive venom, dealing {$444258s1=261626} Nature damage over 20 sec. While active, your attacks and abilities against the target restore {$444258s2=13627} health. Cannot occur more than every 1 sec. Overhealing from this effect permanently increases your maximum health by the same amount, becoming an absorb shield upon leaving combat.}
Word of Glory 75,189 (75,236)31.4% (31.4%)14.714.02s1,528,9201,262,578Direct14.7 (14.8)1,362,8682,547,8231,527,62913.9% (14.0%)

Stats Details: Word Of Glory

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal14.7314.730.000.000.001.21100.000022,512,285.1025,085,972.2310.26%1,262,577.591,262,577.59
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit86.10%12.692221,362,868.2203,821,4361,366,544.43288,2262,487,97617,292,63418,903,5928.88%
crit13.90%2.05082,547,823.3807,452,7252,267,047.2407,430,5685,219,6516,182,38021.12%

Action Details: Word Of Glory

  • id:85673
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:false

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.465000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.75
  • base_multiplier:1.00

Spelldata

  • id:85673
  • name:Word of Glory
  • school:holy
  • tooltip:
  • description:Calls down the Light to heal a friendly target for $130551s1{$?a378405=true}[ and an additional {$=}<heal> over {$378412d=15 seconds}][].{$?a379043=true}[ Your block chance is increased by {$379043s1=5}% for {$379041d=5 seconds}.][]{$?a315921=true}&!a315924[ |cFFFFFFFFProtection:|r If cast on yourself, healing increased by up to {$315921s1=300}% based on your missing health.][]{$?a315924=false}[ |cFFFFFFFFProtection:|r Healing increased by up to {$315921s1=300}% based on your missing health, or up to {$315924s1=100}% if cast on another target.][]

Action Priority List

    standard
    [W]:14.74
  • if_expr:buff.shining_light_free.up

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountProtection Paladin13702817PCT75.0%
    Sacred Word 470.0%0.164.53s152,3200Direct0.1115,419228,713152,36232.6%

Stats Details: Sacred Word

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal0.100.100.000.000.000.00000.000014,624.1917,664.7717.21%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.40%0.0603115,418.790156,7897,246.320156,7897,4738,9901.05%
crit32.60%0.0302228,712.540302,9866,999.480302,9867,1518,6750.54%

Action Details: Sacred Word

  • id:447246
  • school:holy
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:447246
  • name:Sacred Word
  • school:holy
  • tooltip:
  • description:Heals the target for {$s1=0}.
Simple Action Stats Execute Interval
Nêreus
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Avenging Wrath 3.0120.41s

Stats Details: Avenging Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.990.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Avenging Wrath

  • id:31884
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:{$?=}{$=}w2>0&{$=}w3>0[Damage, healing and critical strike chance increased by {$=}w2%.]?{$=}w3==0&{$=}w2>0[Damage and healing increased by {$=}w2%.]?{$=}w2==0&{$=}w3>0[Critical strike chance increased by {$=}w3%.][]{$?a53376=true}[ ][]{$?a53376=true}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=true}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]{$?s384442=true}&s384376[increasing your damage, healing and critical strike chance by {$s2=0}% for {$d=20 seconds}.]?!s384442&s384376[increasing your damage and healing by {$s1=0}% for {$d=20 seconds}.]?!s384376&s384442[increasing your critical strike chance by {$s3=0}% for {$d=20 seconds}.][and activating all the effects learned for Avenging Wrath for {$d=20 seconds}.]

Action Priority List

    cooldowns
    [G]:2.99
Bastion of Light 3.0120.41s

Stats Details: Bastion Of Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.990.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Bastion Of Light

  • id:378974
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:378974
  • name:Bastion of Light
  • school:holy
  • tooltip:Your next {$=}U casts of Judgment generate {$s1=2} additional Holy Power.
  • description:Your next {$=}U casts of Judgment generate {$s1=2} additional Holy Power.

Action Priority List

    cooldowns
    [J]:2.99
  • if_expr:buff.avenging_wrath.up|cooldown.avenging_wrath.remains<=30
Devotion Aura 1.00.00s

Stats Details: Devotion Aura

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Devotion Aura

  • id:465
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:465
  • name:Devotion Aura
  • school:holy
  • tooltip:Damage taken reduced by {$=}w1%.
  • description:Party and raid members within {$=}a1 yds are bolstered by their devotion, reducing damage taken by {$s1=3}%.
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of the Divine Day 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457283
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Holy Bulwark (Holy Armaments) 6.742.59s

Stats Details: Holy Armaments

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.730.000.000.000.001.15170.00000.000.000.00%0.000.00

Action Details: Holy Armaments

  • id:432459
  • school:holy
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:432459
  • name:Holy Bulwark
  • school:holy
  • tooltip:
  • description:Will the Light to coalesce and become manifest as a Holy Armament, wielded by your friendly target. {$@=}spellicon432496 {$@=}spellname432496: {$@spelldesc432496=While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.} Becomes Sacred Weapon after use.

Action Priority List

    standard
    [M]:3.60
  • if_expr:next_armament=sacred_weapon&(!buff.sacred_weapon.up|(buff.sacred_weapon.remains<6&!buff.avenging_wrath.up&cooldown.avenging_wrath.remains<=30))
    standard
    [U]:3.13
  • if_expr:next_armament=holy_bulwark
holy_bulwark 7.338.66s

Stats Details: Holy Bulwark

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage7.340.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Holy Bulwark

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Light of the Titans 14.714.02s

Stats Details: Light Of The Titans

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal14.7314.730.000.000.000.00000.00000.000.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit86.21%12.702230.00000.0000000.00%
crit13.79%2.030110.00000.0000000.00%

Action Details: Light Of The Titans

  • id:378405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:378405
  • name:Light of the Titans
  • school:physical
  • tooltip:
  • description:Word of Glory heals for an additional {$s1=20}% over {$378412d=15 seconds}. Increased by {$s2=100}% if cast on yourself while you are afflicted by a harmful damage over time effect.
Light of the Titans (_hot) 14.714.02s

Stats Details: Light Of The Titans Hot

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal14.7314.7345.7145.7110.530.00003.00000.000.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit86.26%12.713240.00000.0000000.00%
crit13.74%2.02090.00000.0000000.00%
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit84.81%38.7710630.00000.0000000.00%
crit15.19%6.940200.00000.0000000.00%

Action Details: Light Of The Titans Hot

  • id:378412
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:unknown

Spelldata

  • id:378412
  • name:Light of the Titans
  • school:holy
  • tooltip:Healing for {$=}w1 every {$t1=3} sec.
  • description:{$@spelldesc378405=Word of Glory heals for an additional {$s1=20}% over {$378412d=15 seconds}. Increased by {$s2=100}% if cast on yourself while you are afflicted by a harmful damage over time effect.}
Moment of Glory 3.790.37s

Stats Details: Moment Of Glory

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.650.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Moment Of Glory

  • id:327193
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:327193
  • name:Moment of Glory
  • school:holy
  • tooltip:Avenger's Shield damage increased by {$s2=20}% and cooldown reduced by {$s1=75}%. Generating an absorb shield for {$s2=20}% of all damage dealt.
  • description:For the next {$d=15 seconds}, you generate an absorb shield for {$s3=25}% of all damage you deal, and Avenger's Shield damage is increased by {$s2=20}% and its cooldown is reduced by {$s1=75}%.

Action Priority List

    cooldowns
    [I]:3.66
  • if_expr:(buff.avenging_wrath.remains<15|(time>10))
Tempered Potion 1.00.00s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [H]:1.00
  • if_expr:buff.avenging_wrath.up
Rite of Sanctification 1.00.00s

Stats Details: Rite Of Sanctification

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Rite Of Sanctification

  • id:433568
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:433568
  • name:Rite of Sanctification
  • school:holy
  • tooltip:
  • description:Imbue your weapon with the power of the Light, increasing your armor by {$433550s2=5}% and your primary stat by {$433550s1=1}%. Lasts {$433550d=3600 seconds}.
sacred_weapon 10.829.51s

Stats Details: Sacred Weapon

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.800.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sacred Weapon

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
arakara_sacbrood 11.020.42s

Stats Details: Spiderfling

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.990.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Spiderfling

  • id:452227
  • school:physical
  • range:100.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:452227
  • name:Spiderfling
  • school:physical
  • tooltip:
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Avenging Wrath3.00.0120.4s120.4s24.1s24.23%26.67%0.0 (0.0)2.8

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 121.2s
  • trigger_min/max:120.0s / 121.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:20.71% / 28.29%

Stack Uptimes

  • avenging_wrath_1:24.23%

Spelldata

  • id:31884
  • name:Avenging Wrath
  • tooltip:{$?=}{$=}w2>0&{$=}w3>0[Damage, healing and critical strike chance increased by {$=}w2%.]?{$=}w3==0&{$=}w2>0[Damage and healing increased by {$=}w2%.]?{$=}w2==0&{$=}w3>0[Critical strike chance increased by {$=}w3%.][]{$?a53376=true}[ ][]{$?a53376=true}&a137029[Holy Shock's cooldown reduced by {$=}w6%.]?a53376&a137028[Judgment generates {$53376s3=1} additional Holy Power.]?a53376[Each Holy Power spent deals {$326731s1=0} Holy damage to nearby enemies.][]
  • description:Call upon the Light to become an avatar of retribution, {$?s53376=true}&c2[causing Judgment to generate {$53376s3=1} additional Holy Power, ]?s53376&c3[each Holy Power spent causing you to explode with Holy light for {$326731s1=0} damage to nearby enemies, ]?s53376&c1[reducing Holy Shock's cooldown by {$53376s2=50}%, ][]{$?s326730=true}[allowing Hammer of Wrath to be used on any target, ][]{$?s384442=true}&s384376[increasing your damage, healing and critical strike chance by {$s2=0}% for {$d=20 seconds}.]?!s384442&s384376[increasing your damage and healing by {$s1=0}% for {$d=20 seconds}.]?!s384376&s384442[increasing your critical strike chance by {$s3=0}% for {$d=20 seconds}.][and activating all the effects learned for Avenging Wrath for {$d=20 seconds}.]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Barricade of Faith14.324.021.5s7.8s18.1s86.11%74.95%24.0 (24.0)13.4

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_barricade_of_faith
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 104.7s
  • trigger_min/max:1.1s / 21.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 102.7s
  • uptime_min/max:78.94% / 93.39%

Stack Uptimes

  • barricade_of_faith_1:86.11%

Spelldata

  • id:385726
  • name:Barricade of Faith
  • tooltip:
  • description:When you use Avenger's Shield, your block chance is increased by {$385724s1=10}% for {$385724d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Bastion of Light3.00.0120.4s120.4s15.1s15.12%18.38%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_bastion_of_light
  • max_stacks:5
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 121.2s
  • trigger_min/max:120.0s / 121.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.9s
  • uptime_min/max:9.97% / 20.85%

Stack Uptimes

  • bastion_of_light_1:3.34%
  • bastion_of_light_2:3.34%
  • bastion_of_light_3:3.50%
  • bastion_of_light_4:3.14%
  • bastion_of_light_5:1.79%

Spelldata

  • id:378974
  • name:Bastion of Light
  • tooltip:Your next {$=}U casts of Judgment generate {$s1=2} additional Holy Power.
  • description:Your next {$=}U casts of Judgment generate {$s1=2} additional Holy Power.
  • max_stacks:5
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Blessed Hammer (_absorb)96.70.03.0s3.0s0.0s0.00%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_blessed_hammer_absorb
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 30.9s
  • trigger_min/max:0.0s / 30.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s
  • uptime_min/max:0.00% / 0.00%

Stack Uptimes

Spelldata

  • id:204301
  • name:Blessed Hammer
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of Dawn52.70.05.7s5.7s2.4s24.01%54.14%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_blessing_of_dawn
  • max_stacks:2
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.6s / 13.9s
  • trigger_min/max:2.6s / 13.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.1s
  • uptime_min/max:6.60% / 40.27%

Stack Uptimes

  • blessing_of_dawn_1:24.01%

Spelldata

  • id:385127
  • name:Blessing of Dawn
  • tooltip:Your next Holy Power spending ability deals {$s1=20}% additional increased damage and healing.
  • description:Your next Holy Power spending ability deals {$s1=20}% additional increased damage and healing. This effect stacks.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blessing of Dusk2.949.578.8s5.7s101.4s98.25%99.16%49.5 (49.5)1.9

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_blessing_of_dusk
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 344.1s
  • trigger_min/max:0.9s / 18.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 357.0s
  • uptime_min/max:94.62% / 99.25%

Stack Uptimes

  • blessing_of_dusk_1:98.25%

Spelldata

  • id:385126
  • name:Blessing of Dusk
  • tooltip:Damage taken reduced by {$=}w1%{$?s385129=false}[, armor increased by {$=}w2%, and Holy Power generating abilities cool down {$=}w3% faster.][.]
  • description:Damage taken reduced by {$s1=4}%{$?s385129=false}&c2[, armor increased by {$s2=10}%, and Holy Power generating abilities cool down {$s3=10}% faster]?s385129[ and your Holy Power generating abilities also grant an absorb shield for {$s9=10}% of damage or healing dealt.][] For {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of the Forge3.00.0120.4s120.4s19.4s19.55%32.65%0.0 (0.0)2.8

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_blessing_of_the_forge
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • blessing_of_the_forge_1:19.55%

Spelldata

  • id:434132
  • name:Blessing of the Forge
  • tooltip:Assisted by a Sacred Weapon.
  • description:{$@spelldesc433011=Avenging Wrath summons an additional Sacred Weapon, and during Avenging Wrath your Sacred Weapon casts spells on your target and echoes the effects of your Holy Power abilities.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.51%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bulwark of Order55.63.95.4s5.0s0.9s16.24%51.65%3.9 (3.9)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_bulwark_of_order
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 19.1s
  • trigger_min/max:0.0s / 19.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.9s
  • uptime_min/max:9.49% / 22.36%

Stack Uptimes

  • bulwark_of_order_1:16.24%

Spelldata

  • id:209389
  • name:Bulwark of Order
  • tooltip:
  • description:Avenger's Shield also shields you for {$209388d=8 seconds}, absorbing {$s1=60}% as much damage as it dealt, up to {$s2=50}% of your maximum health.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Bulwark of Righteous Fury45.613.96.6s5.0s2.7s41.51%53.74%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_bulwark_of_righteous_fury
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 22.7s
  • trigger_min/max:0.0s / 19.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.8s
  • uptime_min/max:30.99% / 53.62%

Stack Uptimes

  • bulwark_of_righteous_fury_1:33.54%
  • bulwark_of_righteous_fury_2:6.65%
  • bulwark_of_righteous_fury_3:0.96%
  • bulwark_of_righteous_fury_4:0.29%
  • bulwark_of_righteous_fury_5:0.07%

Spelldata

  • id:386652
  • name:Bulwark of Righteous Fury
  • tooltip:Increases your next Shield of the Righteous' damage by {$=}w1% and radius by {$s3=6}~ yds.
  • description:{$@spelldesc386653=Avenger's Shield increases the damage of your next Shield of the Righteous by {$386652s1=20}% for each target hit by Avenger's Shield, stacking up to {$386652u=5} times, and increases its radius by {$386652s3=6} yds.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Guidance23.375.713.1s3.0s10.2s79.69%94.64%11.6 (11.6)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_divine_guidance
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 31.2s
  • trigger_min/max:0.0s / 12.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.2s
  • uptime_min/max:69.20% / 87.90%

Stack Uptimes

  • divine_guidance_1:23.25%
  • divine_guidance_2:19.52%
  • divine_guidance_3:14.92%
  • divine_guidance_4:9.93%
  • divine_guidance_5:12.07%

Spelldata

  • id:433106
  • name:Divine Guidance
  • tooltip:
  • description:For each Holy Power ability cast, your next Consecration deals {$=}<value> damage or healing immediately, split across all enemies and allies.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Divine Purpose14.80.018.9s18.8s0.8s3.27%13.06%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 266.2s
  • trigger_min/max:0.0s / 266.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.8s
  • uptime_min/max:0.22% / 8.56%

Stack Uptimes

  • divine_purpose_1:3.27%

Spelldata

  • id:223819
  • name:Divine Purpose
  • tooltip:Your next Holy Power ability is free and deals {$s2=15}% increased damage and healing.
  • description:{$@spelldesc223817=Holy Power spending abilities have a {$s1=15}% chance to make your next Holy Power spending ability free and deal {$223819s2=15}% increased damage and healing.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Resonance5.40.060.5s60.5s14.7s26.57%0.00%10.6 (10.6)5.2

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_divine_resonance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:60.0s / 64.0s
  • trigger_min/max:60.0s / 64.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:24.28% / 29.18%

Stack Uptimes

  • divine_resonance_1:26.57%

Spelldata

  • id:355455
  • name:Divine Resonance
  • tooltip:Casting {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$t1=5} sec for {$s2=15} sec.
  • description:{$@spelldesc355098=After casting Divine Toll, you instantly cast {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$355455t1=5} sec. This effect lasts {$355455s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Egg Sac13.90.0134.8s20.3s237.0s92.56%0.00%0.0 (0.0)0.2

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_egg_sac
  • max_stacks:99
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:839.34

Trigger Details

  • interval_min/max:0.1s / 356.5s
  • trigger_min/max:0.1s / 87.3s
  • trigger_pct:99.99%
  • duration_min/max:0.1s / 358.4s
  • uptime_min/max:71.30% / 99.74%

Stack Uptimes

  • egg_sac_1:19.35%
  • egg_sac_2:27.69%
  • egg_sac_3:22.32%
  • egg_sac_4:13.29%
  • egg_sac_5:6.30%
  • egg_sac_6:2.48%
  • egg_sac_7:0.81%
  • egg_sac_8:0.25%
  • egg_sac_9:0.07%
  • egg_sac_10:0.02%
  • egg_sac_11:0.02%
  • egg_sac_12:0.01%

Spelldata

  • id:452146
  • name:Egg Sac
  • tooltip:Overcome by parental instinct, you gain {$=}w1 {$=}pri to protect your brood.
  • description:{$@spelldesc443541=Your abilities have a chance to stir the sac, releasing an egg which grants you {$s1=744} {$=}pri. Each egg hatches after {$452146d=60 seconds}, and the new brood attacks your next target, inflicting {$=}{{$=}<rolemult>*{$s2=6209}*{$452229d=8 seconds}/{$452229t1=1}} Nature damage over {$452229d=8 seconds}.}
  • max_stacks:99
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Faith in the Light10.14.620.9s14.0s6.3s21.22%22.22%4.6 (4.6)10.1

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_faith_in_the_light
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 159.2s
  • trigger_min/max:0.9s / 159.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.2s
  • uptime_min/max:6.15% / 33.71%

Stack Uptimes

  • faith_in_the_light_1:21.22%

Spelldata

  • id:379041
  • name:Faith in the Light
  • tooltip:Block chance increased by {$=}w1%.
  • description:Casting Word of Glory grants you an additional {$379043s1=5}% block chance for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Crit)2.10.6112.2s76.3s35.4s25.05%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 356.7s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 88.04%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:25.05%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6112.0s77.4s35.1s24.87%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 350.4s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 96.45%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.87%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6111.0s76.4s35.3s25.14%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 346.9s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 77.50%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.14%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.7s76.5s35.5s24.94%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 349.8s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 81.77%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:24.94%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Holy Bulwark5.32.156.6s38.9s24.9s43.88%39.20%61.9 (61.9)4.8

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_holy_bulwark
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:20.0s / 170.1s
  • trigger_min/max:0.3s / 121.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 119.5s
  • uptime_min/max:22.88% / 78.48%

Stack Uptimes

  • holy_bulwark_1:43.88%

Spelldata

  • id:432496
  • name:Holy Bulwark
  • tooltip:Wielding a Holy Bulwark.{$?=}{$=}w3<0[ Duration of Fear effects reduced by {$s3=0}%.][]
  • description:While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Holy Bulwark (_absorb)63.18.54.2s3.7s1.1s23.49%55.92%8.5 (8.5)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_holy_bulwark_absorb
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 101.3s
  • trigger_min/max:0.0s / 101.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.9s
  • uptime_min/max:5.80% / 46.91%

Stack Uptimes

  • holy_bulwark_absorb_1:23.49%

Spelldata

  • id:432607
  • name:Holy Bulwark
  • tooltip:Absorbing the next {$=}w1 damage you take.
  • description:{$@spelldesc432496=While wielding a Holy Bulwark, gain an absorb shield for {$=}{{$s2=150}/10}.1% of your max health and an additional {$=}{{$s4=20}/10}.1% every {$t2=2} sec. Lasts {$d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Inspiring Vanguard10.22.827.7s21.3s9.4s31.74%0.00%2.8 (2.8)9.9

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_inspiring_vanguard
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:2.00%

Trigger Details

  • interval_min/max:8.0s / 223.0s
  • trigger_min/max:0.0s / 215.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.8s
  • uptime_min/max:6.54% / 59.59%

Stack Uptimes

  • inspiring_vanguard_1:31.74%

Spelldata

  • id:393019
  • name:Inspiring Vanguard
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc393020=Grand Crusader's chance to occur is increased to {$s2=20}% and it grants you {$393019s1=2}% strength for {$393019d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Moment of Glory3.70.090.4s90.4s14.7s17.95%18.53%0.0 (0.0)3.5

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_moment_of_glory
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 91.2s
  • trigger_min/max:90.0s / 91.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:15.95% / 20.31%

Stack Uptimes

  • moment_of_glory_1:17.95%

Spelldata

  • id:327193
  • name:Moment of Glory
  • tooltip:Avenger's Shield damage increased by {$s2=20}% and cooldown reduced by {$s1=75}%. Generating an absorb shield for {$s2=20}% of all damage dealt.
  • description:For the next {$d=15 seconds}, you generate an absorb shield for {$s3=25}% of all damage you deal, and Avenger's Shield damage is increased by {$s2=20}% and its cooldown is reduced by {$s1=75}%.
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Moment of Glory (_absorb)35.1243.67.4s0.9s1.4s16.81%84.12%243.6 (243.6)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_moment_of_glory_absorb
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 90.9s
  • trigger_min/max:0.0s / 77.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.6s
  • uptime_min/max:13.29% / 22.15%

Stack Uptimes

  • moment_of_glory_absorb_1:16.81%

Spelldata

  • id:393899
  • name:Moment of Glory
  • tooltip:Absorbs {$=}w1 damage.
  • description:{$@spelldesc327193=For the next {$d=15 seconds}, you generate an absorb shield for {$s3=25}% of all damage you deal, and Avenger's Shield damage is increased by {$s2=20}% and its cooldown is reduced by {$s1=75}%.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Redoubt1.283.0149.0s3.6s242.4s99.65%98.88%80.6 (80.6)0.2

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_redoubt
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.8s / 302.4s
  • trigger_min/max:0.6s / 13.4s
  • trigger_pct:100.00%
  • duration_min/max:5.2s / 359.1s
  • uptime_min/max:98.09% / 99.75%

Stack Uptimes

  • redoubt_1:0.66%
  • redoubt_2:0.66%
  • redoubt_3:98.33%

Spelldata

  • id:280375
  • name:Redoubt
  • tooltip:Strength and Stamina increased by {$=}w1%.
  • description:{$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Sacred Weapon7.83.040.2s29.5s25.1s65.03%68.03%3.0 (3.0)7.2

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_sacred_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:custom
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:8.00
  • modifier:1.00

Stack Uptimes

  • sacred_weapon_1:65.03%

Spelldata

  • id:432502
  • name:Sacred Weapon
  • tooltip:Your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets.{$?=}{$=}w3<0[ Duration of Fear effects reduced by {$s3=0}%.][]
  • description:While wielding a Sacred Weapon, your spells and abilities have a chance to deal {$432616s1=0} additional Holy damage or healing to nearby targets. Effect is increased when Sacred Weapon strikes a single target, and reduced above {$432616s2=5}. Lasts {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Shield of the Righteous1.083.367.6s3.6s298.1s99.69%100.00%83.3 (83.3)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_shield_of_the_righteous
  • max_stacks:1
  • base duration:4.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.7s / 121.6s
  • trigger_min/max:0.6s / 13.4s
  • trigger_pct:100.00%
  • duration_min/max:4.5s / 359.1s
  • uptime_min/max:97.65% / 99.75%

Stack Uptimes

  • shield_of_the_righteous_1:99.69%

Spelldata

  • id:132403
  • name:Shield of the Righteous
  • tooltip:Armor increased by {$?=}c1[{$=}{{$=}W1*{$=}INT/100}][{$=}{{$=}W1*{$=}STR/100}].{$?=}{$=}W3<0[ Damage taken reduced by {$=}w3%.][]
  • description:{$@spelldesc53600=Slams enemies in front of you with your shield, causing {$s1=0} Holy damage, and increasing your Armor by {$?=}c1[{$=}{{$132403s1=160}*{$=}INT/100}][{$=}{{$132403s1=160}*{$=}STR/100}] for {$132403d=4.500 seconds}.{$?a386568=false}[ {$@spelldesc386568=When Shield of the Righteous expires, gain {$386556s1=10}% block chance and deal {$386553s1=0} Holy damage to all attackers for {$386556d=4 seconds}.}][]{$?a280373=true}[ {$@spelldesc280373=Shield of the Righteous increases your Strength and Stamina by $280375s2% for {$280375d=10 seconds}, stacking up to {$280375u=3}.}][] }
  • max_stacks:0
  • duration:4.50
  • cooldown:0.00
  • default_chance:0.00%
Shining Light (_free)7.637.331.7s6.7s34.3s86.98%100.00%28.2 (28.2)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_shining_light_free
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 278.2s
  • trigger_min/max:0.0s / 26.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.5s
  • uptime_min/max:60.44% / 99.45%

Stack Uptimes

  • shining_light_free_1:22.05%
  • shining_light_free_2:64.94%

Spelldata

  • id:327510
  • name:Shining Light
  • tooltip:Your next Word of Glory costs no Holy Power.
  • description:{$@spelldesc321136=Every {$s1=3} Shields of the Righteous make your next Word of Glory cost no Holy Power. Maximum {$327510=}U stacks.}
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Shining Light (_stacks)28.428.110.7s5.3s7.0s66.38%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_shining_light_stacks
  • max_stacks:2
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 28.0s
  • trigger_min/max:0.6s / 19.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.3s
  • uptime_min/max:56.33% / 76.19%

Stack Uptimes

  • shining_light_stacks_1:33.34%
  • shining_light_stacks_2:33.04%

Spelldata

  • id:182104
  • name:Shining Light
  • tooltip:After {$=}{{$321136s1=3}~-{$=}w1} {$?=}{$=}w1<{$=}w2[Shields][Shield] of the Righteous, your next Word of Glory is free.
  • description:{$@spelldesc321136=Every {$s1=3} Shields of the Righteous make your next Word of Glory cost no Holy Power. Maximum {$327510=}U stacks.}
  • max_stacks:4
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Spiderling10.90.120.4s20.1s0.7s2.62%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_spiderling
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 84.9s
  • trigger_min/max:0.5s / 84.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.8s
  • uptime_min/max:0.29% / 7.80%

Stack Uptimes

  • spiderling_1:2.59%
  • spiderling_2:0.02%
  • spiderling_3:0.00%

Spelldata

  • id:452226
  • name:Spiderling
  • tooltip:A new brood is ready to attack!
  • description:Casting a harmful spell or ability launches one of your spiderlings at the enemy inflicting {$443541s2=6209} Nature damage over $12096d.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Storm's Fury5.71.648.2s36.5s13.8s26.28%0.00%1.6 (1.6)5.4

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_storms_fury
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:3325.00

Trigger Details

  • interval_min/max:15.6s / 168.0s
  • trigger_min/max:5.2s / 147.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.6s
  • uptime_min/max:8.23% / 55.20%

Stack Uptimes

  • storms_fury_1:26.28%

Spelldata

  • id:449100
  • name:Storm's Fury
  • tooltip:Filled with the storm's fury, gaining {$=}w1 Haste rating.
  • description:{$@spelldesc445317=|cnNORMAL_FONT_COLOR:Earthen Enhancements - Wondrous Weapons|R Permanently enchants a weapon to sometimes grant you Storm's Fury, bestowing {$=}ec1s1 Haste to you for {$449100d=12 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Tempered Potion1.00.00.0s0.0s30.0s10.14%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s
  • uptime_min/max:8.33% / 12.50%

Stack Uptimes

  • tempered_potion_1:10.14%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devotion Aura

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_devotion_aura
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:465
  • name:Devotion Aura
  • tooltip:Damage taken reduced by {$=}w1%.
  • description:Party and raid members within {$=}a1 yds are bolstered by their devotion, reducing damage taken by {$s1=3}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Nerubian Fortitude

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_nerubian_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:446886
  • name:Nerubian Fortitude
  • tooltip:Maximum health increased by {$=}w1.
  • description:{$@spelldesc444264=Inject an enemy with digestive venom, dealing {$444258s1=261626} Nature damage over 20 sec. While active, your attacks and abilities against the target restore {$444258s2=13627} health. Cannot occur more than every 1 sec. Overhealing from this effect permanently increases your maximum health by the same amount, becoming an absorb shield upon leaving combat.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rite of Sanctification

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_rite_of_sanctification
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:433550
  • name:Rite of Sanctification
  • tooltip:Primary stat increased by {$=}w1%. Armor increased by {$=}w2%.
  • description:{$@spelldesc433568=Imbue your weapon with the power of the Light, increasing your armor by {$433550s2=5}% and your primary stat by {$433550s1=1}%. Lasts {$433550d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Feast of the Divine Day

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_well_fed
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:445.80

Spelldata

  • id:457284
  • name:Well Fed
  • tooltip:Your primary stats have been increased by {$=}w11.
  • description:{$@=}spellicon457049 {$@=}spellname457049 If you spend at least 10 seconds eating you will become {$@=}spellname457049 and gain {$456961s2=123415} primary stat for $457172d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Skyfury (Main Hand)29.810.054.09.8s0.9s150.8s
parry_haste6.70.019.037.6s2.0s316.0s
Divine Purpose14.91.033.019.3s0.0s266.2s
Avenger's Shield: Grand Crusader12.62.025.021.9s1.9s215.6s
Avenger's Shield: Grand Crusader wasted0.40.04.094.5s2.0s318.0s
Divine Inspiration8.42.020.032.6s0.3s154.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Avenger's Shield (_dt)40.3311.75154.970238.203193.132292.785
Avenger's Shield (_dr)12.4120.00051.274208.947174.244252.553
Consecration9.0000.00024.844217.957158.027269.339
Avenging Wrath0.2630.0001.2350.7870.0002.120
Moment of Glory3.1240.00010.93711.41810.00113.479
Divine Toll0.7300.0003.9543.9761.78610.306
Bastion of Light0.2630.0001.2350.7870.0002.120
Eye of Tyr3.1470.00028.15621.2826.93447.880
Shield of the Righteous2.7690.00012.531234.988178.114289.246
Hammer of Wrath7.8410.00096.291175.453133.870213.048
Judgment0.0170.0002.4951.3220.8904.635
Blessed Hammer0.5570.00031.04132.32012.00965.347
Holy Bulwark (Holy Armaments)3.9040.00091.02026.29420.00098.760
Avenger's Shield1.7820.00011.39568.71834.971115.208

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Nêreus
Divine Guidance (_heal)Health22.513,896,300.249.88%173,127.06258,807.636.23%
Blessed HammerHoly Power56.8956.8927.16%1.000.000.00%
Blessed Hammer (_absorb)Health96.711,944,891.564.93%20,110.910.000.00%
Divine TollHoly Power5.435.432.59%1.000.000.00%
Hammer of WrathHoly Power22.3822.3810.68%1.000.000.00%
JudgmentHoly Power79.75124.7759.56%1.565.103.93%
Judgment of LightHealth222.483,794,642.249.62%17,055.984,688.590.12%
LeechHealth255.231,755,061.154.45%6,876.50130,599.366.93%
Sacred Weapon (_proc_heal)Health19.825,508,581.0813.97%277,983.41258,337.334.48%
Sacred WordHealth0.1014,684.430.04%152,362.403,046.6917.18%
Word of GloryHealth14.7422,514,812.0757.10%1,527,629.152,575,854.3410.27%
Usage Type Count Total Tot% Avg RPE APR
Nêreus
Shield of the RighteousHoly Power84.28208.44100.00%2.472.4778,505.09
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Health6,208,640.0710,032.27734,969.6569,704,788.96,208,640.06,208,640.06,208,640.0
Holy Power0.00.700.695.11.00.05.0

Statistics & Data Analysis

Fight Length
Nêreus Fight Length
Count 9999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Nêreus Damage Per Second
Count 9999
Mean 271662.48
Minimum 239056.44
Maximum 312243.04
Spread ( max - min ) 73186.60
Range [ ( max - min ) / 2 * 100% ] 13.47%
Standard Deviation 10585.4130
5th Percentile 255457.23
95th Percentile 289967.01
( 95th Percentile - 5th Percentile ) 34509.78
Mean Distribution
Standard Deviation 105.8594
95.00% Confidence Interval ( 271455.00 - 271869.96 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5833
0.1 Scale Factor Error with Delta=300 956532
0.05 Scale Factor Error with Delta=300 3826127
0.01 Scale Factor Error with Delta=300 95653151
Priority Target DPS
Nêreus Priority Target Damage Per Second
Count 9999
Mean 271662.48
Minimum 239056.44
Maximum 312243.04
Spread ( max - min ) 73186.60
Range [ ( max - min ) / 2 * 100% ] 13.47%
Standard Deviation 10585.4130
5th Percentile 255457.23
95th Percentile 289967.01
( 95th Percentile - 5th Percentile ) 34509.78
Mean Distribution
Standard Deviation 105.8594
95.00% Confidence Interval ( 271455.00 - 271869.96 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5833
0.1 Scale Factor Error with Delta=300 956532
0.05 Scale Factor Error with Delta=300 3826127
0.01 Scale Factor Error with Delta=300 95653151
DPS(e)
Nêreus Damage Per Second (Effective)
Count 9999
Mean 271662.48
Minimum 239056.44
Maximum 312243.04
Spread ( max - min ) 73186.60
Range [ ( max - min ) / 2 * 100% ] 13.47%
Damage
Nêreus Damage
Count 9999
Mean 81301303.90
Minimum 59440081.47
Maximum 106778400.45
Spread ( max - min ) 47338318.98
Range [ ( max - min ) / 2 * 100% ] 29.11%
DTPS
Nêreus Damage Taken Per Second
Count 9999
Mean 734741.80
Minimum 627338.93
Maximum 838584.11
Spread ( max - min ) 211245.18
Range [ ( max - min ) / 2 * 100% ] 14.38%
Standard Deviation 28836.8761
5th Percentile 686297.60
95th Percentile 781169.59
( 95th Percentile - 5th Percentile ) 94871.99
Mean Distribution
Standard Deviation 288.3832
95.00% Confidence Interval ( 734176.58 - 735307.02 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5918
0.1 Scale Factor Error with Delta=300 7098721
0.05 Scale Factor Error with Delta=300 28394884
0.01 Scale Factor Error with Delta=300 709872077
HPS
Nêreus Healing Per Second
Count 9999
Mean 134365.25
Minimum 74696.98
Maximum 211515.32
Spread ( max - min ) 136818.35
Range [ ( max - min ) / 2 * 100% ] 50.91%
Standard Deviation 17319.7941
5th Percentile 106672.76
95th Percentile 163751.39
( 95th Percentile - 5th Percentile ) 57078.63
Mean Distribution
Standard Deviation 173.2066
95.00% Confidence Interval ( 134025.77 - 134704.73 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 639
0.1% Error 63828
0.1 Scale Factor Error with Delta=300 2560762
0.05 Scale Factor Error with Delta=300 10243046
0.01 Scale Factor Error with Delta=300 256076141
HPS(e)
Nêreus Healing Per Second (Effective)
Count 9999
Mean 134365.25
Minimum 74696.98
Maximum 211515.32
Spread ( max - min ) 136818.35
Range [ ( max - min ) / 2 * 100% ] 50.91%
Heal
Nêreus Heal
Count 9999
Mean 40237221.55
Minimum 18484289.97
Maximum 66671611.04
Spread ( max - min ) 48187321.07
Range [ ( max - min ) / 2 * 100% ] 59.88%
HTPS
Nêreus Healing Taken Per Second
Count 9999
Mean 709612.66
Minimum 614603.77
Maximum 803777.11
Spread ( max - min ) 189173.34
Range [ ( max - min ) / 2 * 100% ] 13.33%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 rite_of_sanctification
4 0.00 rite_of_adjuration
5 0.00 snapshot_stats
6 0.00 devotion_aura
7 0.00 lights_judgment
8 0.00 arcane_torrent
9 0.00 consecration
A 0.00 variable,name=trinket_sync_slot,value=1,if=trinket.1.has_cooldown&trinket.1.has_stat.any_dps&(!trinket.2.has_stat.any_dps|trinket.1.cooldown.duration>=trinket.2.cooldown.duration)|!trinket.2.has_cooldown
B 0.00 variable,name=trinket_sync_slot,value=2,if=trinket.2.has_cooldown&trinket.2.has_stat.any_dps&(!trinket.1.has_stat.any_dps|trinket.2.cooldown.duration>trinket.1.cooldown.duration)|!trinket.1.has_cooldown
Default action list Executed every time the actor is available.
# count action,conditions
C 1.00 auto_attack
D 0.00 call_action_list,name=cooldowns
E 0.00 call_action_list,name=trinkets
F 0.00 call_action_list,name=standard
actions.cooldowns
# count action,conditions
0.00 lights_judgment,if=spell_targets.lights_judgment>=2|!raid_event.adds.exists|raid_event.adds.in>75|raid_event.adds.up
G 2.99 avenging_wrath
H 1.00 potion,if=buff.avenging_wrath.up
I 3.66 moment_of_glory,if=(buff.avenging_wrath.remains<15|(time>10))
0.00 divine_toll,if=spell_targets.shield_of_the_righteous>=3
J 2.99 bastion_of_light,if=buff.avenging_wrath.up|cooldown.avenging_wrath.remains<=30
0.00 invoke_external_buff,name=power_infusion,if=buff.avenging_wrath.up
0.00 fireblood,if=buff.avenging_wrath.remains>8
actions.standard
# count action,conditions
K 0.00 call_action_list,name=hammer_of_light,if=talent.lights_guidance.enabled&(cooldown.eye_of_tyr.remains<2|buff.hammer_of_light_ready.up)&(!talent.redoubt.enabled|buff.redoubt.stack>=2|!talent.bastion_of_light.enabled)
0.00 hammer_of_light,if=(!talent.redoubt.enabled|buff.redoubt.stack=3)&(buff.blessing_of_dawn.stack>=1|!talent.of_dusk_and_dawn.enabled)
L 84.28 shield_of_the_righteous,if=(((!talent.righteous_protector.enabled|cooldown.righteous_protector_icd.remains=0)&holy_power>2)|buff.bastion_of_light.up|buff.divine_purpose.up)&!((buff.hammer_of_light_ready.up|buff.hammer_of_light_free.up))
M 3.60 holy_armaments,if=next_armament=sacred_weapon&(!buff.sacred_weapon.up|(buff.sacred_weapon.remains<6&!buff.avenging_wrath.up&cooldown.avenging_wrath.remains<=30))
0.00 judgment,target_if=min:debuff.judgment.remains,if=spell_targets.shield_of_the_righteous>3&buff.bulwark_of_righteous_fury.stack>=3&holy_power<3
0.00 avengers_shield,if=!buff.bulwark_of_righteous_fury.up&talent.bulwark_of_righteous_fury.enabled&spell_targets.shield_of_the_righteous>=3
N 22.38 hammer_of_wrath
O 6.23 judgment,target_if=min:debuff.judgment.remains,if=charges>=2|full_recharge_time<=gcd.max
0.00 holy_armaments,if=next_armament=holy_bulwark&charges=2
P 5.43 divine_toll,if=(!raid_event.adds.exists|raid_event.adds.in>10)
Q 73.52 judgment,target_if=min:debuff.judgment.remains
0.00 blessed_hammer,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3
0.00 hammer_of_the_righteous,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<3
0.00 crusader_strike,if=buff.blessed_assurance.up&spell_targets.shield_of_the_righteous<2
R 38.30 avengers_shield,if=!talent.lights_guidance.enabled
S 20.14 consecration,if=!consecration.up
T 6.67 eye_of_tyr,if=(talent.inmost_light.enabled&raid_event.adds.in>=45|spell_targets.shield_of_the_righteous>=3)&!talent.lights_deliverance.enabled
U 3.13 holy_armaments,if=next_armament=holy_bulwark
V 56.89 blessed_hammer
0.00 hammer_of_the_righteous
0.00 crusader_strike
0.00 word_of_glory,if=buff.shining_light_free.up&talent.lights_guidance.enabled&cooldown.hammerfall_icd.remains=0
0.00 avengers_shield
0.00 eye_of_tyr,if=!talent.lights_deliverance.enabled
W 14.74 word_of_glory,if=buff.shining_light_free.up
0.00 arcane_torrent,if=holy_power<5
X 2.63 consecration
actions.trinkets
# count action,conditions
Y 3.24 use_items,slots=trinket1,if=(variable.trinket_sync_slot=1&(buff.avenging_wrath.up|fight_remains<=40)|(variable.trinket_sync_slot=2&(!trinket.2.cooldown.ready|!buff.avenging_wrath.up))|!variable.trinket_sync_slot)
0.00 use_items,slots=trinket2,if=(variable.trinket_sync_slot=2&(buff.avenging_wrath.up|fight_remains<=40)|(variable.trinket_sync_slot=1&(!trinket.1.cooldown.ready|!buff.avenging_wrath.up))|!variable.trinket_sync_slot)

Sample Sequence

012369ACGHJYNOLPLQLRNQLTVLOLLNIQLRQLSNRQLVRNLQMRQLNRSQLRUQVVLQQRVLLQQRSVLQVVLWQVWQLRSTQVQLRVOPLQRSQVLVQRQLMQRSQVLLVQVLQRVQLSVWLQWLVLTQIRVQLRSVOQLRVWQRVLQRGJYNSPLQLUNQLVLQLLRNQLSVLQLNQLRVOLNQLRSQTVQLLVVVLQRSVOLQRVWQLWVQSVLQMRVOLPQRQLSIRVOOLQRTVQLRSVQRVLQRQVLLVQSVLWLQVRQLWVWQSUVLQRVQLNGJYQLRSPLNQLTQLVLNQLRQLSNLQVLVVNLLQRVLQNSQLVVNLOQRIRNLQRSQNLRMQRNTQLRS

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0flask
[precombat]
Nêreus 6208640.0/6208640 100% HP
0.0/5 0% HoPo
Pre1food
[precombat]
Nêreus 6208640.0/6208640 100% HP
0.0/5 0% HoPo
Pre2augmentation
[precombat]
Nêreus 6208640.0/6208640 100% HP
0.0/5 0% HoPo
Pre3rite_of_sanctification
[precombat]
Nêreus 6208640.0/6208640 100% HP
0.0/5 0% HoPo
Pre6devotion_aura
[precombat]
Fluffy_Pillow 6208640.0/6208640 100% HP
0.0/5 0% HoPo
Pre9consecration
[precombat]
Fluffy_Pillow 6208640.0/6208640 100% HP
0.0/5 0% HoPo
PreAtrinket_sync_slot
[precombat]
Nêreus 6208640.0/6208640 100% HP
0.0/5 0% HoPo
0:00.000Cauto_attack
[default]
Fluffy_Pillow 6208640.0/6208640 100% HP
0.0/5 0% HoPo
0:00.000Gavenging_wrath
[cooldowns]
Fluffy_Pillow 6208640.0/6208640 100% HP
0.0/5 0% HoPo
bloodlust
0:00.000Hpotion
[cooldowns]
Fluffy_Pillow 6208640.0/6208640 100% HP
0.0/5 0% HoPo
bloodlust, avenging_wrath, sacred_weapon, blessing_of_the_forge
0:00.000Jbastion_of_light
[cooldowns]
Nêreus 6208640.0/6208640 100% HP
0.0/5 0% HoPo
bloodlust, avenging_wrath, sacred_weapon, blessing_of_the_forge, tempered_potion
0:00.000Yuse_items
[trinkets]
Fluffy_Pillow 6208640.0/6208640 100% HP
0.0/5 0% HoPo
bloodlust, bastion_of_light(5), avenging_wrath, sacred_weapon, blessing_of_the_forge, tempered_potion
0:00.000Nhammer_of_wrath
[standard]
Fluffy_Pillow 6208640.0/6208640 100% HP
0.0/5 0% HoPo
bloodlust, bastion_of_light(5), avenging_wrath, sacred_weapon, blessing_of_the_forge, tempered_potion
0:00.938Ojudgment
[standard]
Fluffy_Pillow 6208640.0/6289699 99% HP
1.0/5 20% HoPo
bloodlust, bastion_of_light(5), avenging_wrath, sacred_weapon, blessing_of_the_forge, tempered_potion
0:00.938Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6208640.0/6289699 99% HP
5.0/5 100% HoPo
bloodlust, bastion_of_light(4), avenging_wrath, sacred_weapon, blessing_of_the_forge, tempered_potion
0:01.874Pdivine_toll
[standard]
Fluffy_Pillow 6389523.6/6413859 100% HP
2.0/5 40% HoPo
bloodlust, redoubt, shield_of_the_righteous, bastion_of_light(4), shining_light_stacks, avenging_wrath, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac, tempered_potion
0:01.874Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6389523.6/6413859 100% HP
3.0/5 60% HoPo
bloodlust, redoubt, shield_of_the_righteous, bastion_of_light(4), shining_light_stacks, avenging_wrath, divine_resonance, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac, tempered_potion
0:02.810Qjudgment
[standard]
Fluffy_Pillow 6538039.3/6538039 100% HP
0.0/5 0% HoPo
bloodlust, bulwark_of_order, redoubt(2), shield_of_the_righteous, bastion_of_light(4), bulwark_of_righteous_fury, shining_light_stacks(2), avenging_wrath, divine_resonance, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac, tempered_potion
0:02.810Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6538039.3/6538039 100% HP
4.0/5 80% HoPo
bloodlust, bulwark_of_order, redoubt(2), shield_of_the_righteous, bastion_of_light(3), bulwark_of_righteous_fury, shining_light_stacks(2), avenging_wrath, blessing_of_dawn, divine_resonance, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac, tempered_potion
0:03.747Ravengers_shield
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
1.0/5 20% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bastion_of_light(3), shining_light_free, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(3), blessing_of_the_forge, egg_sac, tempered_potion
0:04.681Nhammer_of_wrath
[standard]
Fluffy_Pillow 1670181.5/6662219 25% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bastion_of_light(3), bulwark_of_righteous_fury, shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(3), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:05.581Qjudgment
[standard]
Fluffy_Pillow 5701904.2/6662219 86% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bastion_of_light(3), bulwark_of_righteous_fury, shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(3), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:05.581Lshield_of_the_righteous
[standard]
Fluffy_Pillow 5701904.2/6662219 86% HP
5.0/5 100% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bastion_of_light(2), bulwark_of_righteous_fury, shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(3), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:06.479Teye_of_tyr
[standard]
Fluffy_Pillow 3180409.4/6662219 48% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bastion_of_light(2), shining_light_stacks, shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(4), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:07.377Vblessed_hammer
[standard]
Fluffy_Pillow 2776885.5/6662219 42% HP
2.0/5 40% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bastion_of_light(2), bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(4), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:07.377Lshield_of_the_righteous
[standard]
Fluffy_Pillow 2776885.5/6662219 42% HP
3.0/5 60% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bastion_of_light(2), bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(4), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:08.277Ojudgment
[standard]
Fluffy_Pillow 1740269.4/6662219 26% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bastion_of_light(2), shining_light_stacks(2), shining_light_free, inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:08.277Lshield_of_the_righteous
[standard]
Fluffy_Pillow 1740269.4/6662219 26% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bastion_of_light, shining_light_stacks(2), shining_light_free, inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:08.873Lshield_of_the_righteous
[standard]
Fluffy_Pillow 1757496.5/6662219 26% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bastion_of_light, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, divine_purpose, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:09.175Nhammer_of_wrath
[standard]
Fluffy_Pillow 1263754.6/6662219 19% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bastion_of_light, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:10.073Imoment_of_glory
[cooldowns]
Fluffy_Pillow 3877975.1/6662219 58% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bastion_of_light, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:10.073Qjudgment
[standard]
Fluffy_Pillow 3877975.1/6662219 58% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, bastion_of_light, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:10.073Lshield_of_the_righteous
[standard]
Fluffy_Pillow 3877975.1/6662219 58% HP
5.0/5 100% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:10.970Ravengers_shield
[standard]
Fluffy_Pillow 3899265.5/6662219 59% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:11.869Qjudgment
[standard]
Fluffy_Pillow 3551242.0/6662219 53% HP
2.0/5 40% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:11.869Lshield_of_the_righteous
[standard]
Fluffy_Pillow 3551242.0/6662219 53% HP
4.0/5 80% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:12.767Sconsecration
[standard]
Fluffy_Pillow 2535127.9/6662219 38% HP
1.0/5 20% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:13.665Nhammer_of_wrath
[standard]
Fluffy_Pillow 3005080.9/6662219 45% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:14.563Ravengers_shield
[standard]
Fluffy_Pillow 1436303.8/6662219 22% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, blessing_of_the_forge, egg_sac, storms_fury, tempered_potion
0:15.462Qjudgment
[standard]
Fluffy_Pillow 5287822.4/6662219 79% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, blessing_of_the_forge, egg_sac, storms_fury, flask_of_alchemical_chaos_crit, tempered_potion
0:15.462Lshield_of_the_righteous
[standard]
Fluffy_Pillow 5287822.4/6662219 79% HP
4.0/5 80% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, sacred_weapon, blessing_of_the_forge, egg_sac, storms_fury, flask_of_alchemical_chaos_crit, tempered_potion
0:16.362Vblessed_hammer
[standard]
Fluffy_Pillow 3813027.7/6662219 57% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac, storms_fury, flask_of_alchemical_chaos_crit, tempered_potion
0:17.260Ravengers_shield
[standard]
Fluffy_Pillow 3268996.4/6662219 49% HP
2.0/5 40% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:18.197Nhammer_of_wrath
[standard]
Fluffy_Pillow 2168738.6/6662219 33% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:18.200Lshield_of_the_righteous
[standard]
Fluffy_Pillow 2168738.6/6662219 33% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:19.137Qjudgment
[standard]
Fluffy_Pillow 1845739.3/6662219 28% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:20.073Mholy_armaments
[standard]
Fluffy_Pillow 3514752.9/6662219 53% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_stacks(2), shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:21.008Ravengers_shield
[standard]
Fluffy_Pillow 2969938.3/6662219 45% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:21.943Qjudgment
[standard]
Fluffy_Pillow 3565985.4/6662219 54% HP
2.0/5 40% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:21.943Lshield_of_the_righteous
[standard]
Fluffy_Pillow 3565985.4/6662219 54% HP
4.0/5 80% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:22.880Nhammer_of_wrath
[standard]
Fluffy_Pillow 2225189.2/6662219 33% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance(3), egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:23.817Ravengers_shield
[standard]
Fluffy_Pillow 2098077.4/6662219 31% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance(3), egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:24.754Sconsecration
[standard]
Fluffy_Pillow -144971.9/6662219 -2% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance(3), egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:25.691Qjudgment
[standard]
Fluffy_Pillow 3518014.6/6662219 53% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dusk, sacred_weapon, egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:25.691Lshield_of_the_righteous
[standard]
Fluffy_Pillow 3518014.6/6662219 53% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:26.627Ravengers_shield
[standard]
Fluffy_Pillow 898734.2/6662219 13% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:27.564Uholy_armaments
[standard]
Fluffy_Pillow 410196.1/6662219 6% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:28.499Qjudgment
[standard]
Fluffy_Pillow -1006634.6/6662219 -15% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance, egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:29.436Vblessed_hammer
[standard]
Fluffy_Pillow -1589811.0/6662219 -24% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance, egg_sac, flask_of_alchemical_chaos_crit, tempered_potion
0:30.374Vblessed_hammer
[standard]
Fluffy_Pillow -74831.9/6662219 -1% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance, egg_sac, flask_of_alchemical_chaos_crit
0:30.374Lshield_of_the_righteous
[standard]
Fluffy_Pillow -74831.9/6662219 -1% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance, egg_sac, flask_of_alchemical_chaos_crit
0:31.343Qjudgment
[standard]
Fluffy_Pillow -671915.7/6662219 -10% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_crit
0:32.313Qjudgment
[standard]
Fluffy_Pillow -655163.4/6662219 -10% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_crit
0:33.432Ravengers_shield
[standard]
Fluffy_Pillow -1103083.4/6662219 -17% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_crit
0:34.402Vblessed_hammer
[standard]
Fluffy_Pillow -1085463.0/6662219 -16% HP
2.0/5 40% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_crit
0:34.402Lshield_of_the_righteous
[standard]
Fluffy_Pillow -1085463.0/6662219 -16% HP
3.0/5 60% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_crit
0:35.045Lshield_of_the_righteous
[standard]
Fluffy_Pillow 2545503.3/6662219 38% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_free(2), inspiring_vanguard, barricade_of_faith, divine_purpose, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(3), egg_sac(2), flask_of_alchemical_chaos_crit
0:35.370Qjudgment
[standard]
Fluffy_Pillow 2558778.4/6662219 38% HP
0.0/5 0% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(4), egg_sac(2), flask_of_alchemical_chaos_crit
0:36.340Qjudgment
[standard]
Fluffy_Pillow 2565187.6/6662219 39% HP
1.0/5 20% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(4), egg_sac(2), flask_of_alchemical_chaos_crit
0:37.511Ravengers_shield
[standard]
Fluffy_Pillow 2051618.4/6662219 31% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(4), egg_sac(3), flask_of_alchemical_chaos_crit
0:38.479Sconsecration
[standard]
Fluffy_Pillow 2082464.2/6662219 31% HP
2.0/5 40% HoPo
bloodlust, bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(4), egg_sac(3), flask_of_alchemical_chaos_crit
0:39.449Vblessed_hammer
[standard]
Fluffy_Pillow 2088998.4/6662219 31% HP
2.0/5 40% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, egg_sac(3), flask_of_alchemical_chaos_crit
0:39.449Lshield_of_the_righteous
[standard]
Fluffy_Pillow 2088998.4/6662219 31% HP
3.0/5 60% HoPo
bloodlust, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, sacred_weapon, egg_sac(3), flask_of_alchemical_chaos_crit
0:40.419Qjudgment
[standard]
Fluffy_Pillow 6337470.5/6662219 95% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
0:41.678Vblessed_hammer
[standard]
Fluffy_Pillow 5882443.0/6662219 88% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
0:42.938Vblessed_hammer
[standard]
Fluffy_Pillow 6149424.0/6662219 92% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
0:42.938Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6149424.0/6662219 92% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
0:44.197Wword_of_glory
[standard]
Nêreus 5697860.9/6662219 86% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_crit
0:45.455Qjudgment
[standard]
Fluffy_Pillow 6434907.1/6662219 97% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_crit
0:46.715Vblessed_hammer
[standard]
Fluffy_Pillow 6439229.4/6662219 97% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_crit
0:47.974Wword_of_glory
[standard]
Nêreus 5999395.7/6662219 90% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, blessing_of_dusk, holy_bulwark_absorb, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_crit
0:49.235Qjudgment
[standard]
Fluffy_Pillow 6181624.4/6662219 93% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, blessing_of_dusk, divine_guidance(4), egg_sac(3), flask_of_alchemical_chaos_crit
0:49.309Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6181624.4/6662219 93% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, blessing_of_dawn, blessing_of_dusk, divine_guidance(4), egg_sac(3), flask_of_alchemical_chaos_crit
0:50.567Ravengers_shield
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, blessing_of_dusk, divine_guidance(5), egg_sac(3), flask_of_alchemical_chaos_crit
0:51.825Sconsecration
[standard]
Fluffy_Pillow 6084690.4/6662219 91% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, blessing_of_dusk, divine_guidance(5), egg_sac(3), flask_of_alchemical_chaos_crit
0:53.085Teye_of_tyr
[standard]
Fluffy_Pillow 5663369.8/6662219 85% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_crit
0:54.346Qjudgment
[standard]
Fluffy_Pillow 5710267.5/6662219 86% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_crit
0:55.606Vblessed_hammer
[standard]
Fluffy_Pillow 6209040.1/6662219 93% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, barricade_of_faith, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_crit
0:56.865Qjudgment
[standard]
Fluffy_Pillow 6224111.8/6662219 93% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_crit
0:56.865Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6224111.8/6662219 93% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_crit
0:58.124Ravengers_shield
[standard]
Fluffy_Pillow 5794899.9/6662219 87% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_crit
0:59.385Vblessed_hammer
[standard]
Fluffy_Pillow 5459112.6/6662219 82% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_crit
1:00.646Ojudgment
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_crit
1:01.906Pdivine_toll
[standard]
Fluffy_Pillow 6079787.5/6662219 91% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_guidance, spiderling, egg_sac(3), flask_of_alchemical_chaos_crit
1:01.906Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6079787.5/6662219 91% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_resonance, divine_guidance, spiderling, egg_sac(3), flask_of_alchemical_chaos_crit
1:03.164Qjudgment
[standard]
Fluffy_Pillow -1076967.3/6662219 -16% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_resonance, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_crit
1:04.422Ravengers_shield
[standard]
Fluffy_Pillow -1059581.8/6662219 -16% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_resonance, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_crit
1:05.683Sconsecration
[standard]
Fluffy_Pillow 2353232.2/6662219 35% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_resonance, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_crit
1:06.943Qjudgment
[standard]
Fluffy_Pillow 571281.2/6662219 9% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, divine_resonance, egg_sac(3), flask_of_alchemical_chaos_crit
1:08.202Vblessed_hammer
[standard]
Fluffy_Pillow -2734483.7/6662219 -41% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(3), shining_light_free(2), barricade_of_faith, blessing_of_dawn, divine_resonance, egg_sac(3), flask_of_alchemical_chaos_crit
1:08.202Lshield_of_the_righteous
[standard]
Fluffy_Pillow -2734483.7/6662219 -41% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(3), shining_light_free(2), barricade_of_faith, blessing_of_dawn, divine_resonance, egg_sac(3), flask_of_alchemical_chaos_crit
1:09.461Vblessed_hammer
[standard]
Fluffy_Pillow -2729876.5/6662219 -41% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, divine_resonance, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
1:10.720Qjudgment
[standard]
Fluffy_Pillow -1119088.7/6662219 -17% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_resonance, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
1:11.979Ravengers_shield
[standard]
Fluffy_Pillow -1093922.1/6662219 -16% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_resonance, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
1:13.237Qjudgment
[standard]
Fluffy_Pillow -3539474.7/6662219 -53% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_resonance, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
1:13.237Lshield_of_the_righteous
[standard]
Fluffy_Pillow -3539474.7/6662219 -53% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_resonance, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
1:14.496Mholy_armaments
[standard]
Fluffy_Pillow -3966662.3/6662219 -60% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_resonance, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_crit
1:15.756Qjudgment
[standard]
Fluffy_Pillow 286380.1/6662219 4% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:17.012Ravengers_shield
[standard]
Fluffy_Pillow -2086973.3/6662219 -31% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:18.266Sconsecration
[standard]
Fluffy_Pillow -4486224.5/6662219 -67% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:19.520Qjudgment
[standard]
Fluffy_Pillow -4324227.1/6662219 -65% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, egg_sac(3), flask_of_alchemical_chaos_vers
1:20.774Vblessed_hammer
[standard]
Fluffy_Pillow -2643489.9/6662219 -40% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, egg_sac(3), flask_of_alchemical_chaos_vers
1:20.774Lshield_of_the_righteous
[standard]
Fluffy_Pillow -2643489.9/6662219 -40% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, egg_sac(3), flask_of_alchemical_chaos_vers
1:21.607Lshield_of_the_righteous
[standard]
Fluffy_Pillow -2638658.4/6662219 -40% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), inspiring_vanguard, barricade_of_faith, divine_purpose, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_vers
1:22.029Vblessed_hammer
[standard]
Fluffy_Pillow -4978980.4/6662219 -75% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:23.284Qjudgment
[standard]
Fluffy_Pillow -4948008.8/6662219 -74% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:24.547Vblessed_hammer
[standard]
Fluffy_Pillow -8052416.5/6662219 -121% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:24.547Lshield_of_the_righteous
[standard]
Fluffy_Pillow -8052416.5/6662219 -121% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_vers
1:25.801Qjudgment
[standard]
Fluffy_Pillow -4033398.6/6662219 -61% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_vers
1:27.055Ravengers_shield
[standard]
Fluffy_Pillow -5226421.8/6662219 -78% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_vers
1:28.309Vblessed_hammer
[standard]
Fluffy_Pillow -7697104.9/6662219 -116% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_vers
1:29.562Qjudgment
[standard]
Fluffy_Pillow -7696523.1/6662219 -116% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_vers
1:29.562Lshield_of_the_righteous
[standard]
Fluffy_Pillow -7696523.1/6662219 -116% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_vers
1:30.817Sconsecration
[standard]
Fluffy_Pillow -6754580.6/6662219 -101% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(4), egg_sac(3), flask_of_alchemical_chaos_vers
1:32.072Vblessed_hammer
[standard]
Fluffy_Pillow -7043523.0/6662219 -106% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, egg_sac(3), flask_of_alchemical_chaos_vers
1:33.326Wword_of_glory
[standard]
Nêreus -7014390.9/6662219 -105% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, egg_sac(3), flask_of_alchemical_chaos_vers
1:33.326Lshield_of_the_righteous
[standard]
Fluffy_Pillow -4028840.6/6662219 -60% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, faith_in_the_light, barricade_of_faith, divine_purpose, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_vers
1:34.581Qjudgment
[standard]
Fluffy_Pillow -4462341.2/6662219 -67% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), faith_in_the_light, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(2), spiderling, egg_sac(2), flask_of_alchemical_chaos_vers
1:35.835Wword_of_glory
[standard]
Nêreus -444382.8/6662219 -7% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), faith_in_the_light, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(2), egg_sac(2), flask_of_alchemical_chaos_vers
1:35.835Lshield_of_the_righteous
[standard]
Fluffy_Pillow 1813860.2/6662219 27% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, divine_purpose, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(3), egg_sac(2), flask_of_alchemical_chaos_vers
1:37.089Vblessed_hammer
[standard]
Fluffy_Pillow 1363837.6/6662219 20% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(4), spiderling, egg_sac, flask_of_alchemical_chaos_vers
1:37.089Lshield_of_the_righteous
[standard]
Fluffy_Pillow 1377185.2/6662219 21% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(4), egg_sac, flask_of_alchemical_chaos_vers
1:38.343Teye_of_tyr
[standard]
Fluffy_Pillow 939304.9/6662219 14% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, blessing_of_dusk, holy_bulwark, divine_guidance(5), egg_sac, flask_of_alchemical_chaos_vers
1:39.598Qjudgment
[standard]
Fluffy_Pillow 960708.3/6662219 14% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(5), egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:40.801Imoment_of_glory
[cooldowns]
Fluffy_Pillow 4676846.3/6662219 70% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(5), egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:40.801Ravengers_shield
[standard]
Fluffy_Pillow 4676846.3/6662219 70% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_free(2), faith_in_the_light, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(5), egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:42.003Vblessed_hammer
[standard]
Fluffy_Pillow 4683019.7/6662219 70% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(5), egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:43.204Qjudgment
[standard]
Fluffy_Pillow 4560006.7/6662219 68% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(5), egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:43.204Lshield_of_the_righteous
[standard]
Fluffy_Pillow 4560006.7/6662219 68% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(5), egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:44.408Ravengers_shield
[standard]
Fluffy_Pillow 4382678.7/6662219 66% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark, divine_guidance(5), egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:45.610Sconsecration
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, holy_bulwark_absorb, divine_guidance(5), egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:46.811Vblessed_hammer
[standard]
Fluffy_Pillow 6444572.4/6662219 97% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:48.012Ojudgment
[standard]
Fluffy_Pillow 6459372.4/6662219 97% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:49.212Qjudgment
[standard]
Fluffy_Pillow 5894088.1/6662219 88% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:49.212Lshield_of_the_righteous
[standard]
Fluffy_Pillow 5894088.1/6662219 88% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:50.415Ravengers_shield
[standard]
Fluffy_Pillow 6208391.0/6662219 93% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_guidance, egg_sac, storms_fury, flask_of_alchemical_chaos_vers
1:51.615Vblessed_hammer
[standard]
Fluffy_Pillow 6217736.6/6662219 93% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_guidance, egg_sac, flask_of_alchemical_chaos_vers
1:52.869Wword_of_glory
[standard]
Nêreus 5986438.7/6662219 90% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance, egg_sac, flask_of_alchemical_chaos_vers
1:54.123Qjudgment
[standard]
Fluffy_Pillow 6244876.7/6662219 94% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, inspiring_vanguard, faith_in_the_light, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_vers
1:55.378Ravengers_shield
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, faith_in_the_light, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_vers
1:56.633Vblessed_hammer
[standard]
Fluffy_Pillow 6286486.6/6662219 94% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free, faith_in_the_light, barricade_of_faith, blessing_of_dusk, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_vers
1:56.633Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6299834.3/6662219 95% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free, faith_in_the_light, barricade_of_faith, blessing_of_dusk, divine_guidance(2), egg_sac, flask_of_alchemical_chaos_vers
1:57.886Qjudgment
[standard]
Fluffy_Pillow 6303298.0/6662219 95% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, divine_guidance(3), spiderling, flask_of_alchemical_chaos_vers
1:59.141Ravengers_shield
[standard]
Fluffy_Pillow 5674449.8/6662219 85% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance(3), flask_of_alchemical_chaos_vers
2:00.397Gavenging_wrath
[cooldowns]
Fluffy_Pillow 6090322.5/6662219 91% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance(3), flask_of_alchemical_chaos_vers
2:00.397Jbastion_of_light
[cooldowns]
Nêreus 6116558.0/6662219 92% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(3), blessing_of_the_forge, flask_of_alchemical_chaos_vers
2:00.397Yuse_items
[trinkets]
Fluffy_Pillow 6116558.0/6662219 92% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(5), bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(3), blessing_of_the_forge, flask_of_alchemical_chaos_vers
2:00.397Nhammer_of_wrath
[standard]
Fluffy_Pillow 6116558.0/6662219 92% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(5), bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(3), blessing_of_the_forge, flask_of_alchemical_chaos_vers
2:01.652Sconsecration
[standard]
Fluffy_Pillow 6138281.5/6662219 92% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(5), bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(3), blessing_of_the_forge, flask_of_alchemical_chaos_vers
2:02.906Pdivine_toll
[standard]
Fluffy_Pillow -647441.9/6662219 -10% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(5), bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, sacred_weapon, blessing_of_the_forge, flask_of_alchemical_chaos_vers
2:02.906Lshield_of_the_righteous
[standard]
Fluffy_Pillow -631700.5/6662219 -9% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(5), bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, divine_resonance, sacred_weapon, blessing_of_the_forge, flask_of_alchemical_chaos_vers
2:04.162Qjudgment
[standard]
Fluffy_Pillow -3728126.1/6662219 -56% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(5), bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance, blessing_of_the_forge, flask_of_alchemical_chaos_vers
2:04.162Lshield_of_the_righteous
[standard]
Fluffy_Pillow -3728126.1/6662219 -56% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(4), bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance, blessing_of_the_forge, flask_of_alchemical_chaos_vers
2:05.417Uholy_armaments
[standard]
Fluffy_Pillow 298815.6/6662219 4% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(4), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac, flask_of_alchemical_chaos_vers
2:06.671Nhammer_of_wrath
[standard]
Fluffy_Pillow -933245.0/6662219 -14% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(4), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac, flask_of_alchemical_chaos_vers
2:07.925Qjudgment
[standard]
Fluffy_Pillow -906501.4/6662219 -14% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(4), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac, flask_of_alchemical_chaos_vers
2:07.925Lshield_of_the_righteous
[standard]
Fluffy_Pillow -906501.4/6662219 -14% HP
5.0/5 100% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(3), shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac, flask_of_alchemical_chaos_vers
2:09.180Vblessed_hammer
[standard]
Fluffy_Pillow -3785889.8/6662219 -57% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(3), bulwark_of_righteous_fury, shining_light_free(2), avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(3), blessing_of_the_forge, egg_sac, flask_of_alchemical_chaos_vers
2:09.180Lshield_of_the_righteous
[standard]
Fluffy_Pillow -3785889.8/6662219 -57% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(3), bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(3), blessing_of_the_forge, egg_sac, flask_of_alchemical_chaos_vers
2:10.434Qjudgment
[standard]
Fluffy_Pillow -2226923.6/6662219 -33% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(3), shining_light_stacks, shining_light_free(2), inspiring_vanguard, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(4), blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_vers
2:10.434Lshield_of_the_righteous
[standard]
Fluffy_Pillow -2226923.6/6662219 -33% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(2), shining_light_stacks, shining_light_free(2), inspiring_vanguard, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(4), blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_vers
2:11.267Lshield_of_the_righteous
[standard]
Fluffy_Pillow -2805554.5/6662219 -42% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(2), shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, avenging_wrath, divine_purpose, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_vers
2:11.688Ravengers_shield
[standard]
Fluffy_Pillow -2772419.8/6662219 -42% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(2), shining_light_free(2), inspiring_vanguard, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_vers
2:12.943Nhammer_of_wrath
[standard]
Fluffy_Pillow -4891561.9/6662219 -73% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(2), bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_vers
2:14.198Qjudgment
[standard]
Fluffy_Pillow -8059497.7/6662219 -121% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(2), bulwark_of_righteous_fury(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_vers
2:14.198Lshield_of_the_righteous
[standard]
Fluffy_Pillow -8059497.7/6662219 -121% HP
5.0/5 100% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light, bulwark_of_righteous_fury(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_vers
2:15.452Sconsecration
[standard]
Fluffy_Pillow -4713198.8/6662219 -71% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
2:16.706Vblessed_hammer
[standard]
Fluffy_Pillow -4206136.3/6662219 -63% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessing_of_the_forge, egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:16.706Lshield_of_the_righteous
[standard]
Fluffy_Pillow -4172328.6/6662219 -63% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessing_of_the_forge, egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:17.907Qjudgment
[standard]
Fluffy_Pillow -4031466.5/6662219 -61% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:17.907Lshield_of_the_righteous
[standard]
Fluffy_Pillow -4031466.5/6662219 -61% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:19.109Nhammer_of_wrath
[standard]
Fluffy_Pillow -4380480.6/6662219 -66% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:20.312Qjudgment
[standard]
Fluffy_Pillow -1957801.9/6662219 -29% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:20.312Lshield_of_the_righteous
[standard]
Fluffy_Pillow -1957801.9/6662219 -29% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:21.516Ravengers_shield
[standard]
Fluffy_Pillow -2544696.0/6662219 -38% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:22.718Vblessed_hammer
[standard]
Fluffy_Pillow -4004987.2/6662219 -60% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(3), egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:23.921Ojudgment
[standard]
Fluffy_Pillow -4593299.9/6662219 -69% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:23.921Lshield_of_the_righteous
[standard]
Fluffy_Pillow -4593299.9/6662219 -69% HP
4.0/5 80% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:25.121Nhammer_of_wrath
[standard]
Fluffy_Pillow -2565581.4/6662219 -39% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(4), egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:26.322Qjudgment
[standard]
Fluffy_Pillow -4969522.2/6662219 -75% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(4), egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:26.322Lshield_of_the_righteous
[standard]
Fluffy_Pillow -4969522.2/6662219 -75% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(4), egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:27.523Ravengers_shield
[standard]
Fluffy_Pillow -5644904.4/6662219 -85% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_guidance(5), egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery
2:28.725Sconsecration
[standard]
Fluffy_Pillow -8385468.6/6662219 -126% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_guidance(5), egg_sac(3), flask_of_alchemical_chaos_mastery
2:29.979Qjudgment
[standard]
Fluffy_Pillow -8784647.9/6662219 -132% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_mastery
2:31.236Teye_of_tyr
[standard]
Fluffy_Pillow -7172626.7/6662219 -108% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_mastery
2:32.491Vblessed_hammer
[standard]
Fluffy_Pillow -7160395.1/6662219 -107% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_mastery
2:33.745Qjudgment
[standard]
Fluffy_Pillow -7560231.6/6662219 -113% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_mastery
2:33.923Lshield_of_the_righteous
[standard]
Fluffy_Pillow -7560231.6/6662219 -113% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_mastery
2:34.756Lshield_of_the_righteous
[standard]
Fluffy_Pillow -7553450.2/6662219 -113% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, divine_purpose, blessing_of_dusk, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_mastery
2:35.177Vblessed_hammer
[standard]
Fluffy_Pillow -3982091.7/6662219 -60% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_mastery
2:36.432Vblessed_hammer
[standard]
Fluffy_Pillow -3949792.0/6662219 -59% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_mastery
2:37.686Vblessed_hammer
[standard]
Fluffy_Pillow -4377446.1/6662219 -66% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dawn, blessing_of_dusk, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_mastery
2:37.686Lshield_of_the_righteous
[standard]
Fluffy_Pillow -4377446.1/6662219 -66% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dawn, blessing_of_dusk, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_mastery
2:38.940Qjudgment
[standard]
Fluffy_Pillow -4346007.1/6662219 -65% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_mastery
2:40.195Ravengers_shield
[standard]
Fluffy_Pillow -924795.6/6662219 -14% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), blessing_of_dusk, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_mastery
2:41.449Sconsecration
[standard]
Fluffy_Pillow -1407889.8/6662219 -21% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dusk, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_mastery
2:42.703Vblessed_hammer
[standard]
Fluffy_Pillow -1273689.8/6662219 -19% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_mastery
2:43.957Ojudgment
[standard]
Fluffy_Pillow -1841213.5/6662219 -28% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_mastery
2:43.957Lshield_of_the_righteous
[standard]
Fluffy_Pillow -1841213.5/6662219 -28% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_mastery
2:45.212Qjudgment
[standard]
Fluffy_Pillow 1550864.5/6662219 23% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
2:46.465Ravengers_shield
[standard]
Fluffy_Pillow 1582256.7/6662219 24% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
2:47.720Vblessed_hammer
[standard]
Fluffy_Pillow 1067901.4/6662219 16% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
2:48.975Wword_of_glory
[standard]
Nêreus 1095347.5/6662219 16% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
2:50.230Qjudgment
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, inspiring_vanguard, faith_in_the_light, barricade_of_faith, blessing_of_dusk, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_crit
2:50.230Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, inspiring_vanguard, faith_in_the_light, barricade_of_faith, blessing_of_dusk, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_crit
2:51.483Wword_of_glory
[standard]
Nêreus 6067258.4/6662219 91% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, barricade_of_faith, blessing_of_dusk, divine_guidance(3), egg_sac(3), flask_of_alchemical_chaos_crit
2:52.738Vblessed_hammer
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), faith_in_the_light, barricade_of_faith, blessing_of_dusk, divine_guidance(4), egg_sac(3), flask_of_alchemical_chaos_crit
2:53.993Qjudgment
[standard]
Fluffy_Pillow 6053690.4/6662219 91% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), faith_in_the_light, barricade_of_faith, blessing_of_dusk, divine_guidance(4), egg_sac(3), flask_of_alchemical_chaos_crit
2:55.248Sconsecration
[standard]
Fluffy_Pillow 5979282.3/6662219 90% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), faith_in_the_light, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance(4), egg_sac(3), flask_of_alchemical_chaos_crit
2:56.501 Waiting0.822s 6134106.6/6662219 92% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), blessing_of_dawn, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_crit
2:57.323Vblessed_hammer
[standard]
Fluffy_Pillow 5538918.0/6662219 83% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), blessing_of_dawn, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_crit
2:57.497Lshield_of_the_righteous
[standard]
Fluffy_Pillow 5538918.0/6662219 83% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), blessing_of_dawn, blessing_of_dusk, egg_sac(3), flask_of_alchemical_chaos_crit
2:58.752Qjudgment
[standard]
Fluffy_Pillow 5555407.0/6662219 83% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, blessing_of_dusk, divine_guidance, egg_sac(3), storms_fury, flask_of_alchemical_chaos_crit
2:59.954Mholy_armaments
[standard]
Fluffy_Pillow 4950967.8/6662219 74% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, blessing_of_dusk, divine_guidance, egg_sac(3), storms_fury, flask_of_alchemical_chaos_crit
3:01.155Ravengers_shield
[standard]
Fluffy_Pillow 6060103.9/6662219 91% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(4), storms_fury, flask_of_alchemical_chaos_crit
3:02.353Vblessed_hammer
[standard]
Fluffy_Pillow 1558640.0/6662219 23% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free, barricade_of_faith, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(4), storms_fury, flask_of_alchemical_chaos_crit
3:03.554Ojudgment
[standard]
Fluffy_Pillow 1217785.8/6662219 18% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(4), storms_fury, flask_of_alchemical_chaos_crit
3:03.554Lshield_of_the_righteous
[standard]
Fluffy_Pillow 1217785.8/6662219 18% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(4), storms_fury, flask_of_alchemical_chaos_crit
3:04.754Pdivine_toll
[standard]
Fluffy_Pillow -571598.7/6662219 -9% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dusk, sacred_weapon, divine_guidance(2), spiderling, egg_sac(3), storms_fury, flask_of_alchemical_chaos_crit
3:05.956Qjudgment
[standard]
Fluffy_Pillow 3176730.0/6662219 48% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(2), egg_sac(4), storms_fury, flask_of_alchemical_chaos_crit
3:07.156Ravengers_shield
[standard]
Fluffy_Pillow -148016.8/6662219 -2% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(2), egg_sac(4), storms_fury, flask_of_alchemical_chaos_crit
3:08.358Qjudgment
[standard]
Fluffy_Pillow -1999696.8/6662219 -30% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(2), egg_sac(4), storms_fury, flask_of_alchemical_chaos_crit
3:08.576Lshield_of_the_righteous
[standard]
Fluffy_Pillow -1999696.8/6662219 -30% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(2), egg_sac(4), storms_fury, flask_of_alchemical_chaos_crit
3:09.778Sconsecration
[standard]
Fluffy_Pillow -1979430.3/6662219 -30% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, inspiring_vanguard, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance(3), egg_sac(4), storms_fury, flask_of_alchemical_chaos_crit
3:10.979Imoment_of_glory
[cooldowns]
Fluffy_Pillow -166050.9/6662219 -2% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, spiderling, egg_sac(3), storms_fury, flask_of_alchemical_chaos_crit
3:10.979Ravengers_shield
[standard]
Fluffy_Pillow -152818.0/6662219 -2% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, spiderling, egg_sac(3), storms_fury, flask_of_alchemical_chaos_crit
3:12.181Vblessed_hammer
[standard]
Fluffy_Pillow -2442186.9/6662219 -37% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, egg_sac(3), storms_fury, flask_of_alchemical_chaos_crit
3:13.382Ojudgment
[standard]
Fluffy_Pillow -2440314.0/6662219 -37% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free, inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, egg_sac(3), storms_fury, flask_of_alchemical_chaos_crit
3:14.583Ojudgment
[standard]
Fluffy_Pillow -2945195.2/6662219 -44% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free, inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, spiderling, egg_sac(2), storms_fury, flask_of_alchemical_chaos_crit
3:14.583Lshield_of_the_righteous
[standard]
Fluffy_Pillow -2945195.2/6662219 -44% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free, inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_resonance, sacred_weapon, egg_sac(2), storms_fury, flask_of_alchemical_chaos_crit
3:15.784Qjudgment
[standard]
Fluffy_Pillow 1062799.8/6662219 16% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
3:17.044Ravengers_shield
[standard]
Fluffy_Pillow -1003772.3/6662219 -15% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
3:18.303Teye_of_tyr
[standard]
Fluffy_Pillow -2111106.7/6662219 -32% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
3:19.561Vblessed_hammer
[standard]
Fluffy_Pillow -2088281.5/6662219 -31% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
3:20.819Qjudgment
[standard]
Fluffy_Pillow 516868.4/6662219 8% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(3), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, holy_bulwark, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
3:20.819Lshield_of_the_righteous
[standard]
Fluffy_Pillow 516868.4/6662219 8% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(3), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_crit
3:22.079Ravengers_shield
[standard]
Fluffy_Pillow -1248514.9/6662219 -19% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, holy_bulwark, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_crit
3:23.341Sconsecration
[standard]
Fluffy_Pillow -1241850.0/6662219 -19% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_crit
3:24.600Vblessed_hammer
[standard]
Fluffy_Pillow -3105908.5/6662219 -47% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, holy_bulwark, egg_sac(3), flask_of_alchemical_chaos_crit
3:25.859Qjudgment
[standard]
Fluffy_Pillow 921928.9/6662219 14% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, egg_sac(4), flask_of_alchemical_chaos_crit
3:27.118Ravengers_shield
[standard]
Fluffy_Pillow -1298026.6/6662219 -19% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, egg_sac(4), flask_of_alchemical_chaos_crit
3:28.378Vblessed_hammer
[standard]
Fluffy_Pillow -4312836.0/6662219 -65% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, egg_sac(4), flask_of_alchemical_chaos_crit
3:28.378Lshield_of_the_righteous
[standard]
Fluffy_Pillow -4312836.0/6662219 -65% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, sacred_weapon, egg_sac(4), flask_of_alchemical_chaos_crit
3:29.639Qjudgment
[standard]
Fluffy_Pillow -4308755.4/6662219 -65% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_crit
3:30.897Ravengers_shield
[standard]
Fluffy_Pillow -2359783.5/6662219 -35% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_crit
3:32.156Qjudgment
[standard]
Fluffy_Pillow -2730662.3/6662219 -41% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_crit
3:33.415Vblessed_hammer
[standard]
Fluffy_Pillow -2701887.5/6662219 -41% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_crit
3:33.415Lshield_of_the_righteous
[standard]
Fluffy_Pillow -2701887.5/6662219 -41% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_crit
3:34.251Lshield_of_the_righteous
[standard]
Fluffy_Pillow -3162366.7/6662219 -47% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), inspiring_vanguard, barricade_of_faith, divine_purpose, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(2), egg_sac(4), flask_of_alchemical_chaos_crit
3:34.675Vblessed_hammer
[standard]
Fluffy_Pillow -3148636.4/6662219 -47% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, sacred_weapon, divine_guidance(3), egg_sac(4), flask_of_alchemical_chaos_crit
3:35.936Qjudgment
[standard]
Fluffy_Pillow 882832.4/6662219 13% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(4), flask_of_alchemical_chaos_crit
3:37.195Sconsecration
[standard]
Fluffy_Pillow 375166.1/6662219 6% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(4), flask_of_alchemical_chaos_crit
3:38.455Vblessed_hammer
[standard]
Fluffy_Pillow 29358.5/6662219 0% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, sacred_weapon, egg_sac(4), flask_of_alchemical_chaos_crit
3:38.455Lshield_of_the_righteous
[standard]
Fluffy_Pillow 42860.2/6662219 1% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, egg_sac(4), flask_of_alchemical_chaos_crit
3:39.714Wword_of_glory
[standard]
Nêreus 58928.1/6662219 1% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_crit
3:39.714Lshield_of_the_righteous
[standard]
Fluffy_Pillow 2289633.4/6662219 34% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free, faith_in_the_light, barricade_of_faith, divine_purpose, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac(4), flask_of_alchemical_chaos_crit
3:40.973Qjudgment
[standard]
Fluffy_Pillow 5704274.2/6662219 86% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, blessing_of_dusk, sacred_weapon, divine_guidance(3), egg_sac(4), flask_of_alchemical_chaos_crit
3:42.233Vblessed_hammer
[standard]
Fluffy_Pillow 5118912.8/6662219 77% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, blessing_of_dusk, sacred_weapon, divine_guidance(3), egg_sac(4), flask_of_alchemical_chaos_crit
3:43.490Ravengers_shield
[standard]
Fluffy_Pillow 5123085.1/6662219 77% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), faith_in_the_light, blessing_of_dusk, sacred_weapon, divine_guidance(3), egg_sac(4), flask_of_alchemical_chaos_crit
3:44.751Qjudgment
[standard]
Fluffy_Pillow 5394050.3/6662219 81% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(4), flask_of_alchemical_chaos_crit
3:44.980Lshield_of_the_righteous
[standard]
Fluffy_Pillow 5398804.9/6662219 81% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), egg_sac(4), flask_of_alchemical_chaos_mastery
3:46.236Wword_of_glory
[standard]
Nêreus 6662219.3/6662219 100% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(4), egg_sac(4), flask_of_alchemical_chaos_mastery
3:47.489Vblessed_hammer
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), faith_in_the_light, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(5), egg_sac(4), flask_of_alchemical_chaos_mastery
3:48.743Wword_of_glory
[standard]
Nêreus 6367387.7/6662219 96% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), faith_in_the_light, barricade_of_faith, blessing_of_dusk, holy_bulwark, divine_guidance(5), egg_sac(4), flask_of_alchemical_chaos_mastery
3:49.997Qjudgment
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(5), egg_sac(4), flask_of_alchemical_chaos_mastery
3:51.252Sconsecration
[standard]
Fluffy_Pillow 6131658.2/6662219 92% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, blessing_of_dusk, holy_bulwark, divine_guidance(5), egg_sac(4), flask_of_alchemical_chaos_mastery
3:52.507Uholy_armaments
[standard]
Fluffy_Pillow 5872655.4/6662219 88% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free, faith_in_the_light, barricade_of_faith, blessing_of_dusk, holy_bulwark, egg_sac(4), flask_of_alchemical_chaos_mastery
3:53.763Vblessed_hammer
[standard]
Fluffy_Pillow 5886967.4/6662219 88% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, egg_sac(4), flask_of_alchemical_chaos_mastery
3:53.763Lshield_of_the_righteous
[standard]
Fluffy_Pillow 5901051.0/6662219 89% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, egg_sac(4), flask_of_alchemical_chaos_mastery
3:55.018Qjudgment
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_mastery
3:56.272Ravengers_shield
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_mastery
3:57.526Vblessed_hammer
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_mastery
3:58.780Qjudgment
[standard]
Fluffy_Pillow 6376313.2/6662219 96% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_mastery
3:58.780Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6376313.2/6662219 96% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance, egg_sac(4), flask_of_alchemical_chaos_mastery
4:00.034Nhammer_of_wrath
[standard]
Fluffy_Pillow 6662219.3/6662219 100% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(2), spiderling, egg_sac(3), flask_of_alchemical_chaos_mastery
4:01.290Gavenging_wrath
[cooldowns]
Fluffy_Pillow 6225206.3/6662219 93% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_mastery
4:01.290Jbastion_of_light
[cooldowns]
Nêreus 6225206.3/6662219 93% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:01.290Yuse_items
[trinkets]
Fluffy_Pillow 6225206.3/6662219 93% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(5), shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:01.290Qjudgment
[standard]
Fluffy_Pillow 6225206.3/6662219 93% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(5), shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:01.290Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6225206.3/6662219 93% HP
5.0/5 100% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(4), shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:02.544Ravengers_shield
[standard]
Fluffy_Pillow 1319486.7/6662219 20% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(4), shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:03.797Sconsecration
[standard]
Fluffy_Pillow 1362915.8/6662219 20% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bastion_of_light(4), bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(3), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:05.051Pdivine_toll
[standard]
Fluffy_Pillow 2582090.5/6662219 39% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(4), bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessing_of_the_forge, spiderling, egg_sac(2), flask_of_alchemical_chaos_mastery
4:05.051Lshield_of_the_righteous
[standard]
Fluffy_Pillow 2582090.5/6662219 39% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(4), bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, blessing_of_the_forge, spiderling, egg_sac(2), flask_of_alchemical_chaos_mastery
4:06.307Nhammer_of_wrath
[standard]
Fluffy_Pillow 44153.5/6662219 1% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(4), bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_mastery
4:07.561Qjudgment
[standard]
Fluffy_Pillow 58842.8/6662219 1% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(4), bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:07.561Lshield_of_the_righteous
[standard]
Fluffy_Pillow 75466.2/6662219 1% HP
5.0/5 100% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(3), bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:08.816Teye_of_tyr
[standard]
Fluffy_Pillow -2986602.6/6662219 -45% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(3), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:10.071Qjudgment
[standard]
Fluffy_Pillow -804462.1/6662219 -12% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(3), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:10.071Lshield_of_the_righteous
[standard]
Fluffy_Pillow -804462.1/6662219 -12% HP
5.0/5 100% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(2), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:11.324Vblessed_hammer
[standard]
Fluffy_Pillow -941087.8/6662219 -14% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(2), bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(3), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:11.324Lshield_of_the_righteous
[standard]
Fluffy_Pillow -941087.8/6662219 -14% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(2), bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(3), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:12.579Nhammer_of_wrath
[standard]
Fluffy_Pillow -2856144.7/6662219 -43% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(2), shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, holy_bulwark_absorb, sacred_weapon, divine_guidance(4), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:13.833Qjudgment
[standard]
Fluffy_Pillow -3121456.4/6662219 -47% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light(2), shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(4), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:13.833Lshield_of_the_righteous
[standard]
Fluffy_Pillow -3121456.4/6662219 -47% HP
5.0/5 100% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(4), blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_mastery
4:15.088Ravengers_shield
[standard]
Fluffy_Pillow -897025.8/6662219 -13% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light, shining_light_free(2), inspiring_vanguard, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_haste
4:16.287Qjudgment
[standard]
Fluffy_Pillow -3372513.0/6662219 -51% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bastion_of_light, bulwark_of_righteous_fury(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_haste
4:16.287Lshield_of_the_righteous
[standard]
Fluffy_Pillow -3372513.0/6662219 -51% HP
5.0/5 100% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_haste
4:17.486Sconsecration
[standard]
Fluffy_Pillow -3895382.3/6662219 -58% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark, sacred_weapon, divine_guidance(5), blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_haste
4:18.684Nhammer_of_wrath
[standard]
Fluffy_Pillow -5267293.2/6662219 -79% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark_absorb, sacred_weapon, blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_haste
4:18.684Lshield_of_the_righteous
[standard]
Fluffy_Pillow -5267293.2/6662219 -79% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, holy_bulwark_absorb, sacred_weapon, blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_haste
4:19.882Qjudgment
[standard]
Fluffy_Pillow -5687060.4/6662219 -85% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, divine_resonance, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac(2), flask_of_alchemical_chaos_haste
4:21.194Vblessed_hammer
[standard]
Fluffy_Pillow -4041625.5/6662219 -61% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_haste
4:21.194Lshield_of_the_righteous
[standard]
Fluffy_Pillow -4009752.5/6662219 -60% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance, blessing_of_the_forge, egg_sac(3), flask_of_alchemical_chaos_haste
4:22.393Vblessed_hammer
[standard]
Fluffy_Pillow -6383571.1/6662219 -96% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac(3), storms_fury, flask_of_alchemical_chaos_haste
4:23.546Vblessed_hammer
[standard]
Fluffy_Pillow -6983923.3/6662219 -105% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac(3), storms_fury, flask_of_alchemical_chaos_haste
4:24.697Nhammer_of_wrath
[standard]
Fluffy_Pillow -9613495.6/6662219 -144% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance(2), spiderling, egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:24.697Lshield_of_the_righteous
[standard]
Fluffy_Pillow -9613495.6/6662219 -144% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, avenging_wrath, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:25.461Lshield_of_the_righteous
[standard]
Fluffy_Pillow -6207778.0/6662219 -93% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), avenging_wrath, divine_purpose, blessing_of_dusk, sacred_weapon, divine_guidance(3), egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:25.848Qjudgment
[standard]
Fluffy_Pillow -6192107.5/6662219 -93% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), avenging_wrath, blessing_of_dusk, sacred_weapon, divine_guidance(4), egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:27.000Ravengers_shield
[standard]
Fluffy_Pillow -8038452.9/6662219 -121% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), blessing_of_dusk, sacred_weapon, divine_guidance(4), egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:28.151Vblessed_hammer
[standard]
Fluffy_Pillow -8636158.7/6662219 -130% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, sacred_weapon, divine_guidance(4), egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:28.151Lshield_of_the_righteous
[standard]
Fluffy_Pillow -8623100.0/6662219 -129% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, sacred_weapon, divine_guidance(4), egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:29.301Qjudgment
[standard]
Fluffy_Pillow -9141282.5/6662219 -137% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dusk, divine_guidance(5), egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:30.453Nhammer_of_wrath
[standard]
Fluffy_Pillow -8078060.9/6662219 -121% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance(5), egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:31.603Sconsecration
[standard]
Fluffy_Pillow -8736474.6/6662219 -131% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance(5), egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:32.754Qjudgment
[standard]
Fluffy_Pillow -8534287.7/6662219 -128% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:32.754Lshield_of_the_righteous
[standard]
Fluffy_Pillow -8534287.7/6662219 -128% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:33.905Vblessed_hammer
[standard]
Fluffy_Pillow -9127333.5/6662219 -137% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dusk, divine_guidance, egg_sac(2), storms_fury, flask_of_alchemical_chaos_haste
4:35.056Vblessed_hammer
[standard]
Fluffy_Pillow -5113650.4/6662219 -77% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance, egg_sac(2), flask_of_alchemical_chaos_haste
4:36.255Nhammer_of_wrath
[standard]
Fluffy_Pillow -5706645.9/6662219 -86% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance, egg_sac(2), flask_of_alchemical_chaos_haste
4:36.277Lshield_of_the_righteous
[standard]
Fluffy_Pillow -5706645.9/6662219 -86% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks, shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance, egg_sac(2), flask_of_alchemical_chaos_haste
4:37.475Ojudgment
[standard]
Fluffy_Pillow -6305764.1/6662219 -95% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, blessing_of_dusk, divine_guidance(2), egg_sac(2), flask_of_alchemical_chaos_haste
4:38.673Qjudgment
[standard]
Fluffy_Pillow -6274468.3/6662219 -94% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, blessing_of_dawn, blessing_of_dusk, divine_guidance(2), egg_sac(2), flask_of_alchemical_chaos_haste
4:39.870Ravengers_shield
[standard]
Fluffy_Pillow -6877474.9/6662219 -103% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, blessing_of_dawn, blessing_of_dusk, divine_guidance(2), egg_sac(2), flask_of_alchemical_chaos_haste
4:41.069Imoment_of_glory
[cooldowns]
Fluffy_Pillow -3373241.9/6662219 -51% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance(2), egg_sac(2), flask_of_alchemical_chaos_haste
4:41.069Ravengers_shield
[standard]
Fluffy_Pillow -3373241.9/6662219 -51% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance(2), egg_sac(2), flask_of_alchemical_chaos_haste
4:42.270Nhammer_of_wrath
[standard]
Fluffy_Pillow -3368369.6/6662219 -51% HP
2.0/5 40% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance(2), egg_sac(2), flask_of_alchemical_chaos_haste
4:42.270Lshield_of_the_righteous
[standard]
Fluffy_Pillow -3368369.6/6662219 -51% HP
3.0/5 60% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_stacks(2), shining_light_free(2), inspiring_vanguard, moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance(2), egg_sac(2), flask_of_alchemical_chaos_haste
4:43.468Qjudgment
[standard]
Fluffy_Pillow -3720062.3/6662219 -56% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_guidance(3), egg_sac(2), flask_of_alchemical_chaos_haste
4:44.666Ravengers_shield
[standard]
Fluffy_Pillow -3716025.8/6662219 -56% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance(3), egg_sac(2), flask_of_alchemical_chaos_haste
4:45.865Sconsecration
[standard]
Fluffy_Pillow -191460.5/6662219 -3% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, divine_guidance(3), egg_sac(2), flask_of_alchemical_chaos_mastery
4:47.125Qjudgment
[standard]
Fluffy_Pillow -605962.6/6662219 -9% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac(2), flask_of_alchemical_chaos_mastery
4:48.527Nhammer_of_wrath
[standard]
Fluffy_Pillow -577841.9/6662219 -9% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac(2), flask_of_alchemical_chaos_mastery
4:48.527Lshield_of_the_righteous
[standard]
Fluffy_Pillow -577841.9/6662219 -9% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, egg_sac(2), flask_of_alchemical_chaos_mastery
4:49.785Ravengers_shield
[standard]
Fluffy_Pillow -916208.1/6662219 -14% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_guidance, egg_sac(2), flask_of_alchemical_chaos_mastery
4:51.044Mholy_armaments
[standard]
Fluffy_Pillow 3116143.5/6662219 47% HP
0.0/5 0% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, divine_guidance, egg_sac(2), flask_of_alchemical_chaos_mastery
4:52.302Qjudgment
[standard]
Fluffy_Pillow 3158738.3/6662219 47% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_mastery
4:53.562Ravengers_shield
[standard]
Fluffy_Pillow 2734230.0/6662219 41% HP
1.0/5 20% HoPo
redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury, shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_mastery
4:54.821Nhammer_of_wrath
[standard]
Fluffy_Pillow 2743922.6/6662219 41% HP
1.0/5 20% HoPo
bulwark_of_order, redoubt(3), shield_of_the_righteous, moment_of_glory, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_mastery
4:56.080Teye_of_tyr
[standard]
Fluffy_Pillow 6442511.4/6662219 97% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), moment_of_glory_absorb, barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_mastery
4:57.340Qjudgment
[standard]
Fluffy_Pillow 6204935.5/6662219 93% HP
2.0/5 40% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_mastery
4:57.340Lshield_of_the_righteous
[standard]
Fluffy_Pillow 6218788.3/6662219 93% HP
3.0/5 60% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury(2), shining_light_stacks, shining_light_free(2), barricade_of_faith, blessing_of_dawn, blessing_of_dusk, sacred_weapon, divine_guidance, egg_sac(3), flask_of_alchemical_chaos_mastery
4:58.600Ravengers_shield
[standard]
Fluffy_Pillow 6242093.9/6662219 94% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac(3), flask_of_alchemical_chaos_mastery
4:59.861Sconsecration
[standard]
Fluffy_Pillow 5822114.3/6662219 87% HP
0.0/5 0% HoPo
redoubt(3), shield_of_the_righteous, bulwark_of_righteous_fury, shining_light_stacks(2), shining_light_free(2), barricade_of_faith, blessing_of_dusk, sacred_weapon, divine_guidance(2), egg_sac(3), storms_fury, flask_of_alchemical_chaos_mastery

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength176470403763879921152 (18274)
Agility61760617661760
Stamina864520310432295649110451
Intellect17647018176176470
Spirit00000
Health620864059129800
Holy Power550
Spell Power18176550150
Crit12.08%12.50%2451
Haste25.54%19.96%10131
Versatility13.10%10.48%8172
Mitigation Versatility6.55%5.24%8172
Attack Power49744447500
Mastery17.34%15.34%5136
Armor912338688963293
Run Speed70337
Leech1.95%1.95%1990
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry12.46%12.54%2451
Tank-Block44.69%43.15%0
Tank-Crit-6.00%-6.00%0

Gear

Source Slot Average Item Level: 584.00
Local Head Visor of the Ascended Captain
ilevel: 600, stats: { 5,880 Armor, +14,000 Sta, +1,112 Haste, +555 Vers, +2,638 StrInt }
Local Neck Gem-Studded Pendant of the Harmonious (gemstudded_pendant)
ilevel: 587, stats: { +6,448 Sta, +1,794 Mastery, +2,130 Vers }, gems: { +205 Sta, +49 Haste }
Local Shoulders Swarm Monarch's Spaulders
ilevel: 587, stats: { 5,036 Armor, +8,598 Sta, +680 Vers, +481 Mastery, +1,753 StrInt }
Local Shirt Artisan Member's Shirt
ilevel: 1
Local Chest Sedimentary Breastplate of the Feverflare (sedimentary_breastplate)
ilevel: 587, stats: { 7,325 Armor, +11,463 Sta, +2,337 StrInt, +1,105 Haste, +442 Mastery }, enchant: { +440 Str, +225 Sta (oathsworns_strength_2) }
Local Waist Stalwart Girdle of the Feverflare (stalwart_girdle)
ilevel: 567, stats: { 3,738 Armor, +6,536 Sta, +1,455 StrInt, +371 Haste, +668 Mastery }
Local Legs Sedimentary Legguards of the Aurora (sedimentary_legguards)
ilevel: 587, stats: { 6,410 Armor, +11,463 Sta, +2,337 StrInt, +884 Haste, +663 Vers }
Local Feet Sedimentary Sabatons of the Aurora (sedimentary_sabatons)
ilevel: 580, stats: { 4,421 Armor, +7,675 Sta, +1,642 StrInt, +397 Haste, +715 Vers }
Local Wrists Bracers of Umbral Mending
ilevel: 584, stats: { 3,608 Armor, +6,140 Sta, +428 Haste, +427 Mastery, +1,279 StrInt }, enchant: { +1,325 Leech (whisper_of_armored_leech_3) }
Local Hands Sedimentary Gauntlets of the Feverflare (sedimentary_gauntlets)
ilevel: 584, stats: { 4,059 Armor, +8,186 Sta, +1,705 StrInt, +651 Haste, +489 Mastery }
Local Finger1 Experiment 08752's Band
ilevel: 584, stats: { +6,140 Sta, +1,573 Haste, +2,224 Vers }
Local Finger2 Gem-Studded Ring of the Fireflash (gemstudded_ring)
ilevel: 587, stats: { +6,448 Sta, +2,130 Crit, +1,794 Haste }, enchant: { +190 Mastery (glimmering_mastery_3) }
Local Trinket1 Foul Behemoth's Chelicera
ilevel: 584, stats: { +2,161 StrAgi }
item effects: { equip: Foul Behemoth's Chelicera, use: Digestive Venom }
Local Trinket2 Ara-Kara Sacbrood
ilevel: 584, stats: { +1,086 Haste }
item effects: { equip: Ara-Kara Sacbrood }
Local Back Cape of the Favored
ilevel: 554, stats: { 1,020 Armor, +4,620 Sta, +273 Crit, +482 Haste, +967 StrAgiInt }, enchant: { +665 Leech (whisper_of_silken_leech_3) }
Local Main Hand Cutting-Edge Sermon
ilevel: 593, weapon: { 2,739 - 4,567, 2.6 }, stats: { +1,236 Str, +6,292 Sta, +486 Vers, +315 Mastery }, enchant: stormriders_fury_2
Local Off Hand Husk of Swallowing Darkness
ilevel: 590, stats: { 21,796 Armor, +1,202 Str, +3,687 Int, +6,012 Sta, +559 Vers, +229 Mastery, +337 RunSpeed }
Local Tabard Tabard of the Lightbringer
ilevel: 32
item effects: { use: }

Profile

paladin="Nêreus"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/n%C3%AAreus"
spec=protection
level=80
race=human
role=tank
position=front
talents=CIEAE74QAafj6bdTrgpLZS4VlvxMjxyMWMzMzM22MzMmZxYMDAAAAAAAAAAaLmZmxMzgZYGbwYGAwYAAYwMAAAQAmZW2WaZmxiZA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=feast_of_the_divine_day
augmentation=crystallized
temporary_enchant=main_hand:algari_mana_oil_3,if=!(talent.rite_of_adjuration.enabled|talent.rite_of_sanctification.enabled)

head=visor_of_the_ascended_captain,id=212427,bonus_id=6652/10877/10376/10354/10272/1501/10255
neck=gemstudded_pendant,id=224665,bonus_id=10280/6652/10394/10878/3406/1659/10255,gems=205sta_49haste
shoulders=swarm_monarchs_spaulders,id=221155,bonus_id=10388/6652/10375/12045/10292/1622/10255
back=cape_of_the_favored,id=225549,bonus_id=11128/11054,enchant=whisper_of_silken_leech_3,drop_level=80
chest=sedimentary_breastplate,id=224690,bonus_id=10280/6652/1697/1659/10255/10377,enchant=oathsworns_strength_2
shirt=artisan_members_shirt,id=89193
tabard=tabard_of_the_lightbringer,id=52252
wrists=bracers_of_umbral_mending,id=133306,bonus_id=10388/6652/10877/10375/12045/10293/10014/10255,enchant=whisper_of_armored_leech_3
hands=sedimentary_gauntlets,id=224692,bonus_id=6652/1699/10293/1656/10255
waist=stalwart_girdle,id=224622,bonus_id=6652/10876/1702/10844/10286/1494
legs=sedimentary_legguards,id=224694,bonus_id=10280/6652/1706/1659/10255/10377
feet=sedimentary_sabatons,id=224691,bonus_id=6652/1709/10282/1652/10254
finger1=experiment_08752s_band,id=221189,bonus_id=10388/6652/10394/10392/12045/10293/1619/10255
finger2=gemstudded_ring,id=224662,bonus_id=6652/10394/10393/1759/10292/1659/10255,enchant=glimmering_mastery_3
trinket1=foul_behemoths_chelicera,id=219915,bonus_id=6652/10353/10281/1485/10255
trinket2=arakara_sacbrood,id=219314,bonus_id=10388/6652/12045/10293/1619/10255
main_hand=cuttingedge_sermon,id=221091,bonus_id=10278/10388/6652/10384/1628/10255,enchant=stormriders_fury_2
off_hand=husk_of_swallowing_darkness,id=212386,bonus_id=42/10353/10279/1491/10255

# Gear Summary
# gear_ilvl=583.69
# gear_strength=21152
# gear_stamina=110451
# gear_crit_rating=2403
# gear_haste_rating=9932
# gear_mastery_rating=5035
# gear_versatility_rating=8012
# gear_leech_rating=1990
# gear_speed_rating=337
# gear_armor=63293

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 81107938
Max Event Queue: 125
Sim Seconds: 3007022
CPU Seconds: 67.0339
Physical Seconds: 84.3848
Speed Up: 44858

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Nêreus Nêreus augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Nêreus Nêreus avengers_shield 31935 7969066 26562 7.66 170608 366623 38.3 38.3 19.2% 0.0% 0.0% 0.0% 7.77sec 7969066 300.01sec
Nêreus Nêreus tyrs_enforceravengers_shield 378286 788665 2629 7.66 16946 35970 38.3 38.3 19.2% 0.0% 0.0% 0.0% 7.77sec 788665 300.01sec
Nêreus Nêreus avenging_wrath 31884 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.41sec 0 300.01sec
Nêreus Nêreus bastion_of_light 378974 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.41sec 0 300.01sec
Nêreus Nêreus blessed_hammer 204019 0 0 0.00 0 0 56.9 0.0 0.0% 0.0% 0.0% 0.0% 5.15sec 0 300.01sec
Nêreus Nêreus blessed_hammer_tick ticks -204301 2722770 9076 0.00 20194 42159 0.0 0.0 17.4% 0.0% 0.0% 0.0% 0.00sec 2722770 300.01sec
Nêreus Nêreus blessed_hammer_absorb 0 1944902 6483 19.34 20111 0 0.0 96.7 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Nêreus Nêreus bulwark_of_order_absorb 0 7585847 25285 11.09 136784 0 0.0 55.5 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Nêreus Nêreus consecration 26573 0 0 0.00 0 0 23.8 0.0 0.0% 0.0% 0.0% 0.0% 12.93sec 0 300.01sec
Nêreus Nêreus consecration_tick ticks -81297 2212746 7376 0.00 5237 11050 0.0 0.0 18.8% 0.0% 0.0% 0.0% 0.00sec 2212746 300.01sec
Nêreus Nêreus divine_guidance 433808 4325430 14418 4.50 156176 355497 22.5 22.5 18.1% 0.0% 0.0% 0.0% 13.09sec 4325430 300.01sec
Nêreus Nêreus devotion_aura 465 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Nêreus Nêreus digestive_venom ticks -444264 3227092 10757 6.29 77337 155489 3.2 31.5 32.3% 0.0% 0.0% 0.0% 108.73sec 3227092 300.01sec
Nêreus Nêreus divine_guidance_heal 433807 3896443 12988 4.50 139662 324111 22.5 22.5 18.1% 0.0% 0.0% 0.0% 13.09sec 4155130 300.01sec
Nêreus Nêreus divine_toll 375576 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.48sec 0 300.01sec
Nêreus Nêreus avengers_shield_dt 31935 1153408 3845 1.09 165834 349023 5.4 5.4 25.4% 0.0% 0.0% 0.0% 60.48sec 1153408 300.01sec
Nêreus Nêreus tyrs_enforceravengers_shield_dt 378286 123346 411 1.09 17756 37364 5.4 5.4 25.3% 0.0% 0.0% 0.0% 60.47sec 123346 300.01sec
Nêreus Nêreus avengers_shield_dr 31935 3549103 11830 3.16 175284 371844 15.8 15.8 25.2% 0.0% 0.0% 0.0% 18.30sec 3549103 300.01sec
Nêreus Nêreus tyrs_enforceravengers_shield_dr 378286 360157 1200 3.16 17810 37703 15.8 15.8 25.1% 0.0% 0.0% 0.0% 18.30sec 360157 300.01sec
Nêreus Nêreus eye_of_tyr 387174 2214708 7382 1.33 271928 577191 6.7 6.7 19.6% 0.0% 0.0% 0.0% 47.48sec 2214708 300.01sec
Nêreus Nêreus flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Nêreus Nêreus food 457283 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Nêreus Nêreus hammer_of_wrath 24275 6140332 20467 4.47 210345 441864 22.4 22.4 27.7% 0.0% 0.0% 0.0% 14.33sec 6140332 300.01sec
Nêreus Nêreus holy_armaments 432459 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 42.59sec 0 300.01sec
Nêreus Nêreus holy_bulwark 0 0 0 0.00 0 0 7.3 0.0 0.0% 0.0% 0.0% 0.0% 38.66sec 0 300.01sec
Nêreus Nêreus holy_bulwark_absorb 0 16825185 56082 14.29 235626 0 0.0 71.4 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Nêreus Nêreus holy_shield 157122 667688 2226 8.82 12086 25649 44.1 44.1 22.5% 0.0% 0.0% 0.0% 6.68sec 667688 300.01sec
Nêreus Nêreus judgment 275779 16467506 54889 15.94 169808 359140 79.8 79.7 19.4% 0.0% 0.0% 0.0% 3.76sec 16467506 300.01sec
Nêreus Nêreus hammer_and_anvil 433717 3242133 10807 3.10 164743 349361 15.5 15.5 24.2% 0.0% 0.0% 0.0% 18.79sec 3242133 300.01sec
Nêreus Nêreus judgment_of_light 183811 3794723 12649 44.50 14123 29627 222.5 222.5 18.9% 0.0% 0.0% 0.0% 1.35sec 3799409 300.01sec
Nêreus Nêreus leech 143924 1755189 5850 51.04 6876 0 255.2 255.2 0.0% 0.0% 0.0% 0.0% 1.17sec 1885869 300.01sec
Nêreus Nêreus light_of_the_titans 378405 0 0 2.95 0 0 14.7 14.7 13.8% 0.0% 0.0% 0.0% 14.02sec 0 300.01sec
Nêreus Nêreus light_of_the_titans_hot 378412 0 0 2.95 0 0 14.7 14.7 13.7% 0.0% 0.0% 0.0% 14.02sec 0 300.01sec
Nêreus Nêreus melee 0 5600075 18666 35.76 25800 54521 178.8 178.8 19.2% 0.0% 0.0% 0.0% 2.01sec 8000099 300.01sec
Nêreus Nêreus moment_of_glory 327193 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.37sec 0 300.01sec
Nêreus Nêreus moment_of_glory_absorb 0 5071284 16904 7.22 140396 0 0.0 36.1 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Nêreus Nêreus potion 431932 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Nêreus Nêreus rite_of_sanctification 433568 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
Nêreus Nêreus sacred_weapon 0 0 0 0.00 0 0 10.8 0.0 0.0% 0.0% 0.0% 0.0% 29.51sec 0 300.01sec
Nêreus Nêreus sacred_weapon_proc_damage 432616 3351638 11172 4.02 131546 279672 20.1 20.1 23.6% 0.0% 0.0% 0.0% 14.19sec 3351638 300.01sec
Nêreus Nêreus sacred_weapon_proc_heal 441590 5507355 18357 3.96 230321 479064 19.8 19.8 19.2% 0.0% 0.0% 0.0% 14.07sec 5765638 300.01sec
Nêreus Nêreus shield_of_the_righteous 53600 10126864 33755 16.86 98110 194666 84.3 84.3 22.8% 0.0% 0.0% 0.0% 3.57sec 10126864 300.01sec
Nêreus Nêreus forges_reckoning 447258 6237018 20789 6.28 146992 294366 31.4 31.4 35.1% 0.0% 0.0% 0.0% 8.39sec 6237018 300.01sec
Nêreus Nêreus spiderfling 452227 0 0 0.00 0 0 11.0 0.0 0.0% 0.0% 0.0% 0.0% 20.42sec 0 300.01sec
Nêreus Nêreus spidersting ticks -452229 821557 2739 19.32 7216 14515 11.0 96.6 17.7% 0.0% 0.0% 0.0% 20.42sec 821557 300.01sec
Nêreus Nêreus tasty_juices 446805 2756603 9188 10.99 37818 75527 54.9 54.9 32.4% 0.0% 0.0% 0.0% 5.17sec 2810147 300.01sec
Nêreus Nêreus word_of_glory 85673 22512285 75038 2.95 1362868 2547823 14.7 14.7 13.9% 0.0% 0.0% 0.0% 14.02sec 25085972 300.01sec
Nêreus Nêreus sacred_word 447246 14624 49 0.02 115419 228713 0.1 0.1 32.6% 0.0% 0.0% 0.0% 64.53sec 17665 300.01sec

Fluffy_Pillow : 734,742 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
734,741.8734,741.80.0 / 0.000%0.0 / 0.0%2.7
Resource Out In Waiting APM Active
Health268,141.79,188.346.46%3.4100.0%

Scale Factors for other metrics

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Fluffy_Pillow734,742
melee_main_hand_Nêreus 448,76961.1%77.53.75s1,738,487869,245Direct77.51,936,15601,738,4160.0%10.2%52.5%

Stats Details: Melee Main Hand Nêreus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage77.5077.500.000.000.002.00000.0000134,739,114.65556,704,517.1175.80%869,245.35869,245.35
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit37.24%28.8612512,395,074.6703,114,8032,392,954.942,042,9882,614,48069,124,678230,887,89570.09%
hit (blocked)52.55%40.7316641,611,051.9802,181,9111,609,992.291,404,1081,771,38265,614,437325,816,62279.88%
parry10.21%7.920210.00000.0000000.00%

Action Details: Melee Main Hand Nêreus

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7840000.00
  • base_dd_max:8160000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
melee_nuke_Nêreus 57,3057.8%5.559.57s3,133,0981,563,131Direct5.53,133,38003,133,3800.0%0.0%62.5%

Stats Details: Melee Nuke Nêreus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.475.470.000.000.002.00450.000017,125,657.9865,592,269.9173.89%1,563,130.521,563,130.52
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit37.53%2.05063,865,891.421,650,5954,620,8103,566,863.3404,560,6227,929,80424,615,59262.50%
hit (blocked)62.47%3.41062,693,038.07940,4773,224,8992,680,563.3403,150,0359,195,85440,976,67777.16%

Action Details: Melee Nuke Nêreus

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11760000.00
  • base_dd_max:12240000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Action Priority List

    default
    [2]:5.50
spell_dot_Nêreus 228,66831.1%5.361.01s12,851,23712,795,496Periodic144.8473,9240473,9240.0%0.0%0.0%96.5%

Stats Details: Spell Dot Nêreus

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.340.00144.81144.810.001.00452.000068,635,040.63115,845,984.6040.75%232,677.7212,795,496.02
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%144.81115174473,923.750725,177473,875.81407,903525,78568,635,041115,845,98540.77%

Action Details: Spell Dot Nêreus

  • id:0
  • school:physical
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_cast_speed
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:800000.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:60.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Action Priority List

    default
    [3]:5.36
Simple Action Stats Execute Interval
Fluffy_Pillow
pause_action 4.560.01s

Stats Details: Pause Action

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.500.000.000.000.0030.00450.00000.000.000.00%0.000.00

Action Details: Pause Action

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:30.00
  • base_crit:0.00
  • target:Nêreus
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [4]:5.00
  • if_expr:time>=30
    default
    [4]:5.00
  • if_expr:time>=30
tank_heal 60.55.00s

Stats Details: Tank Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal60.500.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Tank Heal

  • id:0
  • school:holy
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4000000.00
  • base_dd_max:4000000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Blessed Hammer97.016.43.0s2.6s0.9s30.07%44.18%16.4 (16.4)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_blessed_hammer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 31.1s
  • trigger_min/max:0.0s / 31.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.0s
  • uptime_min/max:22.39% / 36.67%

Stack Uptimes

  • blessed_hammer_1:30.07%

Spelldata

  • id:204301
  • name:Blessed Hammer
  • tooltip:Damage against {$@=}auracaster reduced by {$=}w2.
  • description:{$@spelldesc204019=Throws a Blessed Hammer that spirals outward, dealing {$204301s1=0} Holy damage to enemies and reducing the next damage they deal to you by {$=}<shield>. |cFFFFFFFFGenerates {$s2=1} Holy Power.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Crusader's Resolve9.050.534.1s5.0s30.7s92.61%0.00%50.5 (50.5)8.1

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_crusaders_resolve
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 179.0s
  • trigger_min/max:0.0s / 19.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 179.0s
  • uptime_min/max:87.31% / 97.66%

Stack Uptimes

  • crusaders_resolve_1:92.61%

Spelldata

  • id:383843
  • name:Crusader's Resolve
  • tooltip:Melee attack damage to the Paladin reduced by {$=}w1%
  • description:{$@spelldesc380188=Enemies hit by Avenger's Shield deal {$s1=0}% reduced melee damage to you for {$383843d=10 seconds}. }
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Eye of Tyr6.70.047.5s47.5s5.9s13.24%13.52%0.0 (0.0)6.5

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_eye_of_tyr
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 64.7s
  • trigger_min/max:45.0s / 64.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:11.33% / 14.98%

Stack Uptimes

  • eye_of_tyr_1:13.24%

Spelldata

  • id:387174
  • name:Eye of Tyr
  • tooltip:Dealing {$s1=25}% less damage to the Paladin.
  • description:Releases a blinding flash from your shield, causing {$s2=0} Holy damage to all nearby enemies within {$=}A1 yds and reducing all damage they deal to you by {$s1=25}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment79.70.07.9s3.8s5.4s79.17%77.21%0.0 (0.0)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_judgment
  • max_stacks:20
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 33.7s
  • trigger_min/max:0.8s / 9.0s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 32.6s
  • uptime_min/max:65.31% / 90.01%

Stack Uptimes

  • judgment_1:48.83%
  • judgment_2:25.96%
  • judgment_3:4.20%
  • judgment_4:0.18%
  • judgment_5:0.00%
  • judgment_6:0.00%

Spelldata

  • id:197277
  • name:Judgment
  • tooltip:Taking {$=}w1% increased damage from {$@=}auracaster's next Holy Power ability.
  • description:{$@spelldesc20271=Judges the target, dealing {$s1=0} {$?s403664=false}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]}
  • max_stacks:20
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Judgment of Light3.576.2101.7s3.8s85.7s99.45%98.92%76.2 (172.5)0.0

Buff Details

  • buff initial source:Nêreus
  • cooldown name:buff_judgment_of_light
  • max_stacks:5
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 352.2s
  • trigger_min/max:0.9s / 9.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.5s
  • uptime_min/max:97.93% / 99.71%

Stack Uptimes

  • judgment_of_light_1:2.20%
  • judgment_of_light_2:11.83%
  • judgment_of_light_3:24.03%
  • judgment_of_light_4:32.05%
  • judgment_of_light_5:29.34%

Spelldata

  • id:196941
  • name:Judgment of Light
  • tooltip:Attackers are healed for {$183811s1=0}.
  • description:{$@spelldesc183778=Judgment causes the next {$196941=}N successful attacks against the target to heal the attacker for {$183811s1=0}. {$@=}switch<{$s2=1}>[][This effect can only occur once every {$s1=1} sec on each target.]}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
delayed_aa_cast5.04.06.060.0s60.0s60.0s
Uptime Avg % Min Max Avg Dur Min Max
Health Cap0.04%0.03%0.05%0.1s0.0s0.8s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Fluffy_Pillow
external_healingHealth54.942,750,002.55100.00%50,055.1659,676.542.12%
Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 300.01
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 734741.80
Minimum 627338.93
Maximum 838584.11
Spread ( max - min ) 211245.18
Range [ ( max - min ) / 2 * 100% ] 14.38%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 734741.80
Minimum 627338.93
Maximum 838584.11
Spread ( max - min ) 211245.18
Range [ ( max - min ) / 2 * 100% ] 14.38%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 220499813.26
Minimum 154866663.21
Maximum 280925735.37
Spread ( max - min ) 126059072.16
Range [ ( max - min ) / 2 * 100% ] 28.58%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 271662.48
Minimum 239056.44
Maximum 312243.04
Spread ( max - min ) 73186.60
Range [ ( max - min ) / 2 * 100% ] 13.47%
Standard Deviation 10585.4130
5th Percentile 255457.23
95th Percentile 289967.01
( 95th Percentile - 5th Percentile ) 34509.78
Mean Distribution
Standard Deviation 105.8594
95.00% Confidence Interval ( 271455.00 - 271869.96 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5833
0.1 Scale Factor Error with Delta=300 956532
0.05 Scale Factor Error with Delta=300 3826127
0.01 Scale Factor Error with Delta=300 95653151
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 9236.39
Minimum 6211.24
Maximum 12983.50
Spread ( max - min ) 6772.26
Range [ ( max - min ) / 2 * 100% ] 36.66%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=8000000,range=160000,attack_speed=2,aoe_tanks=1
2 5.50 melee_nuke,damage=12000000,range=240000,attack_speed=2,cooldown=30,aoe_tanks=1
3 5.36 spell_dot,damage=800000,range=16000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
4 5.00 pause_action,duration=30,cooldown=30,if=time>=30

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health0921073530
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=8000000,range=160000,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=12000000,range=240000,attack_speed=2,cooldown=30,aoe_tanks=1
actions+=/spell_dot,damage=800000,range=16000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
actions+=/pause_action,duration=30,cooldown=30,if=time>=30


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.