SimulationCraft 1100-02      berechnet von Metaux@Antonidas

for World of Warcraft 11.0.2.56647 Live (hotfix 2024-09-20/56647, git build 534999b026)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Priest

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-20 Periodic damage increased by 4%
Shadow Priest (effect#2) base_value 10.00 6.00
2024-09-20 Direct damage increased by 4%
Shadow Priest (effect#1) base_value 10.00 6.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Fugux : 477,241 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
477,240.6477,240.6225.3 / 0.047%45,292.0 / 9.5%509,815.9
Resource Out In Waiting APM Active
Holy Power0.90.93.05%54.2100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/fugux
TalentCYEAE74QAafj6bdTrgpLZS4VlDAAAwAAjJ22mZ2W2mZsZmZbxsNAAAAAAMbT0MDDMzYGzyYYMMmlZW2GGMYwyCbAAAIzMtNLz2MAgNA
Scale Factors for Fugux Damage Per Second
Wdps Str Mastery Haste Crit Vers
Scale Factors 56.15 10.15 7.76 6.45 6.20 5.28
Normalized 5.53 1.00 0.77 0.64 0.61 0.52
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.16 0.14 0.14 0.14 0.14 0.14
Ranking
  • Wdps > Str > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, Strength=10.15, CritRating=6.20, HasteRating=6.45, MasteryRating=7.76, Versatility=5.28, Dps=56.15 )

Scale Factors for other metrics

Scale Factors for Fugux Priority Target Damage Per Second
Wdps Str Mastery Haste Crit Vers
Scale Factors 56.15 10.15 7.76 6.45 6.20 5.28
Normalized 5.53 1.00 0.77 0.64 0.61 0.52
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.16 0.14 0.14 0.14 0.14 0.14
Ranking
  • Wdps > Str > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, Strength=10.15, CritRating=6.20, HasteRating=6.45, MasteryRating=7.76, Versatility=5.28, Dps=56.15 )
Scale Factors for Fugux Damage Per Second (Effective)
Wdps Str Mastery Haste Crit Vers
Scale Factors 56.15 10.15 7.76 6.45 6.20 5.28
Normalized 5.53 1.00 0.77 0.64 0.61 0.52
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Str > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, Strength=10.15, CritRating=6.20, HasteRating=6.45, MasteryRating=7.76, Versatility=5.28, Dps=56.15 )
Scale Factors for Fugux Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Fugux Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Fugux Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Fugux Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Fugux Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Fugux Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Ranking
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, )
Scale Factors for Fugux Fight Length
Str Wdps Vers Haste Crit Mastery
Scale Factors -0.00 -0.00 -0.00 0.00 0.00 0.00
Normalized 1.00 0.11 0.05 -0.80 -0.84 -0.88
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Str > Wdps > Vers > Haste > Crit > Mastery
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, Strength=0.00, CritRating=-0.00, HasteRating=-0.00, MasteryRating=-0.00, Versatility=0.00, Dps=0.00 )
Scale Factors for Raid Damage Per Second
Wdps Str Mastery Haste Crit Vers
Scale Factors 56.15 10.15 7.76 6.45 6.20 5.28
Normalized 5.53 1.00 0.77 0.64 0.61 0.52
Scale Deltas 2310 2310 2310 2310 2310 2310
Error 0.16 0.14 0.14 0.14 0.14 0.14
Ranking
  • Wdps > Str > Mastery > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Fugux-Retribution": Class=Paladin, Spec=Retribution, Strength=10.15, CritRating=6.20, HasteRating=6.45, MasteryRating=7.76, Versatility=5.28, Dps=56.15 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Fugux477,241
Blade of Justice 36,7227.7%66.74.45s165,050153,902Direct66.7137,901289,795165,05017.9%

Stats Details: Blade Of Justice

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage66.7366.730.000.000.001.07240.000011,014,312.2811,014,312.280.00%153,902.11153,902.11
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.13%54.813081137,900.97111,584190,553137,911.52129,142147,8357,557,8427,557,8420.00%
crit17.87%11.93228289,794.64233,433398,637289,924.53238,416352,4973,456,4713,456,4710.00%

Action Details: Blade Of Justice

  • id:184575
  • school:holy
  • range:12.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:10.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:184575
  • name:Blade of Justice
  • school:holy
  • tooltip:
  • description:{$?s403826=true}[Pierce enemies][Pierce an enemy] with a blade of light, dealing {$s1=0} Holy damage{$?s403826=true}[ to your target and {$404358s1=0} Holy damage to nearby enemies.][.] |cFFFFFFFFGenerates {$s2=1} Holy Power.|r

Action Priority List

    generators
    [Q]:66.73
  • if_expr:holy_power<=3|!talent.holy_blade

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationRetribution Paladin1370273SET1.000
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370276SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin13702719SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
(blade_of_justice_) Consecration 0 (7,134)0.0% (1.5%)22.113.62s96,9540

Stats Details: Blade Of Justice Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage22.070.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Blade Of Justice Consecration

  • id:26573
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=true}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=false}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
    (blade_of_justice_) Consecration 7,1341.5%0.00.00s00Periodic357.15,01610,5335,99317.7%0.0%

Stats Details: Blade Of Justice Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.00357.050.000.00000.00002,139,931.872,139,931.870.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.29%293.801963925,015.954,1377,0655,015.814,8165,2281,473,7181,473,7180.00%
crit17.71%63.253110310,532.858,65414,77910,536.489,70511,375666,213666,2130.00%

Action Details: Blade Of Justice Consecration Tick

  • id:81297
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:11.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Divine Storm 5,235 (5,914)1.1% (1.2%)7.435.48s240,600220,087Direct7.4 (14.7)177,942375,271212,93917.7% (17.8%)

Stats Details: Divine Storm

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage7.377.370.000.000.001.09330.00001,570,481.301,570,481.300.00%220,086.96220,086.96
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.26%6.07017177,942.14107,120336,984177,417.130291,7381,079,4101,079,4100.00%
crit17.74%1.3107375,271.30224,095707,213274,014.860702,655491,071491,0710.00%

Action Details: Divine Storm

  • id:53385
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Unleashes a whirl of divine energy, dealing {$?s405289=true}[{$=}{{$s1=0}*1.05} Radiant][{$s1=0} Holy] damage to all nearby enemies. Deals reduced damage beyond {$s2=5} targets.

Action Priority List

    finishers
    [J]:7.38
  • if_expr:variable.ds_castable&!buff.hammer_of_light_ready.up&(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Divine Storm (_tempest) 6790.1%7.435.48s27,6430Direct7.423,09648,51127,64317.9%

Stats Details: Divine Storm Tempest

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage7.377.370.000.000.000.00000.0000203,859.75203,859.750.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.11%6.0601623,096.4318,63031,81423,040.01031,509139,852139,8520.00%
crit17.89%1.320848,511.3138,97366,55535,309.66066,46664,00764,0070.00%

Action Details: Divine Storm Tempest

  • id:224239
  • school:holyfire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:224239
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:{$@spelldesc53385=Unleashes a whirl of divine energy, dealing {$?s405289=true}[{$=}{{$s1=0}*1.05} Radiant][{$s1=0} Holy] damage to all nearby enemies. Deals reduced damage beyond {$s2=5} targets.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Divine Toll 0 (11,773)0.0% (2.5%)5.856.27s604,549532,802

Stats Details: Divine Toll

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.830.000.000.000.001.13470.00000.000.000.00%532,802.21532,802.21

Action Details: Divine Toll

  • id:375576
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:0.0

Spelldata

  • id:375576
  • name:Divine Toll
  • school:holy
  • tooltip:
  • description:Instantly cast {$?a137029=false}[Holy Shock]?a137028[Avenger's Shield]?a137027[Judgment][Holy Shock, Avenger's Shield, or Judgment] on up to {$s1=5} targets within {$=}A2 yds.{$?=}(a384027|a386738|a387893)[ After casting Divine Toll, you instantly cast ][]{$?=}(a387893&c1)[Holy Shock]?(a386738&c2)[Avenger's Shield]?(a384027&c3)[Judgment][]{$?a387893=true}[ every {$387895t1=5} sec. This effect lasts {$387895d=15 seconds}.][]{$?a384027=true}[ every {$384029t1=5} sec. This effect lasts {$384029d=15 seconds}.][]{$?a386738=true}[ every {$386730t1=5} sec. This effect lasts {$386730d=15 seconds}.][]{$?=}c3[ Divine Toll's Judgment deals {$326011s1=100}% increased damage.][]{$?=}c2[ Generates {$s5=1} Holy Power per target hit.][]

Action Priority List

    generators
    [N]:5.83
  • if_expr:holy_power<=2&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)&(cooldown.avenging_wrath.remains>15|cooldown.crusade.remains>15|talent.radiant_glory|fight_remains<8)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Global CooldownPaladin1370268SET1.000
    (divine_toll_) Judgment 4,6071.0%5.856.27s236,8610Direct5.8199,937417,151236,95017.0%

Stats Details: Divine Toll Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.835.830.000.000.000.00000.00001,381,512.071,381,512.070.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.95%4.8407199,936.81174,050271,595199,875.530238,412966,963966,9630.00%
crit17.05%0.9907417,150.94364,113566,322275,041.650564,281414,549414,5490.00%

Action Details: Divine Toll Judgment

  • id:20271
  • school:holystrike
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.610542
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05
  • base_multiplier:3.15

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    (divine_resonance_) Judgment 7,1661.5%17.017.22s126,3070Direct17.0105,333222,737126,34917.9%

Stats Details: Divine Resonance Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage16.9816.970.000.000.000.00000.00002,144,572.972,144,572.970.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.10%13.93621105,332.6887,025154,072105,366.6493,034119,8631,467,6981,467,6980.00%
crit17.90%3.04010222,737.15182,056322,319214,055.270322,319676,875676,8750.00%

Action Details: Divine Resonance Judgment

  • id:20271
  • school:holystrike
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.610542
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05
  • base_multiplier:1.58

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Empyrean Hammer 77,15116.2%376.70.79s61,4340Direct376.7 (376.7)51,414108,18761,43217.6% (17.6%)

Stats Details: Empyrean Hammer

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage376.68376.680.000.000.000.00000.000023,140,610.4323,140,610.430.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.35%310.2022241151,414.1435,47589,99951,415.3448,87553,80115,948,95815,948,9580.00%
crit17.65%66.4734109108,186.7774,213189,499108,243.5999,780119,4437,191,6537,191,6530.00%

Action Details: Empyrean Hammer

  • id:431398
  • school:holy
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:431398
  • name:Empyrean Hammer
  • school:holy
  • tooltip:
  • description:A Holy Hammer called down from the skies to deal {$s1=0} Holy damage to its target.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Execution Sentence 36,1587.6%9.632.03s1,133,2211,502,037Direct9.61,133,21501,133,2150.0%

Stats Details: Execution Sentence

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.579.570.000.000.000.75450.000010,847,708.1010,847,708.100.00%1,502,036.571,502,036.57
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%9.577121,133,214.56318,7652,258,1481,132,662.50903,5811,386,78810,847,70810,847,7080.00%

Action Details: Execution Sentence

  • id:387113
  • school:holy
  • range:150.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:387113
  • name:Execution Sentence
  • school:holy
  • tooltip:
  • description:{$@spelldesc343527=A hammer slowly falls from the sky upon the target, after {$d=8 seconds}, they suffer {$s2=20}% of the damage taken from your abilities as Holy damage during that time. {$?s406158=false} [|cFFFFFFFFGenerates {$406158s1=3} Holy Power.][]}

Action Priority List

    cooldowns
    [H]:9.57
  • if_expr:(!buff.crusade.up&cooldown.crusade.remains>15|buff.crusade.stack=10|cooldown.avenging_wrath.remains<0.75|cooldown.avenging_wrath.remains>15|talent.radiant_glory)&(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(target.time_to_die>8&!talent.executioners_will|target.time_to_die>12)&cooldown.wake_of_ashes.remains<gcd

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Expurgation 32,2536.8%66.74.45s144,9240Periodic131.161,717130,18973,77517.6%94.5%

Stats Details: Expurgation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage66.730.00131.08131.0861.900.00002.16349,671,195.909,671,195.900.00%34,103.820.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.39%108.007314261,716.7031263,15161,740.3250,85876,9056,665,5026,665,5020.00%
crit17.61%23.09748130,189.0978476,864130,297.9791,947204,6533,005,6943,005,6940.00%

Action Details: Expurgation

  • id:383346
  • school:holyfire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:true
  • attack_power_mod.tick:0.229500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.05
  • base_multiplier:1.21
  • dot_duration:9.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:unknown

Spelldata

  • id:383346
  • name:Expurgation
  • school:holyfire
  • tooltip:Suffering {$=}w1 {$?s403665=false}[Holy][Radiant] damage every {$t1=3} sec.{$?s406545=false}[ Holy damage taken from {$@=}auracaster increased by {$=}w2%.][]
  • description:{$@spelldesc383344=Your Blade of Justice causes the target to burn for {$383346=}o1 {$?s403665=false}[Holy][Radiant] damage over {$383346d=9 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Final Verdict 82,57817.3%88.23.36s280,739253,065Direct88.2234,876493,454280,73517.7%

Stats Details: Final Verdict

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage88.2288.220.000.000.001.10940.000024,766,472.7224,766,472.720.00%253,065.14253,065.14
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.26%72.5747101234,875.89144,813457,010234,897.54216,006253,03817,045,96717,045,9670.00%
crit17.74%15.65335493,454.31302,949956,065493,491.09389,607593,2767,720,5057,720,5050.00%

Action Details: Final Verdict

  • id:383328
  • school:holystrike
  • range:12.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:383328
  • name:Final Verdict
  • school:holy
  • tooltip:
  • description:Unleashes a powerful weapon strike that deals {$s1=0} {$?s403664=true}[Holystrike][Holy] damage to an enemy target, Final Verdict has a {$s2=15}% chance to reset the cooldown of Hammer of Wrath and make it usable on any target, regardless of their health.

Action Priority List

    finishers
    [K]:88.22
  • if_expr:(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hammer of Light 45,8059.6%15.519.68s889,181754,092Direct15.4746,6331,569,196890,01617.4%

Stats Details: Hammer Of Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage15.4615.440.000.000.001.17920.000013,744,830.4313,744,830.430.00%754,091.76754,091.76
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.56%12.75519746,633.49442,4951,239,485746,436.81618,551873,0319,519,2049,519,2040.00%
crit17.44%2.690101,569,195.83925,6992,579,2891,482,507.4302,342,7964,225,6264,225,6260.00%

Action Details: Hammer Of Light

  • id:427453
  • school:holy
  • range:14.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:holy_power
  • base_cost:3
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:427453
  • name:Hammer of Light
  • school:holy
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$429826s1=0} Holy damage and {$=}{{$429826s1=0}/2} Holy damage up to 4 nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.

Action Priority List

    finishers
    [I]:15.46

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hammer of Wrath 10,2732.2%20.514.21s150,154140,829Direct20.5 (20.5)125,813263,805150,22217.7% (17.7%)

Stats Details: Hammer Of Wrath

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage20.5320.520.000.000.001.06620.00003,082,752.953,082,752.950.00%140,829.28140,829.28
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.31%16.89629125,812.8299,348175,889125,816.65110,990142,3612,125,1912,125,1910.00%
crit17.69%3.63012263,804.90207,836367,960257,685.470366,793957,562957,5620.00%

Action Details: Hammer Of Wrath

  • id:24275
  • school:holystrike
  • range:30.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:1.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$=}<damage> {$?s403664=true}[Holystrike][Holy] damage. Only usable on enemies that have less than 20% health{$?s326730=true}[, or during Avenging Wrath][]. |cFFFFFFFFGenerates {$s2=1} Holy Power.

Action Priority List

    generators
    [R]:20.53
  • if_expr:(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown DurationRetribution Paladin1370273SET1.000
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin4123147PCT16.0%
Spell Direct AmountRetribution Paladin4123148PCT-14.0%
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Hasted Cooldown Duration (Category)Paladin1370266SET1.000
Highlord's Judgment 11,2552.4%28.810.18s117,3400Direct28.898,819202,704117,33817.8%

Stats Details: Highlords Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage28.7728.770.000.000.000.00000.00003,375,469.783,375,469.780.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.17%23.6474398,819.1391,449120,13098,802.8392,683107,1032,335,8882,335,8880.00%
crit17.83%5.13017202,704.36186,556245,065201,522.610244,7381,039,5821,039,5820.00%

Action Details: Highlords Judgment

  • id:383921
  • school:holy
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383921
  • name:Highlord's Judgment
  • school:holy
  • tooltip:
  • description:Blasts the target with the Light, dealing {$s1=0} Holy damage.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Judgment 15,2643.2%35.68.40s128,459119,068Direct35.6107,550225,920128,52417.7%

Stats Details: Judgment

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage35.6335.610.000.000.001.07890.00004,577,194.444,577,194.440.00%119,067.54119,067.54
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.28%29.301642107,550.1987,025154,072107,554.6599,313115,4033,151,2973,151,2970.00%
crit17.72%6.31017225,920.07182,056322,319225,701.890320,2251,425,8971,425,8970.00%

Action Details: Judgment

  • id:20271
  • school:holystrike
  • range:30.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:11.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.610542
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05
  • base_multiplier:1.58

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:Movement speed increased by {$s2=10}%.
  • description:Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]

Action Priority List

    generators
    [P]:35.63
  • if_expr:holy_power<=3|!talent.boundless_judgment

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
Hasted Cooldown Duration (Category)Retribution Paladin1370277SET1.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
melee 0 (38,629)0.0% (8.1%)152.31.97s76,05641,167

Stats Details: Melee

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage152.320.000.000.000.001.84750.00000.000.000.00%41,167.1741,167.17

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
    Crusading Strikes (crusading_strike) 27,4485.8%152.31.97s54,0420Direct152.345,21595,00454,04117.7%

Stats Details: Crusading Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage152.32152.320.000.000.000.00000.00008,231,469.038,231,469.030.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.27%125.328716545,214.9437,40663,87945,212.2043,25347,2465,666,2185,666,2180.00%
crit17.73%27.0094895,003.7878,254133,63695,015.8085,372105,5662,565,2522,565,2520.00%

Action Details: Crusading Strike

  • id:408385
  • school:holystrike
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:408385
  • name:Crusading Strikes
  • school:physical
  • tooltip:
  • description:Strike the target for {$=}<damage> {$?s403664=true} [Holystrike][Physical] damage. |cFFFFFFFFGenerates {$s2=1} Holy Power every other attack.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownRetribution Paladin1370274SET1.000
    Seal of the Crusader 11,1812.3%152.31.97s22,0140Direct152.318,42138,72722,01417.7%

Stats Details: Seal Of The Crusader

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage152.32152.320.000.000.000.00000.00003,353,136.433,353,136.430.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.31%125.378516418,421.4315,24126,02818,420.3517,62219,1922,309,5012,309,5010.00%
crit17.69%26.9575138,726.8831,88554,45138,732.6034,64243,4771,043,6351,043,6350.00%

Action Details: Seal Of The Crusader

  • id:385723
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:385723
  • name:Seal of the Crusader
  • school:holy
  • tooltip:{$@=}spellaura385728
  • description:{$@spelldesc385728=Your auto attacks deal {$=}{{$385723s1=0}*(1+{$s2=0}/100)} additional Holy damage.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Searing Light 2,8540.6%4.261.45s203,2180Direct4.2169,970357,003203,21917.8%

Stats Details: Searing Light

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.214.210.000.000.000.00000.0000855,570.88855,570.880.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.22%3.46011169,970.17144,032245,966167,457.070244,863588,386588,3860.00%
crit17.78%0.7505357,003.08301,315514,561192,793.570514,561267,185267,1850.00%

Action Details: Searing Light

  • id:407478
  • school:holyfire
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:407478
  • name:Searing Light
  • school:holyfire
  • tooltip:
  • description:Calls down a explosion of Holy Fire dealing {$s2=0} Radiant damage to all nearby enemies and leaving a Consecration in its wake.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
(searing_light_) Consecration 0 (1,555)0.0% (0.3%)4.261.45s110,6880

Stats Details: Searing Light Consecration

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.210.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Searing Light Consecration

  • id:26573
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26573
  • name:Consecration
  • school:holy
  • tooltip:Damage every {$t1=1} sec.
  • description:Consecrates the land beneath you, causing {$?s405289=true}[{$=}{{$=}<dmg>*1.05} Radiant][{$=}{{$=}<dmg>*1.05} Holy] damage over {$d=12 seconds} to enemies who enter the area{$?s204054=false}[ and reducing their movement speed by {$204054s2=50}%.][.] Limit {$s2=1}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
    (searing_light_) Consecration 1,5550.3%0.00.00s00Periodic74.45,23110,9996,26117.8%0.0%

Stats Details: Searing Light Consecration Tick

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.000.000.0074.440.000.00000.0000466,009.28466,009.280.00%0.000.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.15%61.1501545,231.344,1377,0655,197.6606,704319,901319,9010.00%
crit17.85%13.2804310,998.678,65414,77910,887.34014,490146,108146,1080.00%

Action Details: Searing Light Consecration Tick

  • id:81297
  • school:holyfire
  • range:50000.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:11.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:81297
  • name:Consecration
  • school:holy
  • tooltip:
  • description:Deals {$s1=0} Holy damage every {$26573t1=1} sec to enemies within {$=}A1 yards.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin13702713PCT-6.0%
Spell CooldownRetribution Paladin13702722ADD11000.000
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Shield of Vengeance (_proc) 22,0104.6%5.063.96s1,334,0100Direct5.01,334,00401,334,0040.0%

Stats Details: Shield Of Vengeance Proc

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.964.960.000.000.000.00000.00006,611,746.936,611,746.930.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%4.96461,334,004.351,315,1011,417,8191,333,710.701,315,1011,380,7346,611,7476,611,7470.00%

Action Details: Shield Of Vengeance Proc

  • id:184689
  • school:holy
  • range:8.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1354372.35
  • base_dd_max:1354372.35
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:184689
  • name:Shield of Vengeance
  • school:holy
  • tooltip:
  • description:{$@spelldesc184662=Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.}
Touch of Light (_dmg) 2,5800.5%23.312.60s33,2580Direct23.327,84158,40833,25817.7%

Stats Details: Touch Of Light Dmg

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage23.2723.270.000.000.000.00000.0000773,995.78773,995.780.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.28%19.1553827,841.0222,86239,04227,837.1124,04532,359533,131533,1310.00%
crit17.72%4.1201458,408.3647,82881,67657,521.16081,150240,865240,8650.00%

Action Details: Touch Of Light Dmg

  • id:385354
  • school:holy
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:385354
  • name:Touch of Light
  • school:holy
  • tooltip:
  • description:{$@spelldesc385349=Your spells and abilities have a chance to cause your target to erupt in a blinding light dealing {$385354s1=0} Holy damage or healing an ally for {$385352s1=0} health.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Wake of Ashes 9,960 (37,332)2.1% (7.8%)9.832.00s1,143,274933,559Direct9.8 (88.7)254,964535,185305,16917.9% (17.8%)

Stats Details: Wake Of Ashes

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.799.790.000.000.001.22470.00002,987,223.312,987,223.310.00%933,559.19933,559.19
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.08%8.03312254,963.87234,132354,889254,923.25234,390279,6182,048,4072,048,4070.00%
crit17.92%1.7507535,184.61489,805680,191456,461.200650,288938,816938,8160.00%

Action Details: Wake Of Ashes

  • id:255937
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:holy_power
  • energize_amount:3.0

Spelldata

  • id:255937
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.

Action Priority List

    generators
    [M]:9.79
  • if_expr:(!talent.lights_guidance|holy_power>=2&talent.lights_guidance)&(cooldown.avenging_wrath.remains>6|cooldown.crusade.remains>6|talent.radiant_glory)&(!talent.execution_sentence|cooldown.execution_sentence.remains>4|target.time_to_die<8)&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Truth's Wake 14,0012.9%9.832.00s428,5700Periodic59.458,995124,06170,61817.9%34.7%

Stats Details: Truths Wake

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.790.0059.4059.400.000.00001.75214,194,917.094,194,917.090.00%40,305.120.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit82.14%48.79366358,995.261981,77059,020.1053,73664,1982,878,4332,878,4330.00%
crit17.86%10.61128124,061.0144171,063123,859.1062,260168,4021,316,4841,316,4840.00%

Action Details: Truths Wake

  • id:403695
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.544000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.05
  • base_multiplier:1.10
  • dot_duration:9.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:403695
  • name:Truth's Wake
  • school:holyfire
  • tooltip:{$?=}(s403696)[Burning for {$=}w2 damage every {$t2=3} sec and movement speed reduced by {$s1=50}%.] [Movement speed reduced by {$s1=50}%.]
  • description:Burns the targets for an additional {$=}o2 Radiant damage over {$d=9 seconds}, and slows them by {$s1=50}%.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Wake of Ashes (seething_flames_0) 6,5831.4%9.832.00s202,0710Direct9.8169,207355,350202,07317.7%

Stats Details: Seething Flames 0

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.779.770.000.000.000.00000.00001,973,889.991,973,889.990.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.35%8.04212169,207.05156,028229,613169,185.00156,502186,0811,361,0791,361,0790.00%
crit17.65%1.7207355,349.96326,410447,724301,319.960438,663612,811612,8110.00%

Action Details: Seething Flames 0

  • id:405345
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:405345
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:{$@spelldesc255937=Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
    Wake of Ashes (seething_flames_1) 6,7881.4%9.832.01s208,6480Direct9.8174,387367,906208,64417.7%

Stats Details: Seething Flames 1

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage9.759.750.000.000.000.00000.00002,034,543.572,034,543.570.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit82.30%8.02212174,387.44156,028234,811174,425.57156,371200,0641,399,4591,399,4590.00%
crit17.70%1.7308367,906.50326,410491,225311,846.170491,225635,085635,0850.00%

Action Details: Seething Flames 1

  • id:405350
  • school:holyfire
  • range:0.0
  • travel_speed:0.0000
  • radius:14.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:405350
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:
  • description:{$@spelldesc255937=Lash out at your enemies, dealing {$s1=0} Radiant damage to all enemies within {$=}a1 yds in front of you, and applying {$@=}spellname403695, burning the targets for an additional {$=}{{$403695s2=0}*({$403695d=9 seconds}/$403695t+1)} damage over {$403695d=9 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s2=3} Holy Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountRetribution Paladin41231414PCT5.0%
Spell Periodic AmountRetribution Paladin41231415PCT5.0%
Simple Action Stats Execute Interval
Fugux
imperfect_ascendancy_serum 2.9127.24s

Stats Details: Ascension Channel

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.910.002.890.000.001.59381.60210.000.000.00%0.000.00

Action Details: Ascension Channel

  • id:455482
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:2.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:455482
  • name:Ascension
  • school:physical
  • tooltip:{$=}pri increased by {$=}w2 and all other stats increased by {$=}w1.
  • description:Drink from the vial and ascend over 1.5 sec before taking on a new more powerful form increasing your {$=}pri by {$s2=3828} and all other stats by {$s1=1150} but only for {$d=20 seconds}.
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fugux
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fugux
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
The Sushi Special 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:457302
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fugux
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.5300.65s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.480.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [D]:1.48
  • if_expr:buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up|fight_remains<30
Sacrosanct Crusade (_heal) 15.519.68s

Stats Details: Sacrosanct Crusade Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal15.460.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Sacrosanct Crusade Heal

  • id:461885
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fugux
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:234097.20
  • base_dd_max:234097.20
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:461885
  • name:Sacrosanct Crusade
  • school:holy
  • tooltip:
  • description:{$@spelldesc431730={$?a137028=false}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=false}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=false}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=false}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
Shield of Vengeance 5.064.03s

Stats Details: Shield Of Vengeance

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb4.964.960.000.000.000.60230.00000.000.000.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%4.96460.00000.0000000.00%

Action Details: Shield Of Vengeance

  • id:184662
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.7500
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:62.999
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fugux
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs {$=}w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.

Action Priority List

    cooldowns
    [G]:3.96
  • if_expr:fight_remains>15&(!talent.execution_sentence|!debuff.execution_sentence.up)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascension2.90.0127.4s127.4s19.4s18.71%0.00%0.0 (0.0)2.7

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_ascension
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:583.45
  • stat:haste_rating
  • amount:583.45
  • stat:mastery_rating
  • amount:583.45
  • stat:versatility_rating
  • amount:583.45
  • stat:strength
  • amount:3487.84
  • stat:speed_rating
  • amount:386.90
  • stat:leech_rating
  • amount:97.25
  • stat:avoidance_rating
  • amount:97.25

Trigger Details

  • interval_min/max:120.1s / 141.9s
  • trigger_min/max:120.1s / 141.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:15.44% / 22.07%

Stack Uptimes

  • ascension_1:18.71%

Spelldata

  • id:455482
  • name:Ascension
  • tooltip:{$=}pri increased by {$=}w2 and all other stats increased by {$=}w1.
  • description:Drink from the vial and ascend over 1.5 sec before taking on a new more powerful form increasing your {$=}pri by {$s2=3828} and all other stats by {$s1=1150} but only for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Blessing of Dawn71.35.54.2s3.9s1.6s37.85%64.93%0.0 (0.0)0.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_blessing_of_dawn
  • max_stacks:2
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 15.3s
  • trigger_min/max:0.8s / 11.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.7s
  • uptime_min/max:27.94% / 47.22%

Stack Uptimes

  • blessing_of_dawn_1:36.29%
  • blessing_of_dawn_2:1.55%

Spelldata

  • id:385127
  • name:Blessing of Dawn
  • tooltip:Your next Holy Power spending ability deals {$s1=20}% additional increased damage and healing.
  • description:Your next Holy Power spending ability deals {$s1=20}% additional increased damage and healing. This effect stacks.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blessing of Dusk1.469.5166.5s4.2s210.1s98.43%0.00%69.5 (69.5)0.4

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_blessing_of_dusk
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 322.9s
  • trigger_min/max:0.6s / 15.1s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 355.7s
  • uptime_min/max:96.54% / 98.84%

Stack Uptimes

  • blessing_of_dusk_1:98.43%

Spelldata

  • id:385126
  • name:Blessing of Dusk
  • tooltip:Damage taken reduced by {$=}w1%{$?s385129=true}[, armor increased by {$=}w2%, and Holy Power generating abilities cool down {$=}w3% faster.][.]
  • description:Damage taken reduced by {$s1=4}%{$?s385129=true}&c2[, armor increased by {$s2=10}%, and Holy Power generating abilities cool down {$s3=10}% faster]?s385129[ and your Holy Power generating abilities also grant an absorb shield for {$s9=10}% of damage or healing dealt.][] For {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.52%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crusade16.261.518.8s3.8s9.6s51.73%57.56%32.1 (87.2)15.7

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_crusade
  • max_stacks:10
  • base duration:27.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 41.0s
  • trigger_min/max:0.2s / 30.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:46.24% / 58.20%

Stack Uptimes

  • crusade_1:9.84%
  • crusade_4:4.63%
  • crusade_6:7.61%
  • crusade_7:1.14%
  • crusade_9:6.95%
  • crusade_10:21.57%

Spelldata

  • id:231895
  • name:Crusade
  • tooltip:{$?=}{$=}w1>0&{$=}w3>0[Damage done and haste increased by {$=}<damage>%.]?{$=}w1>0[Damage done increased by {$=}{{$=}w1}%.][Haste increased by {$=}<damage>%.]{$?=}{$=}w4>0[ Hammer of Wrath may be cast on any target.][]{$?s53376=false}[ Exploding with Holy light for {$326731s1=0} damage to nearby enemies.][]
  • description:Call upon the Light and begin a crusade, increasing your haste {$?s384376=true}[and damage ][]by {$=}{{$s5=30}/10}% for {$d=27 seconds}. Each Holy Power spent during Crusade increases haste {$?s384376=true}[and damage ][]by an additional {$=}{{$s5=30}/10}%. Maximum {$u=10} stacks.{$?s53376=false}[ While active, each Holy Power spent causes you to explode with Holy light for {$326731s1=0} damage to nearby enemies.][]{$?s384376=true}[ Hammer of Wrath may be cast on any target.][]
  • max_stacks:10
  • duration:27.00
  • cooldown:120.00
  • default_chance:100.00%
Divine Purpose11.00.124.7s24.5s2.5s9.29%10.33%0.1 (0.1)0.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_divine_purpose
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 299.4s
  • trigger_min/max:0.8s / 299.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.2s
  • uptime_min/max:0.66% / 21.92%

Stack Uptimes

  • divine_purpose_1:9.29%

Spelldata

  • id:408458
  • name:Divine Purpose
  • tooltip:Your next Holy Power ability is free and deals {$s2=10}% increased damage and healing.
  • description:{$@spelldesc408459=Holy Power spending abilities have a {$s1=10}% chance to make your next Holy Power spending ability free and deal {$408458s2=10}% increased damage and healing.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Divine Resonance5.80.056.4s56.3s14.7s28.57%0.00%11.4 (11.4)5.6

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_divine_resonance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:54.5s / 78.8s
  • trigger_min/max:54.5s / 78.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:25.19% / 31.25%

Stack Uptimes

  • divine_resonance_1:28.57%

Spelldata

  • id:355455
  • name:Divine Resonance
  • tooltip:Casting {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$t1=5} sec for {$s2=15} sec.
  • description:{$@spelldesc355098=After casting Divine Toll, you instantly cast {$?=}c2[Avenger's Shield]?c1[Holy Shock][Judgement] every {$355455t1=5} sec. This effect lasts {$355455s2=15} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Empyrean Power7.40.235.3s34.3s1.7s4.27%100.00%0.2 (0.2)0.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_empyrean_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.1s / 320.3s
  • trigger_min/max:1.1s / 320.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.7s
  • uptime_min/max:0.00% / 13.88%

Stack Uptimes

  • empyrean_power_1:4.27%

Spelldata

  • id:326733
  • name:Empyrean Power
  • tooltip:Your next Divine Storm is free and deals {$=}w1% additional damage.
  • description:{$@spelldesc326732={$?s404542=true}[Crusading Strikes has a {$s2=5}%][Crusader Strike has a {$s1=15}%] chance to make your next Divine Storm free and deal {$326733s1=15}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:326732
  • name:Empyrean Power
  • tooltip:
  • description:{$?s404542=true}[Crusading Strikes has a {$s2=5}%][Crusader Strike has a {$s1=15}%] chance to make your next Divine Storm free and deal {$326733s1=15}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Final Verdict10.82.426.2s21.2s6.3s22.56%17.36%2.4 (2.4)0.9

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_final_verdict
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 214.2s
  • trigger_min/max:0.8s / 214.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.2s
  • uptime_min/max:1.59% / 51.94%

Stack Uptimes

  • final_verdict_1:22.56%

Spelldata

  • id:337228
  • name:Final Verdict
  • tooltip:Hammer of Wrath can be used on any target.
  • description:{$@spelldesc336872=Unleashes a powerful weapon strike that deals {$s1=0} Holy damage to an enemy target. Has a {$s2=15}% chance to activate Hammer of Wrath and reset its cooldown.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of Alchemical Chaos (Crit)2.10.6111.1s77.0s35.1s24.85%0.00%2.8 (2.8)0.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 357.2s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 83.50%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.85%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6112.5s77.3s35.2s24.85%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 349.8s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 270.0s
  • uptime_min/max:0.00% / 86.02%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:24.85%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6112.0s76.6s35.3s25.19%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 347.5s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 240.0s
  • uptime_min/max:0.00% / 86.30%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:25.19%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.4s76.2s35.4s25.11%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 343.8s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 203.5s
  • uptime_min/max:0.00% / 80.23%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.11%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance (hammer_of_light_free)5.80.048.5s48.5s1.9s3.71%2.79%0.0 (0.0)0.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_hammer_of_light_free
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • hammer_of_light_free_1:3.71%

Spelldata

  • id:433732
  • name:Light's Deliverance
  • tooltip:
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=false}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hammer of Light (_ready)9.80.032.0s32.0s1.2s3.99%11.40%0.0 (0.0)0.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_hammer_of_light_ready
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.0s / 43.5s
  • trigger_min/max:30.0s / 43.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 2.1s
  • uptime_min/max:3.50% / 4.43%

Stack Uptimes

  • hammer_of_light_ready_1:3.99%

Spelldata

  • id:427453
  • name:Hammer of Light
  • tooltip:
  • description:Hammer down your enemy with the power of the Light, dealing {$429826s1=0} Holy damage and {$=}{{$429826s1=0}/2} Holy damage up to 4 nearby enemies. Additionally, calls down Empyrean Hammers from the sky to strike {$427445s2=3} nearby enemies for {$431398s1=0} Holy damage each.
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Light's Deliverance6.7369.947.6s0.8s43.2s97.06%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_lights_deliverance
  • max_stacks:60
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:35.9s / 68.3s
  • trigger_min/max:0.0s / 11.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.1s
  • uptime_min/max:92.25% / 98.61%

Stack Uptimes

  • lights_deliverance_1:1.20%
  • lights_deliverance_2:1.33%
  • lights_deliverance_3:0.83%
  • lights_deliverance_4:0.73%
  • lights_deliverance_5:0.89%
  • lights_deliverance_6:0.68%
  • lights_deliverance_7:0.59%
  • lights_deliverance_8:1.54%
  • lights_deliverance_9:1.45%
  • lights_deliverance_10:1.45%
  • lights_deliverance_11:1.93%
  • lights_deliverance_12:1.62%
  • lights_deliverance_13:1.60%
  • lights_deliverance_14:1.90%
  • lights_deliverance_15:1.60%
  • lights_deliverance_16:1.61%
  • lights_deliverance_17:2.04%
  • lights_deliverance_18:1.73%
  • lights_deliverance_19:1.64%
  • lights_deliverance_20:1.83%
  • lights_deliverance_21:1.79%
  • lights_deliverance_22:1.60%
  • lights_deliverance_23:1.73%
  • lights_deliverance_24:1.81%
  • lights_deliverance_25:1.61%
  • lights_deliverance_26:1.66%
  • lights_deliverance_27:1.79%
  • lights_deliverance_28:1.71%
  • lights_deliverance_29:1.62%
  • lights_deliverance_30:1.72%
  • lights_deliverance_31:1.71%
  • lights_deliverance_32:1.62%
  • lights_deliverance_33:1.69%
  • lights_deliverance_34:1.76%
  • lights_deliverance_35:1.73%
  • lights_deliverance_36:1.75%
  • lights_deliverance_37:1.82%
  • lights_deliverance_38:1.78%
  • lights_deliverance_39:1.78%
  • lights_deliverance_40:1.74%
  • lights_deliverance_41:1.77%
  • lights_deliverance_42:1.66%
  • lights_deliverance_43:1.64%
  • lights_deliverance_44:1.61%
  • lights_deliverance_45:1.62%
  • lights_deliverance_46:1.65%
  • lights_deliverance_47:1.67%
  • lights_deliverance_48:1.72%
  • lights_deliverance_49:1.74%
  • lights_deliverance_50:1.80%
  • lights_deliverance_51:1.82%
  • lights_deliverance_52:1.85%
  • lights_deliverance_53:1.88%
  • lights_deliverance_54:1.91%
  • lights_deliverance_55:1.94%
  • lights_deliverance_56:1.99%
  • lights_deliverance_57:2.02%
  • lights_deliverance_58:2.02%
  • lights_deliverance_59:2.03%
  • lights_deliverance_60:0.08%

Spelldata

  • id:433674
  • name:Light's Deliverance
  • tooltip:{$?=}{$=}W1=={$=}U[Ready to deliver Light's justice.][Building up Light's Deliverance. At {$u=60} stacks, your next Hammer of Light cast will activate another Hammer of Light for free.]
  • description:{$@spelldesc425518=You gain a stack of Light's Deliverance when you call down an Empyrean Hammer. While {$?a137028=false}[Eye of Tyr][Wake of Ashes] and Hammer of Light are unavailable, you consume {$433674=}U stacks of Light's Deliverance, empowering yourself to cast Hammer of Light an additional time for free.}
  • max_stacks:60
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Quickwick's Quick Trick Wick Walk2.60.0127.5s127.5s19.3s16.92%0.00%0.0 (0.0)2.4

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_quickwicks_quick_trick_wick_walk
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Quickwick Candlestick

Stat Details

  • stat:haste_rating
  • amount:4706.58

Trigger Details

  • interval_min/max:120.0s / 139.9s
  • trigger_min/max:120.0s / 139.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:13.82% / 20.21%

Stack Uptimes

  • quickwicks_quick_trick_wick_walk_1:16.92%

Spelldata

  • id:455451
  • name:Quickwick's Quick Trick Wick Walk
  • tooltip:Increased movement speed and haste.
  • description:{$@=}class be nimble, {$@=}class be quick. {$@=}class invoke the power of the candlestick to increase movement speed by {$s1=20}% and Haste by {$s2=9192} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Sacrosanct Crusade12.313.025.1s11.8s12.1s49.36%51.30%13.0 (13.0)11.8

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_sacrosanct_crusade
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:10.0s / 49.7s
  • trigger_min/max:0.8s / 42.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.3s
  • uptime_min/max:43.96% / 55.51%

Stack Uptimes

  • sacrosanct_crusade_1:49.36%

Spelldata

  • id:461867
  • name:Sacrosanct Crusade
  • tooltip:Absorbs {$=}w1 damage.
  • description:{$@spelldesc431730={$?a137028=false}[Eye of Tyr][Wake of Ashes] surrounds you with a Holy barrier for {$?a137028=false}[{$s1=15}][{$s4=10}]% of your maximum health. Hammer of Light heals you for {$?a137028=false}[{$s2=15}][{$s5=5}]% of your maximum health, increased by {$?a137028=false}[{$s3=2}][{$s6=1}]% for each additional target hit. Any overhealing done with this effect gets converted into a Holy barrier instead.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sanctification58.30.066.9s5.2s82.5s98.46%97.62%0.0 (0.0)2.6

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_sanctification
  • max_stacks:20
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 358.2s
  • trigger_min/max:0.0s / 22.0s
  • trigger_pct:99.83%
  • duration_min/max:0.0s / 359.8s
  • uptime_min/max:92.44% / 99.99%

Stack Uptimes

  • sanctification_1:41.47%
  • sanctification_2:27.02%
  • sanctification_3:23.56%
  • sanctification_4:6.39%
  • sanctification_5:0.01%
  • sanctification_6:0.00%

Spelldata

  • id:433671
  • name:Sanctification
  • tooltip:Empyrean Hammer damage increased by {$=}w1%
  • description:{$@spelldesc432977=Casting Judgment increases the damage of Empyrean Hammer by {$433671s1=10}% for {$433671d=10 seconds}. Multiple applications may overlap.}
  • max_stacks:20
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Shake the Heavens8.66.936.2s36.2s29.1s83.17%85.83%127.8 (120.9)7.7

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_shake_the_heavens
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • shake_the_heavens_1:83.17%

Spelldata

  • id:431536
  • name:Shake the Heavens
  • tooltip:Casting Empyrean Hammer on a nearby target every $t sec.
  • description:{$@spelldesc431533=After casting Hammer of Light, you call down an Empyrean Hammer on a nearby target every {$431536=}T sec, for {$431536d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Shield of Vengeance5.05.063.9s27.4s10.0s16.50%0.00%5.0 (5.0)5.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:63.0s / 71.8s
  • trigger_min/max:0.0s / 71.8s
  • trigger_pct:100.00%
  • duration_min/max:10.0s / 10.0s
  • uptime_min/max:14.27% / 18.69%

Stack Uptimes

  • shield_of_vengeance_1:16.50%

Spelldata

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs {$=}w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs {$=}<shield> damage for {$d=10 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Tempered Potion1.50.0300.8s300.8s27.5s13.32%0.00%0.0 (0.0)1.2

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:300.0s / 318.6s
  • trigger_min/max:300.0s / 318.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.92% / 18.08%

Stack Uptimes

  • tempered_potion_1:13.32%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Undisputed Ruling13.51.922.7s19.7s6.4s28.94%34.86%1.9 (1.9)13.2

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_undisputed_ruling
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • undisputed_ruling_1:28.94%

Spelldata

  • id:432629
  • name:Undisputed Ruling
  • tooltip:Haste increased by {$=}w1%
  • description:{$@spelldesc432626=Hammer of Light applies Judgment to its targets, and increases your Haste by {$432629s1=12}% for {$432629d=6 seconds}.{$?a137028=false}[ Additionally, Eye of Tyr grants {$s2=3} Holy Power.][]}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Crystallization

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
The Sushi Special

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_the_sushi_special
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:469.20

Spelldata

  • id:461957
  • name:Well Fed
  • tooltip:Mastery increased by {$=}w9.
  • description:Increases Mastery by {$s1=0} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
reset_aa_cast15.411.019.019.7s1.0s43.6s
Art of War33.115.057.08.9s1.1s107.1s
Divine Purpose11.11.030.024.5s0.8s299.4s
Empyrean Power7.60.020.034.3s1.1s320.3s
Uptime Avg % Min Max Avg Dur Min Max
Holy Power Cap18.99%9.71%28.66%1.2s0.0s11.4s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Searing Light23.5070.000340.186119.8920.142348.384
(blade_of_justice_) Consecration0.3720.00015.8098.2066.36526.114
(searing_light_) Consecration42.2090.000340.186219.29285.409348.384
Shield of Vengeance0.7410.0008.8495.7790.00034.547
Execution Sentence1.9130.00414.59819.9508.05741.544
Blade of Justice0.4920.00021.36833.0364.12073.270
Wake of Ashes2.0930.00013.45920.5298.81038.913
Divine Toll1.4390.00024.2338.4650.00043.052
Hammer of Wrath6.7130.00091.636140.98349.834243.435
Judgment1.3000.00016.23346.54121.45183.350

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Fugux
Blade of JusticeHoly Power66.7366.7123.52%1.000.020.03%
Crusading StrikesHoly Power75.9063.7922.49%0.8412.1215.96%
Hammer of WrathHoly Power20.5320.537.24%1.000.000.01%
JudgmentHoly Power58.45108.8738.38%1.868.026.86%
Wake of AshesHoly Power9.7923.788.38%2.435.5919.03%
Usage Type Count Total Tot% Avg RPE APR
Fugux
Final VerdictHoly Power88.22235.9484.03%2.672.67104,967.31
Hammer of LightHoly Power15.4644.8315.97%2.902.90306,603.09
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Holy Power0.00.950.9425.82.90.05.0

Statistics & Data Analysis

Fight Length
Fugux Fight Length
Count 9999
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fugux Damage Per Second
Count 9999
Mean 477240.56
Minimum 429856.44
Maximum 522196.65
Spread ( max - min ) 92340.22
Range [ ( max - min ) / 2 * 100% ] 9.67%
Standard Deviation 11494.0303
5th Percentile 458544.49
95th Percentile 496334.53
( 95th Percentile - 5th Percentile ) 37790.04
Mean Distribution
Standard Deviation 114.9461
95.00% Confidence Interval ( 477015.27 - 477465.85 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2229
0.1 Scale Factor Error with Delta=300 1127791
0.05 Scale Factor Error with Delta=300 4511162
0.01 Scale Factor Error with Delta=300 112779028
Priority Target DPS
Fugux Priority Target Damage Per Second
Count 9999
Mean 477240.56
Minimum 429856.44
Maximum 522196.65
Spread ( max - min ) 92340.22
Range [ ( max - min ) / 2 * 100% ] 9.67%
Standard Deviation 11494.0303
5th Percentile 458544.49
95th Percentile 496334.53
( 95th Percentile - 5th Percentile ) 37790.04
Mean Distribution
Standard Deviation 114.9461
95.00% Confidence Interval ( 477015.27 - 477465.85 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2229
0.1 Scale Factor Error with Delta=300 1127791
0.05 Scale Factor Error with Delta=300 4511162
0.01 Scale Factor Error with Delta=300 112779028
DPS(e)
Fugux Damage Per Second (Effective)
Count 9999
Mean 477240.56
Minimum 429856.44
Maximum 522196.65
Spread ( max - min ) 92340.22
Range [ ( max - min ) / 2 * 100% ] 9.67%
Damage
Fugux Damage
Count 9999
Mean 143143407.27
Minimum 109687110.79
Maximum 184298075.55
Spread ( max - min ) 74610964.76
Range [ ( max - min ) / 2 * 100% ] 26.06%
DTPS
Fugux Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Fugux Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Fugux Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fugux Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fugux Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 shield_of_vengeance
5 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
6 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
7 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_1_buffs&(trinket.1.cooldown.duration%%cooldown.crusade.duration=0|cooldown.crusade.duration%%trinket.1.cooldown.duration=0|trinket.1.cooldown.duration%%cooldown.avenging_wrath.duration=0|cooldown.avenging_wrath.duration%%trinket.1.cooldown.duration=0)
8 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=variable.trinket_2_buffs&(trinket.2.cooldown.duration%%cooldown.crusade.duration=0|cooldown.crusade.duration%%trinket.2.cooldown.duration=0|trinket.2.cooldown.duration%%cooldown.avenging_wrath.duration=0|cooldown.avenging_wrath.duration%%trinket.2.cooldown.duration=0)
9 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!variable.trinket_1_buffs&variable.trinket_2_buffs|variable.trinket_2_buffs&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 auto_attack
0.00 rebuke
B 0.00 call_action_list,name=cooldowns
C 0.00 call_action_list,name=generators
actions.cooldowns
# count action,conditions
D 1.48 potion,if=buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up|fight_remains<30
0.00 invoke_external_buff,name=power_infusion,if=buff.avenging_wrath.up|buff.crusade.up|debuff.execution_sentence.up
0.00 lights_judgment,if=spell_targets.lights_judgment>=2|!raid_event.adds.exists|raid_event.adds.in>75|raid_event.adds.up
0.00 fireblood,if=buff.avenging_wrath.up|buff.crusade.up&buff.crusade.stack=10|debuff.execution_sentence.up
E 2.91 use_item,slot=trinket1,if=((buff.avenging_wrath.up&cooldown.avenging_wrath.remains>40|buff.crusade.up&buff.crusade.stack=10)&!talent.radiant_glory|talent.radiant_glory&(!talent.execution_sentence&cooldown.wake_of_ashes.remains=0|debuff.execution_sentence.up))&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
F 2.64 use_item,slot=trinket2,if=((buff.avenging_wrath.up&cooldown.avenging_wrath.remains>40|buff.crusade.up&buff.crusade.stack=10)&!talent.radiant_glory|talent.radiant_glory&(!talent.execution_sentence&cooldown.wake_of_ashes.remains=0|debuff.execution_sentence.up))&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!buff.crusade.up&cooldown.crusade.remains>20|!buff.avenging_wrath.up&cooldown.avenging_wrath.remains>20)
0.00 use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!buff.crusade.up&cooldown.crusade.remains>20|!buff.avenging_wrath.up&cooldown.avenging_wrath.remains>20)
G 3.96 shield_of_vengeance,if=fight_remains>15&(!talent.execution_sentence|!debuff.execution_sentence.up)
H 9.57 execution_sentence,if=(!buff.crusade.up&cooldown.crusade.remains>15|buff.crusade.stack=10|cooldown.avenging_wrath.remains<0.75|cooldown.avenging_wrath.remains>15|talent.radiant_glory)&(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(target.time_to_die>8&!talent.executioners_will|target.time_to_die>12)&cooldown.wake_of_ashes.remains<gcd
0.00 avenging_wrath,if=(holy_power>=4&time<5|holy_power>=3&time>5|holy_power>=2&talent.divine_auxiliary&(cooldown.execution_sentence.remains=0|cooldown.final_reckoning.remains=0))&(!raid_event.adds.up|target.time_to_die>10)
0.00 crusade,if=holy_power>=5&time<5|holy_power>=3&time>5
0.00 final_reckoning,if=(holy_power>=4&time<8|holy_power>=3&time>=8|holy_power>=2&(talent.divine_auxiliary|talent.radiant_glory))&(cooldown.avenging_wrath.remains>10|cooldown.crusade.remains&(!buff.crusade.up|buff.crusade.stack>=10)|talent.radiant_glory&(buff.avenging_wrath.up|talent.crusade&cooldown.wake_of_ashes.remains<gcd))&(!raid_event.adds.exists|raid_event.adds.up|raid_event.adds.in>40)
actions.finishers
# count action,conditions
0.00 variable,name=ds_castable,value=(spell_targets.divine_storm>=2|buff.empyrean_power.up)&!buff.empyrean_legacy.up&!(buff.divine_arbiter.up&buff.divine_arbiter.stack>24)
I 15.46 hammer_of_light
0.00 divine_hammer,if=holy_power=5
J 7.38 divine_storm,if=variable.ds_castable&!buff.hammer_of_light_ready.up&(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
0.00 justicars_vengeance,if=(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
K 88.22 templars_verdict,if=(!talent.crusade|cooldown.crusade.remains>gcd*3|buff.crusade.up&buff.crusade.stack<10|talent.radiant_glory)&!buff.hammer_of_light_ready.up&(!buff.divine_hammer.up|cooldown.divine_hammer.remains>110&holy_power>=4)
actions.generators
# count action,conditions
L 0.00 call_action_list,name=finishers,if=holy_power=5|holy_power=4&buff.divine_resonance.up
0.00 templar_slash,if=buff.templar_strikes.remains<gcd*2
0.00 blade_of_justice,if=!dot.expurgation.ticking&talent.holy_flames
M 9.79 wake_of_ashes,if=(!talent.lights_guidance|holy_power>=2&talent.lights_guidance)&(cooldown.avenging_wrath.remains>6|cooldown.crusade.remains>6|talent.radiant_glory)&(!talent.execution_sentence|cooldown.execution_sentence.remains>4|target.time_to_die<8)&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)
N 5.83 divine_toll,if=holy_power<=2&(!raid_event.adds.exists|raid_event.adds.in>10|raid_event.adds.up)&(cooldown.avenging_wrath.remains>15|cooldown.crusade.remains>15|talent.radiant_glory|fight_remains<8)
O 0.00 call_action_list,name=finishers,if=holy_power>=3&buff.crusade.up&buff.crusade.stack<10
0.00 templar_slash,if=buff.templar_strikes.remains<gcd&spell_targets.divine_storm>=2
0.00 blade_of_justice,if=(holy_power<=3|!talent.holy_blade)&(spell_targets.divine_storm>=2&talent.blade_of_vengeance)
0.00 hammer_of_wrath,if=(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)&(target.health.pct<35&talent.vengeful_wrath|buff.blessing_of_anshe.up)
0.00 templar_strike
P 35.63 judgment,if=holy_power<=3|!talent.boundless_judgment
Q 66.73 blade_of_justice,if=holy_power<=3|!talent.holy_blade
R 20.53 hammer_of_wrath,if=(spell_targets.divine_storm<2|!talent.blessed_champion)&(holy_power<=3|target.health.pct>20|!talent.vanguards_momentum)
0.00 templar_slash
S 0.00 call_action_list,name=finishers,if=(target.health.pct<=20|buff.avenging_wrath.up|buff.crusade.up|buff.empyrean_power.up)
0.00 crusader_strike,if=cooldown.crusader_strike.charges_fractional>=1.75&(holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2)
T 0.00 call_action_list,name=finishers
0.00 hammer_of_wrath,if=holy_power<=3|target.health.pct>20|!talent.vanguards_momentum
0.00 crusader_strike
0.00 arcane_torrent

Sample Sequence

012456789ANHDEMIPKQJQKPKQKQQKPKRQJKJKPQQKKKQPQKHFMIQPKQQKQPRKIQRKPQKQKNKPQKQGHKMIPKQKQRKPQKRKQPQKQKRPKHMIQQIJKPQQKKRKKNPKQKKQQKPKGHEMIPQKQRKQPQKRKQPIKKQQPKHFMIQPKQNJKQKPKQKQQKPKRKQKRPGHKMIQPIKQKQRPKKQRKPQQKQKNHMIPKQKQRKPKKKQRKPIQKRKPQHEKMIPKGQQKRPKQKRKQPKNKQQFKPJKHKMIPKKQQIKPRKQQ

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre0flask
[precombat]
Fugux 0.0/5 0% HoPo
Pre1food
[precombat]
Fugux 0.0/5 0% HoPo
Pre2augmentation
[precombat]
Fugux 0.0/5 0% HoPo
Pre4shield_of_vengeance
[precombat]
Fugux 0.0/5 0% HoPo
Pre5trinket_1_buffs
[precombat]
Fugux 0.0/5 0% HoPo shield_of_vengeance
Pre6trinket_2_buffs
[precombat]
Fugux 0.0/5 0% HoPo shield_of_vengeance
Pre7trinket_1_sync
[precombat]
Fugux 0.0/5 0% HoPo shield_of_vengeance
Pre8trinket_2_sync
[precombat]
Fugux 0.0/5 0% HoPo shield_of_vengeance
Pre9trinket_priority
[precombat]
Fugux 0.0/5 0% HoPo shield_of_vengeance
0:00.000Aauto_attack
[default]
Fluffy_Pillow 0.0/5 0% HoPo shield_of_vengeance
0:00.000Ndivine_toll
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, shield_of_vengeance
0:00.990Hexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, shield_of_vengeance, divine_resonance, sanctification
0:01.744Dpotion
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, shield_of_vengeance, divine_resonance, sanctification
0:01.744Euse_item_imperfect_ascendancy_serum
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, shield_of_vengeance, divine_resonance, sanctification, tempered_potion
0:03.015Mwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, shield_of_vengeance, divine_resonance, sanctification, ascension, tempered_potion
0:03.965Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade, shield_of_vengeance, blessing_of_dawn, divine_resonance, hammer_of_light_ready, sanctification, sacrosanct_crusade, ascension, tempered_potion
0:04.887Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, crusade(6), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(3), sacrosanct_crusade, ascension, tempered_potion
0:05.641Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, crusade(6), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(5), sacrosanct_crusade, ascension, tempered_potion
0:06.397Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(9), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), sacrosanct_crusade, ascension, tempered_potion
0:07.152Jdivine_storm
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(9), empyrean_power, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), sacrosanct_crusade, ascension, tempered_potion
0:07.906Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(10), sacrosanct_crusade, ascension, tempered_potion
0:08.660Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, crusade(10), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(11), sacrosanct_crusade, ascension, tempered_potion
0:09.415Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(10), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(13), sacrosanct_crusade, ascension, tempered_potion
0:10.169Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade(10), blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(13), sacrosanct_crusade, ascension, tempered_potion
0:10.924Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(10), blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(16), sacrosanct_crusade, ascension, tempered_potion
0:11.679Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, crusade(10), blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(16), sacrosanct_crusade, ascension, tempered_potion
0:12.432Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(10), blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(19), sacrosanct_crusade, ascension, tempered_potion
0:13.188Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(19), sacrosanct_crusade, ascension, tempered_potion
0:14.138Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(19), ascension, tempered_potion
0:15.088Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(3), lights_deliverance(22), ascension, flask_of_alchemical_chaos_mastery, tempered_potion
0:16.087Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(4), lights_deliverance(22), ascension, flask_of_alchemical_chaos_mastery, tempered_potion
0:17.086Rhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(4), lights_deliverance(25), ascension, flask_of_alchemical_chaos_mastery, tempered_potion
0:18.086Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(25), ascension, flask_of_alchemical_chaos_mastery, tempered_potion
0:19.085Jdivine_storm
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, empyrean_power, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(4), lights_deliverance(26), ascension, flask_of_alchemical_chaos_mastery, tempered_potion
0:20.082Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(28), ascension, flask_of_alchemical_chaos_mastery, tempered_potion
0:21.050Jdivine_storm
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(4), empyrean_power, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(29), ascension, flask_of_alchemical_chaos_mastery, tempered_potion
0:21.943Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(7), blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(31), ascension, flask_of_alchemical_chaos_mastery, tempered_potion
0:22.767Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, crusade(10), blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(32), ascension, flask_of_alchemical_chaos_mastery, tempered_potion
0:23.535Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(10), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(32), flask_of_alchemical_chaos_mastery, tempered_potion
0:24.309Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(33), flask_of_alchemical_chaos_mastery, tempered_potion
0:25.315Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(33), flask_of_alchemical_chaos_mastery, tempered_potion
0:26.322Kfinal_verdict
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(36), flask_of_alchemical_chaos_mastery, tempered_potion
0:27.328Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(38), flask_of_alchemical_chaos_mastery, tempered_potion
0:28.333Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(41), flask_of_alchemical_chaos_mastery, tempered_potion
0:29.338Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(41), flask_of_alchemical_chaos_mastery, tempered_potion
0:30.342Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(42), flask_of_alchemical_chaos_mastery, tempered_potion
0:31.346Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(42), flask_of_alchemical_chaos_mastery, tempered_potion
0:32.352Hexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(45), flask_of_alchemical_chaos_mastery
0:33.106Fuse_item_quickwick_candlestick
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, blessing_of_dusk, sanctification, lights_deliverance(46), flask_of_alchemical_chaos_mastery
0:33.106Mwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, blessing_of_dusk, sanctification, lights_deliverance(46), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:34.083Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo bloodlust, crusade, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance(46), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:35.032Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo bloodlust, crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(49), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:35.816Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(51), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:36.570Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(52), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:37.324Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(9), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(54), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:38.079Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo bloodlust, crusade(9), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(54), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:38.833Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo bloodlust, crusade(9), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(55), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:39.588Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo bloodlust, crusade(10), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(57), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:40.342Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(58), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:41.450Rhammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(58), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:42.429Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dawn(2), blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(59), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:43.407Ihammer_of_light
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(2), lights_deliverance, sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:44.386Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(5), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
0:45.496Rhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(7), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
0:46.475Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(8), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
0:47.349Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(10), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
0:48.223Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(10), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
0:49.357Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(11), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
0:50.492Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(14), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
0:51.763Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(14), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
0:53.034 Waiting1.744s 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(17), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_vers
0:54.778Ndivine_toll
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(18), flask_of_alchemical_chaos_vers
0:56.279Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(2), lights_deliverance(18), flask_of_alchemical_chaos_vers
0:57.635Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification, lights_deliverance(21), flask_of_alchemical_chaos_vers
0:58.990Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(2), lights_deliverance(22), flask_of_alchemical_chaos_vers
1:00.346Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(23), flask_of_alchemical_chaos_vers
1:01.701Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(25), flask_of_alchemical_chaos_vers
1:03.052Gshield_of_vengeance
[cooldowns]
Fugux 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(26), flask_of_alchemical_chaos_vers
1:03.806Hexecution_sentence
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(26), flask_of_alchemical_chaos_vers
1:04.560Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(27), flask_of_alchemical_chaos_vers
1:05.914Mwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo shield_of_vengeance, blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(30), flask_of_alchemical_chaos_vers
1:07.269Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, divine_resonance, hammer_of_light_ready, sanctification(3), lights_deliverance(30), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:08.585Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(34), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:09.610Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(6), shield_of_vengeance, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(36), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:10.637Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(38), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:11.592Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(38), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:12.546Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(41), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:13.477Rhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(41), sacrosanct_crusade, flask_of_alchemical_chaos_vers
1:14.409Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(42), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:15.447Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(10), blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(44), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:16.485Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(45), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:17.725Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(46), flask_of_alchemical_chaos_mastery
1:18.764Rhammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(48), flask_of_alchemical_chaos_mastery
1:19.806Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(49), flask_of_alchemical_chaos_mastery
1:20.846 Waiting0.676s 0.0/5 0% HoPo crusade(10), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(51), flask_of_alchemical_chaos_mastery
1:21.522Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(51), flask_of_alchemical_chaos_mastery
1:22.873Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(52), flask_of_alchemical_chaos_mastery
1:24.223Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(53), flask_of_alchemical_chaos_mastery
1:25.572Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(53), flask_of_alchemical_chaos_mastery
1:26.922 Waiting1.547s 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(56), flask_of_alchemical_chaos_mastery
1:28.469Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, sanctification, lights_deliverance(57), flask_of_alchemical_chaos_mastery
1:29.818Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(57), flask_of_alchemical_chaos_mastery
1:31.167Rhammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, final_verdict, sanctification, lights_deliverance(58), flask_of_alchemical_chaos_mastery
1:32.517Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, sanctification, lights_deliverance(58), flask_of_alchemical_chaos_mastery
1:33.867Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, sanctification, lights_deliverance(58), flask_of_alchemical_chaos_mastery
1:35.216Hexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, sanctification, lights_deliverance(59), flask_of_alchemical_chaos_mastery
1:35.971Mwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, sanctification, lights_deliverance(59), flask_of_alchemical_chaos_mastery
1:37.320Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance(59), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:38.631Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(6), empyrean_power, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(3), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:39.652Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(6), empyrean_power, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(5), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:40.673Ihammer_of_light
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(6), empyrean_power, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(5), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:41.695Jdivine_storm
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(6), empyrean_power, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(9), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:42.717Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(9), blessing_of_dusk, undisputed_ruling, shake_the_heavens, lights_deliverance(13), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:43.667Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), divine_purpose, blessing_of_dusk, undisputed_ruling, shake_the_heavens, lights_deliverance(16), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
1:44.596Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), divine_purpose, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(16), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:45.482Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), divine_purpose, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(16), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:46.367Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), divine_purpose, blessing_of_dawn(2), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(17), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:47.253Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(19), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:48.243Rhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(20), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:49.234Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), divine_purpose, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(20), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:50.226Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(23), sacrosanct_crusade, flask_of_alchemical_chaos_haste
1:51.215Ndivine_toll
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(23), flask_of_alchemical_chaos_haste
1:52.502Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(2), lights_deliverance(24), flask_of_alchemical_chaos_haste
1:53.789Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(2), lights_deliverance(25), flask_of_alchemical_chaos_haste
1:55.076Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(2), lights_deliverance(27), flask_of_alchemical_chaos_haste
1:56.363Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(28), flask_of_alchemical_chaos_haste
1:57.648Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(31), flask_of_alchemical_chaos_haste
1:58.936Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(33), flask_of_alchemical_chaos_haste
2:00.224Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(34), flask_of_alchemical_chaos_haste
2:01.510Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(34), flask_of_alchemical_chaos_haste
2:02.796Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(2), lights_deliverance(37), flask_of_alchemical_chaos_haste
2:04.084Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(38), flask_of_alchemical_chaos_haste
2:05.370 Waiting0.492s 1.0/5 20% HoPo blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(39), flask_of_alchemical_chaos_haste
2:05.862Gshield_of_vengeance
[cooldowns]
Fugux 1.0/5 20% HoPo blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(39), flask_of_alchemical_chaos_haste
2:06.805Hexecution_sentence
[cooldowns]
Fluffy_Pillow 4.0/5 80% HoPo shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, sanctification(3), lights_deliverance(39), flask_of_alchemical_chaos_haste
2:07.559Euse_item_imperfect_ascendancy_serum
[cooldowns]
Fluffy_Pillow 4.0/5 80% HoPo shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, sanctification(3), lights_deliverance(39), flask_of_alchemical_chaos_haste
2:09.269Mwake_of_ashes
[generators]
Fluffy_Pillow 4.0/5 80% HoPo shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, sanctification(3), lights_deliverance(39), ascension, flask_of_alchemical_chaos_haste
2:10.546Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, hammer_of_light_ready, sanctification(3), lights_deliverance(39), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_haste
2:11.785Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(43), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_haste
2:12.753Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(6), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(44), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_haste
2:13.719Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(6), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(45), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_haste
2:14.686Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(47), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
2:15.633Rhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(48), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
2:16.579Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(48), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
2:17.524Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(51), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
2:18.559Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(51), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
2:19.595Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(52), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
2:20.631Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(52), ascension, flask_of_alchemical_chaos_crit
2:21.667Rhammer_of_wrath
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(2), lights_deliverance(55), ascension, flask_of_alchemical_chaos_crit
2:22.703Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(55), ascension, flask_of_alchemical_chaos_crit
2:23.737 Waiting0.944s 1.0/5 20% HoPo crusade(10), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(58), ascension, flask_of_alchemical_chaos_crit
2:24.681Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(58), ascension, flask_of_alchemical_chaos_crit
2:26.186Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(59), ascension, flask_of_alchemical_chaos_crit
2:27.530Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(2), ascension, flask_of_alchemical_chaos_crit
2:28.875Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(5), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
2:30.073Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(8), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:31.282 Waiting0.800s 0.0/5 0% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(11), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:32.082Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(11), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:33.292Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(12), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:34.504Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(12), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:35.858Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn(2), blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(13), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:37.214 Waiting1.352s 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(16), sacrosanct_crusade, flask_of_alchemical_chaos_crit
2:38.566Hexecution_sentence
[cooldowns]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(16), flask_of_alchemical_chaos_crit
2:39.321Fuse_item_quickwick_candlestick
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(17), flask_of_alchemical_chaos_crit
2:39.321Mwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(17), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_crit
2:40.592Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dusk, hammer_of_light_ready, shake_the_heavens, sanctification, lights_deliverance(17), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_crit
2:41.827Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(22), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_crit
2:42.790Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(6), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(23), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_crit
2:43.754Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(6), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(24), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_crit
2:44.716Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), empyrean_power, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(26), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:45.611Ndivine_toll
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), empyrean_power, blessing_of_dawn, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(27), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:46.655Jdivine_storm
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(9), empyrean_power, blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(27), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:47.550Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(2), lights_deliverance(30), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:48.530Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(2), lights_deliverance(30), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:49.509Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(2), lights_deliverance(31), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:50.487Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(2), lights_deliverance(33), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:51.466Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(34), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:52.444Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(36), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:53.424Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(37), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:54.402Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(39), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:55.670Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dawn, blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(40), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:56.942Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn(2), blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(41), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:58.212Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(43), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
2:59.481Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dusk, final_verdict, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(44), flask_of_alchemical_chaos_mastery
3:00.835Rhammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification(3), lights_deliverance(46), flask_of_alchemical_chaos_mastery
3:02.189Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(47), flask_of_alchemical_chaos_mastery
3:03.543Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(50), flask_of_alchemical_chaos_mastery
3:04.898Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(51), flask_of_alchemical_chaos_mastery
3:06.251 Waiting0.392s 1.0/5 20% HoPo crusade, blessing_of_dawn, blessing_of_dusk, sanctification(2), lights_deliverance(54), flask_of_alchemical_chaos_mastery
3:06.643Rhammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade, blessing_of_dawn, blessing_of_dusk, sanctification(2), lights_deliverance(54), flask_of_alchemical_chaos_mastery
3:08.171Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade, blessing_of_dawn, blessing_of_dusk, sanctification(2), lights_deliverance(54), flask_of_alchemical_chaos_mastery
3:09.487Gshield_of_vengeance
[cooldowns]
Fugux 5.0/5 100% HoPo crusade, blessing_of_dawn(2), blessing_of_dusk, sanctification(2), lights_deliverance(54), flask_of_alchemical_chaos_mastery
3:10.241Hexecution_sentence
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo shield_of_vengeance, blessing_of_dawn(2), blessing_of_dusk, sanctification(2), lights_deliverance(54), flask_of_alchemical_chaos_mastery
3:10.995Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo shield_of_vengeance, blessing_of_dawn(2), blessing_of_dusk, sanctification, lights_deliverance(54), flask_of_alchemical_chaos_mastery
3:12.349Mwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo shield_of_vengeance, blessing_of_dusk, sanctification, lights_deliverance(55), flask_of_alchemical_chaos_mastery
3:13.704Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, shield_of_vengeance, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance(55), sacrosanct_crusade, flask_of_alchemical_chaos_mastery
3:15.018Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(6), shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(59), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:16.043Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(6), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance, sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:17.254Ihammer_of_light
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(6), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance, sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:18.281Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(6), shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(5), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:19.309Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(9), shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(9), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:20.261Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(10), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:21.212Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(12), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:22.144Rhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(13), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:23.076Pjudgment
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(13), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:24.286Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:25.640Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(16), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:26.995Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(19), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:28.348Rhammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dawn, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(20), flask_of_alchemical_chaos_crit
3:29.701Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(20), flask_of_alchemical_chaos_crit
3:31.056 Waiting0.591s 0.0/5 0% HoPo crusade, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(23), flask_of_alchemical_chaos_crit
3:31.647Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(23), flask_of_alchemical_chaos_crit
3:33.184 Waiting0.513s 2.0/5 40% HoPo crusade, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(24), flask_of_alchemical_chaos_crit
3:33.697Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(24), flask_of_alchemical_chaos_crit
3:35.085Qblade_of_justice
[generators]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(25), flask_of_alchemical_chaos_crit
3:36.441Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn(2), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(26), flask_of_alchemical_chaos_crit
3:37.796Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(28), flask_of_alchemical_chaos_crit
3:39.150Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(29), flask_of_alchemical_chaos_crit
3:40.504Ndivine_toll
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(32), flask_of_alchemical_chaos_crit
3:41.858Hexecution_sentence
[cooldowns]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, sanctification(2), lights_deliverance(33), flask_of_alchemical_chaos_crit
3:42.612Mwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, sanctification, lights_deliverance(33), flask_of_alchemical_chaos_crit
3:43.966Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dawn, blessing_of_dusk, divine_resonance, hammer_of_light_ready, sanctification, lights_deliverance(33), sacrosanct_crusade, flask_of_alchemical_chaos_crit
3:45.281Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(37), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:46.306Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(6), blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(39), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:47.334Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(41), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:48.288Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), blessing_of_dawn, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(41), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:49.243Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(10), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(44), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:50.174Rhammer_of_wrath
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(44), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:51.106Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(45), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:52.148Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), divine_purpose, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(3), lights_deliverance(47), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:53.191Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo divine_purpose, blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(48), sacrosanct_crusade, flask_of_alchemical_chaos_vers
3:54.545Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dusk, divine_resonance, shake_the_heavens, sanctification(4), lights_deliverance(51), flask_of_alchemical_chaos_vers
3:55.899Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(53), flask_of_alchemical_chaos_vers
3:57.213Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(4), blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(56), flask_of_alchemical_chaos_vers
3:58.423Rhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(4), blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(57), flask_of_alchemical_chaos_vers
3:59.633Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(3), lights_deliverance(57), flask_of_alchemical_chaos_vers
4:00.988Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, hammer_of_light_free, shake_the_heavens, sanctification(2), flask_of_alchemical_chaos_vers
4:02.343Ihammer_of_light
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, hammer_of_light_free, sanctification(2), lights_deliverance, flask_of_alchemical_chaos_vers
4:03.698Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(5), sacrosanct_crusade, flask_of_alchemical_chaos_vers
4:04.908Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(7), sacrosanct_crusade, flask_of_alchemical_chaos_vers
4:06.118Rhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(9), sacrosanct_crusade, flask_of_alchemical_chaos_vers
4:07.328Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(10), sacrosanct_crusade, flask_of_alchemical_chaos_vers
4:08.538 Waiting0.493s 0.0/5 0% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(12), sacrosanct_crusade, flask_of_alchemical_chaos_vers
4:09.031Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(13), sacrosanct_crusade, flask_of_alchemical_chaos_vers
4:10.535Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(13), sacrosanct_crusade, flask_of_alchemical_chaos_vers
4:11.889Hexecution_sentence
[cooldowns]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(14), sacrosanct_crusade, flask_of_alchemical_chaos_vers
4:12.643Euse_item_imperfect_ascendancy_serum
[cooldowns]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(14), flask_of_alchemical_chaos_vers
4:14.444Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn(2), blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(15), ascension, flask_of_alchemical_chaos_crit
4:15.787Mwake_of_ashes
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(18), ascension, flask_of_alchemical_chaos_crit
4:17.132Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dusk, hammer_of_light_ready, sanctification, lights_deliverance(19), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
4:18.437Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(6), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(23), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
4:19.454Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(6), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(24), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
4:20.471Gshield_of_vengeance
[cooldowns]
Fugux 0.0/5 0% HoPo crusade(9), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(27), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
4:21.226Qblade_of_justice
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(9), shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(27), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
4:22.172Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(9), shield_of_vengeance, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(28), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
4:23.117Kfinal_verdict
[finishers]
Fluffy_Pillow 3.0/5 60% HoPo crusade(9), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification, lights_deliverance(28), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
4:24.062Rhammer_of_wrath
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, final_verdict, shake_the_heavens, sanctification, lights_deliverance(31), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
4:25.096Pjudgment
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(31), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
4:26.131Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(32), sacrosanct_crusade, ascension, flask_of_alchemical_chaos_crit
4:27.167Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo crusade(10), divine_purpose, shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(34), ascension, flask_of_alchemical_chaos_crit
4:28.224Kfinal_verdict
[finishers]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), divine_purpose, shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(35), ascension, flask_of_alchemical_chaos_crit
4:29.261Rhammer_of_wrath
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), shield_of_vengeance, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(37), ascension, flask_of_alchemical_chaos_crit
4:30.294Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), shield_of_vengeance, blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(38), ascension, flask_of_alchemical_chaos_crit
4:31.329Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(40), ascension, flask_of_alchemical_chaos_crit
4:32.672Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(41), ascension, flask_of_alchemical_chaos_crit
4:34.016Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, shake_the_heavens, sanctification(2), lights_deliverance(42), ascension, flask_of_alchemical_chaos_crit
4:35.359Ndivine_toll
[generators]
Fluffy_Pillow 2.0/5 40% HoPo blessing_of_dusk, shake_the_heavens, sanctification, lights_deliverance(44), flask_of_alchemical_chaos_crit
4:36.713Kfinal_verdict
[finishers]
Fluffy_Pillow 4.0/5 80% HoPo blessing_of_dusk, divine_resonance, sanctification(2), lights_deliverance(46), flask_of_alchemical_chaos_crit
4:38.069Qblade_of_justice
[generators]
Fluffy_Pillow 1.0/5 20% HoPo blessing_of_dusk, divine_resonance, sanctification(2), lights_deliverance(47), flask_of_alchemical_chaos_crit
4:39.424Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, sanctification(2), lights_deliverance(47), flask_of_alchemical_chaos_crit
4:40.776Fuse_item_quickwick_candlestick
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(47), flask_of_alchemical_chaos_crit
4:40.776Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo blessing_of_dawn, blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(47), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_crit
4:42.047Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo divine_purpose, blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(48), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_crit
4:43.317Jdivine_storm
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo empyrean_power, divine_purpose, blessing_of_dawn, blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(48), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_crit
4:44.588Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo divine_purpose, blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(49), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:45.858Hexecution_sentence
[cooldowns]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(50), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:46.611Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade, blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(50), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:47.846Mwake_of_ashes
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(4), blessing_of_dawn, blessing_of_dusk, divine_resonance, sanctification(3), lights_deliverance(51), quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:48.981Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(4), blessing_of_dawn, blessing_of_dusk, divine_resonance, hammer_of_light_ready, sanctification(3), lights_deliverance(51), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:50.115Pjudgment
[generators]
Fluffy_Pillow 0.0/5 0% HoPo crusade(10), divine_purpose, blessing_of_dusk, divine_resonance, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(55), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:50.988Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), divine_purpose, blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(56), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:51.863Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(4), lights_deliverance(59), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:52.736Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), divine_purpose, blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(59), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:53.608Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo crusade(10), divine_purpose, blessing_of_dusk, final_verdict, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(3), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:54.481Ihammer_of_light
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), divine_purpose, blessing_of_dawn, blessing_of_dusk, final_verdict, hammer_of_light_free, undisputed_ruling, shake_the_heavens, sanctification(3), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:55.355Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(4), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:56.229Pjudgment
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(2), lights_deliverance(8), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:57.103Rhammer_of_wrath
[generators]
Fluffy_Pillow 4.0/5 80% HoPo crusade(10), blessing_of_dusk, final_verdict, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(8), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:57.974Kfinal_verdict
[finishers]
Fluffy_Pillow 5.0/5 100% HoPo crusade(10), blessing_of_dawn, blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(9), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:58.848Qblade_of_justice
[generators]
Fluffy_Pillow 2.0/5 40% HoPo crusade(10), blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(11), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery
4:59.722Qblade_of_justice
[generators]
Fluffy_Pillow 3.0/5 60% HoPo blessing_of_dusk, undisputed_ruling, shake_the_heavens, sanctification(3), lights_deliverance(12), sacrosanct_crusade, quickwicks_quick_trick_wick_walk, flask_of_alchemical_chaos_mastery

Stats

Level Bonus (80) Race Bonus (dwarf) Raid-Buffed Unbuffed Gear Amount
Strength176472386543785417016 (15181)
Agility6176-2617461740
Stamina86452119508118579282449
Intellect17647-118175176460
Spirit00000
Health390162037158400
Holy Power550
Spell Power18175447440
Crit15.35%15.77%4737
Haste11.49%11.49%4755
Swing Speed56.09%56.09%4755
Versatility12.36%9.73%7586
Attack Power4107938323469
Mastery34.15%23.85%3966
Armor331563315633156
Run Speed70445
Leech0.43%0.43%437

Gear

Source Slot Average Item Level: 558.00
Local Head Monstrosity's Gaze
ilevel: 548, stats: { 3,726 Armor, +7,992 Sta, +514 Haste, +795 Vers, +1,625 StrInt }
Local Neck Gem-Studded Pendant of the Aurora (gemstudded_pendant)
ilevel: 567, stats: { +4,902 Sta, +1,466 Haste, +1,741 Vers }
Local Shoulders General's Pungent Mantle
ilevel: 525, stats: { 2,757 Armor, +4,930 Sta, +398 Crit, +516 Mastery, +984 StrInt }
Local Chest Sedimentary Breastplate of the Feverflare (sedimentary_breastplate)
ilevel: 567, stats: { 6,646 Armor, +8,715 Sta, +1,940 StrInt, +494 Haste, +890 Mastery }
Local Waist Flying Kobold's Seatbelt
ilevel: 554, stats: { 3,178 Armor, +6,160 Sta, +471 Haste, +528 Vers, +1,289 StrInt }
Local Legs Legplates of Broken Trust
ilevel: 554, stats: { 4,944 Armor, +8,213 Sta, +466 Crit, +866 Mastery, +1,719 StrInt }
Local Feet Sedimentary Sabatons of the Peerless (sedimentary_sabatons)
ilevel: 567, stats: { 4,153 Armor, +6,536 Sta, +1,455 StrInt, +445 RunSpeed, +297 Crit, +742 Mastery }
Local Wrists Sedimentary Armplates of the Peerless (sedimentary_armplates)
ilevel: 564, stats: { 2,969 Armor, +4,835 Sta, +1,061 StrInt, +221 Crit, +551 Mastery }
Local Hands Sedimentary Gauntlets of the Aurora (sedimentary_gauntlets)
ilevel: 584, stats: { 4,059 Armor, +8,186 Sta, +1,705 StrInt, +651 Haste, +489 Vers }
Local Finger1 Gem-Studded Ring of the Quickblade (gemstudded_ring)
ilevel: 567, stats: { +4,902 Sta, +1,283 Crit, +1,925 Vers }
Local Finger2 Gem-Studded Signet of the Quickblade (gemstudded_signet)
ilevel: 567, stats: { +4,902 Sta, +1,100 Crit, +2,108 Vers }
Local Trinket1 Imperfect Ascendancy Serum
ilevel: 561, stats: { +486 Haste, +872 StrAgiInt, +437 Leech }
item effects: { use: Ascension }
Local Trinket2 Quickwick Candlestick
ilevel: 564, stats: { +1,793 StrAgiInt }
item effects: { use: Quickwick's Quick Trick Wick Walk }
Local Back Drape of the Heritage Lord
ilevel: 525, stats: { 724 Armor, +3,697 Sta, +284 Haste, +401 Mastery, +738 StrAgiInt }
Local Main Hand Ancient Forged Polearm of the Fireflash (ancient_forged_polearm)
ilevel: 561, weapon: { 3,479 - 6,463, 3.6 }, stats: { +1,835 Str, +8,479 Sta, +972 Crit, +389 Haste }, temporary_enchant: Ironclaw Sharpened Weapon
Local Tabard Tabard of the Highmountain Tribe
ilevel: 40

Talents

Talent Tables

Profile

paladin="Fugux"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/fugux"
spec=retribution
level=80
race=dwarf
role=attack
position=back
talents=CYEAE74QAafj6bdTrgpLZS4VlDAAAwAAjJ22mZ2W2mZsZmZbxsNAAAAAAMbT0MDDMzYGzyYYMMmlZW2GGMYwyCbAAAIzMtNLz2MAgNA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=the_sushi_special
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3

head=monstrositys_gaze,id=221047,bonus_id=10385/10387/6652,drop_level=79
neck=gemstudded_pendant,id=224665,bonus_id=10286/6652/10395/10392/3405/1639
shoulders=generals_pungent_mantle,id=225535,bonus_id=11128,drop_level=76
back=drape_of_the_heritage_lord,id=225551,bonus_id=11128,drop_level=76
chest=sedimentary_breastplate,id=224690,bonus_id=10286/6652/1702/1639
tabard=tabard_of_the_highmountain_tribe,id=140576
wrists=sedimentary_armplates,id=224697,bonus_id=10287/6652/10877/1689/1636
hands=sedimentary_gauntlets,id=224692,bonus_id=10281/6652/1706/1656/10255
waist=flying_kobolds_seatbelt,id=223360,bonus_id=11061,drop_level=80
legs=legplates_of_broken_trust,id=221092,bonus_id=11338/10386/6652
feet=sedimentary_sabatons,id=224691,bonus_id=10286/42/1689/1639
finger1=gemstudded_ring,id=224662,bonus_id=10286/6652/10394/10393/1746/1639
finger2=gemstudded_signet,id=224661,bonus_id=10286/6652/10394/10393/1747/1639
trinket1=imperfect_ascendancy_serum,id=225654,bonus_id=10288/6652/41/1633
trinket2=quickwick_candlestick,id=225649,bonus_id=10287/6652/1636
main_hand=ancient_forged_polearm,id=224708,bonus_id=10288/6652/1690/1633

# Gear Summary
# gear_ilvl=558.33
# gear_strength=17016
# gear_stamina=82449
# gear_attack_power=469
# gear_crit_rating=4737
# gear_haste_rating=4755
# gear_mastery_rating=3966
# gear_versatility_rating=7586
# gear_leech_rating=437
# gear_speed_rating=445
# gear_armor=33156

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 39155495
Max Event Queue: 90
Sim Seconds: 3006918
CPU Seconds: 48.9061
Physical Seconds: 55.9172
Speed Up: 61484

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Fugux Fugux ascension_channel 455482 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.24sec 0 300.00sec
Fugux Fugux augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Fugux Fugux blade_of_justice 184575 11014312 36714 13.35 137901 289795 66.7 66.7 17.9% 0.0% 0.0% 0.0% 4.45sec 11014312 300.00sec
Fugux Fugux blade_of_justice_consecration 26573 0 0 0.00 0 0 22.1 0.0 0.0% 0.0% 0.0% 0.0% 13.62sec 0 300.00sec
Fugux Fugux blade_of_justice_consecration_tick ticks -81297 2139932 7133 0.00 5016 10533 0.0 0.0 17.7% 0.0% 0.0% 0.0% 0.00sec 2139932 300.00sec
Fugux Fugux divine_storm 53385 1570481 5235 1.47 177942 375271 7.4 7.4 17.7% 0.0% 0.0% 0.0% 35.48sec 1570481 300.00sec
Fugux Fugux divine_storm_tempest 224239 203860 680 1.47 23096 48511 7.4 7.4 17.9% 0.0% 0.0% 0.0% 35.48sec 203860 300.00sec
Fugux Fugux divine_toll 375576 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 56.27sec 0 300.00sec
Fugux Fugux divine_toll_judgment 20271 1381512 4605 1.17 199937 417151 5.8 5.8 17.0% 0.0% 0.0% 0.0% 56.27sec 1381512 300.00sec
Fugux Fugux divine_resonance_judgment 20271 2144573 7149 3.39 105333 222737 17.0 17.0 17.9% 0.0% 0.0% 0.0% 17.22sec 2144573 300.00sec
Fugux Fugux empyrean_hammer 431398 23140610 77135 75.33 51414 108187 376.7 376.7 17.6% 0.0% 0.0% 0.0% 0.79sec 23140610 300.00sec
Fugux Fugux execution_sentence 387113 10847708 36159 1.91 1133215 0 9.6 9.6 0.0% 0.0% 0.0% 0.0% 32.03sec 10847708 300.00sec
Fugux Fugux expurgation ticks -383346 9671196 32237 26.22 61717 130189 66.7 131.1 17.6% 0.0% 0.0% 0.0% 4.45sec 9671196 300.00sec
Fugux Fugux final_verdict 383328 24766473 82554 17.64 234876 493454 88.2 88.2 17.7% 0.0% 0.0% 0.0% 3.36sec 24766473 300.00sec
Fugux Fugux flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Fugux Fugux food 457302 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Fugux Fugux hammer_of_light 427453 13744830 45816 3.09 746633 1569196 15.5 15.4 17.4% 0.0% 0.0% 0.0% 19.68sec 13744830 300.00sec
Fugux Fugux hammer_of_wrath 24275 3082753 10276 4.10 125813 263805 20.5 20.5 17.7% 0.0% 0.0% 0.0% 14.21sec 3082753 300.00sec
Fugux Fugux highlords_judgment 383921 3375470 11251 5.75 98819 202704 28.8 28.8 17.8% 0.0% 0.0% 0.0% 10.18sec 3375470 300.00sec
Fugux Fugux judgment 20271 4577194 15257 7.12 107550 225920 35.6 35.6 17.7% 0.0% 0.0% 0.0% 8.40sec 4577194 300.00sec
Fugux Fugux melee 0 0 0 0.00 0 0 152.3 0.0 0.0% 0.0% 0.0% 0.0% 1.97sec 0 300.00sec
Fugux Fugux crusading_strike 408385 8231469 27438 30.46 45215 95004 152.3 152.3 17.7% 0.0% 0.0% 0.0% 1.97sec 8231469 300.00sec
Fugux Fugux seal_of_the_crusader 385723 3353136 11177 30.46 18421 38727 152.3 152.3 17.7% 0.0% 0.0% 0.0% 1.97sec 3353136 300.00sec
Fugux Fugux potion 431932 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.65sec 0 300.00sec
Fugux Fugux sacrosanct_crusade_heal 461885 0 0 0.00 0 0 15.5 0.0 0.0% 0.0% 0.0% 0.0% 19.68sec 0 300.00sec
Fugux Fugux searing_light 407478 855571 2852 0.84 169970 357003 4.2 4.2 17.8% 0.0% 0.0% 0.0% 61.45sec 855571 300.00sec
Fugux Fugux searing_light_consecration 26573 0 0 0.00 0 0 4.2 0.0 0.0% 0.0% 0.0% 0.0% 61.45sec 0 300.00sec
Fugux Fugux searing_light_consecration_tick ticks -81297 466009 1553 0.00 5231 10999 0.0 0.0 17.8% 0.0% 0.0% 0.0% 0.00sec 466009 300.00sec
Fugux Fugux shield_of_vengeance 184662 0 0 0.99 0 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 64.03sec 0 300.00sec
Fugux Fugux shield_of_vengeance_proc 184689 6611747 22039 0.99 1334004 0 5.0 5.0 0.0% 0.0% 0.0% 0.0% 63.96sec 6611747 300.00sec
Fugux Fugux touch_of_light_dmg 385354 773996 2580 4.65 27841 58408 23.3 23.3 17.7% 0.0% 0.0% 0.0% 12.60sec 773996 300.00sec
Fugux Fugux wake_of_ashes 255937 2987223 9957 1.96 254964 535185 9.8 9.8 17.9% 0.0% 0.0% 0.0% 32.00sec 2987223 300.00sec
Fugux Fugux truths_wake ticks -403695 4194917 13983 11.88 58995 124061 9.8 59.4 17.9% 0.0% 0.0% 0.0% 32.00sec 4194917 300.00sec
Fugux Fugux seething_flames_0 405345 1973890 6580 1.95 169207 355350 9.8 9.8 17.7% 0.0% 0.0% 0.0% 32.00sec 1973890 300.00sec
Fugux Fugux seething_flames_1 405350 2034544 6782 1.95 174387 367906 9.8 9.8 17.7% 0.0% 0.0% 0.0% 32.01sec 2034544 300.00sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

Resource Out In Waiting APM Active
Health467,675.10.00.00%0.0100.0%

Scale Factors for other metrics

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Execution Sentence9.60.032.0s32.0s8.0s25.54%0.00%0.0 (0.0)9.6

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_execution_sentence
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 44.6s
  • trigger_min/max:30.0s / 44.6s
  • trigger_pct:100.00%
  • duration_min/max:8.0s / 8.0s
  • uptime_min/max:23.01% / 27.95%

Stack Uptimes

  • execution_sentence_1:25.54%

Spelldata

  • id:343527
  • name:Execution Sentence
  • tooltip:Sentenced to suffer {$s2=20}% of the damage your abilities deal during its duration as Holy damage.
  • description:A hammer slowly falls from the sky upon the target, after {$d=8 seconds}, they suffer {$s2=20}% of the damage taken from your abilities as Holy damage during that time. {$?s406158=false} [|cFFFFFFFFGenerates {$406158s1=3} Holy Power.][]
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:100.00%
Judgment73.70.09.6s4.1s8.9s79.28%87.21%0.0 (0.0)0.0

Buff Details

  • buff initial source:Fugux
  • cooldown name:buff_judgment
  • max_stacks:20
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 41.1s
  • trigger_min/max:0.0s / 19.5s
  • trigger_pct:99.76%
  • duration_min/max:0.0s / 32.9s
  • uptime_min/max:68.54% / 89.82%

Stack Uptimes

  • judgment_1:24.46%
  • judgment_2:24.28%
  • judgment_3:12.49%
  • judgment_4:8.32%
  • judgment_5:5.46%
  • judgment_6:3.16%
  • judgment_7:0.99%
  • judgment_8:0.11%
  • judgment_9:0.00%
  • judgment_11:0.00%

Spelldata

  • id:197277
  • name:Judgment
  • tooltip:Taking {$=}w1% increased damage from {$@=}auracaster's next Holy Power ability.
  • description:{$@spelldesc20271=Judges the target, dealing {$s1=0} {$?s403664=true}[Holystrike][Holy] damage{$?s231663=true}[, and causing them to take {$197277s1=20}% increased damage from your next Holy Power ability.][.]{$?s315867=true}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]}
  • max_stacks:20
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 477240.56
Minimum 429856.44
Maximum 522196.65
Spread ( max - min ) 92340.22
Range [ ( max - min ) / 2 * 100% ] 9.67%
Standard Deviation 11494.0303
5th Percentile 458544.49
95th Percentile 496334.53
( 95th Percentile - 5th Percentile ) 37790.04
Mean Distribution
Standard Deviation 114.9461
95.00% Confidence Interval ( 477015.27 - 477465.85 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2229
0.1 Scale Factor Error with Delta=300 1127791
0.05 Scale Factor Error with Delta=300 4511162
0.01 Scale Factor Error with Delta=300 112779028
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health01688010500
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.