SimulationCraft 1120-01      berechnet von Metaux@Antonidas

for World of Warcraft 11.2.0.62801 Live (hotfix 2025-08-27/62801, git build 62ef600643)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Balance Druid aura does not increase Regrowth cost
Balance Druid (effect#6) base_value 0.00 47.00

Evoker

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-01-20 Ebon Might is 5%
Ebon Might (effect#1) base_value 5.00 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-06-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 30.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Monk

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-08-03 Manually revert TWW3-SPM-4p hotfixes (effect#2).
Monk Shado-Pan 11.2 Class Set 4pc (effect#2) base_value 120.00 150.00
2025-08-03 Manually revert TWW3-SPM-4p hotfixes (effect#1).
Monk Shado-Pan 11.2 Class Set 4pc (effect#1) base_value 100.00 50.00
2025-08-03 Manually revert TWW3-SPM-2p hotfixes (effect#3).
Monk Shado-Pan 11.2 Class Set 2pc (effect#3) base_value 100.00 70.00

Rogue

Tag Spell / Effect Field Hotfixed Value DBC Value
2025-07-29 Fatebound Lucky Coin Expiry
Fateful Ending (effect#2) base_value 15.00 10.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2024-09-06 Manually set Stormkeeper max stacks
Stormkeeper max_stack 3.00 0.00

Raid Summary

Raid Event List
0 heal,name=tank_heal,amount=1500000,cooldown=5.0,duration=0,player_if=role.tank

DPS Scale Factors (dps increase per unit stat)

Profile Str Sta Crit Haste Mastery Vers Wdps wowhead
Ácyd 14.99 -0.04 13.35 19.57 14.96 14.74 71.90 wowhead

Ácyd : 1,270,082 dps, 1,547,692 dtps, 1,317,911 hps (326,818 aps)

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,270,081.61,270,081.6839.2 / 0.066%166,829.8 / 13.1%105,322.0
HPS HPS(e) HPS Error HPS Range HPR
991,092.1991,092.1720.8 / 0.073%145,686.5 / 14.7%111,368.5
APS APS Error APS Range APR
326,818.52,448.8 / 0.749%99,575.5 / 30.5%111,368.5
DTPS DTPS Error DTPS Range
1,547,692.21,751.60 / 0.11%354,356 / 22.9%
Resource Out In Waiting APM Active
Runic Power8.99.00.00%61.3100.0%
Originhttps://worldofwarcraft.com/en-gb/character/antonidas/%C3%A1cyd
TalentCoPAclESCN5uIs3wGGVadXqL3xwgZYGzMGLzYmZmmZMjZGGDAAAAMzMzMzMzMbmZGDAAgZmZmBAAAMwAzY0YZDktBsBYmBbA
Set Bonus
Scale Factors for Ácyd Damage Per Second
Wdps Haste Str Mastery Vers Crit Sta
Scale Factors 71.90 19.57 14.99 14.96 14.74 13.35 -0.04
Normalized 4.80 1.31 1.00 1.00 0.98 0.89 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.55 0.52 0.52 0.52 0.52 0.52 0.51
Ranking
  • Wdps > Haste > Str ~= Mastery ~= Vers > Crit > Sta
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=14.99, Stamina=-0.04, CritRating=13.35, HasteRating=19.57, MasteryRating=14.96, Versatility=14.74, Dps=71.90 )

Scale Factors for other metrics

Scale Factors for Ácyd Priority Target Damage Per Second
Wdps Haste Str Mastery Vers Crit Sta
Scale Factors 71.90 19.57 14.99 14.96 14.74 13.35 -0.04
Normalized 4.80 1.31 1.00 1.00 0.98 0.89 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.55 0.52 0.52 0.52 0.52 0.52 0.51
Ranking
  • Wdps > Haste > Str ~= Mastery ~= Vers > Crit > Sta
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=14.99, Stamina=-0.04, CritRating=13.35, HasteRating=19.57, MasteryRating=14.96, Versatility=14.74, Dps=71.90 )
Scale Factors for Ácyd Damage Per Second (Effective)
Wdps Haste Str Mastery Vers Crit Sta
Scale Factors 71.90 19.57 14.99 14.96 14.74 13.35 -0.04
Normalized 4.80 1.31 1.00 1.00 0.98 0.89 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Wdps > Haste > Str > Mastery > Vers > Crit > Sta
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=14.99, Stamina=-0.04, CritRating=13.35, HasteRating=19.57, MasteryRating=14.96, Versatility=14.74, Dps=71.90 )
Scale Factors for Ácyd Healing Per Second
Mastery Str Sta Crit Vers Haste Wdps
Scale Factors -1.85 -0.79 1.36 1.38 4.11 4.83 6.23
Normalized 2.34 1.00 -1.73 -1.75 -5.21 -6.12 -7.90
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.45 0.44 0.44 0.45 0.45 0.45 0.45
Ranking
  • Mastery > Str > Sta ~= Crit > Vers > Haste > Wdps
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=0.79, Stamina=-1.36, CritRating=-1.38, HasteRating=-4.83, MasteryRating=1.85, Versatility=-4.11, Dps=-6.23 )
Scale Factors for Ácyd Healing Per Second (Effective)
Mastery Str Sta Crit Vers Haste Wdps
Scale Factors -1.85 -0.79 1.36 1.38 4.11 4.83 6.23
Normalized 2.34 1.00 -1.73 -1.75 -5.21 -6.12 -7.90
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Mastery > Str > Sta > Crit > Vers > Haste > Wdps
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=0.79, Stamina=-1.36, CritRating=-1.38, HasteRating=-4.83, MasteryRating=1.85, Versatility=-4.11, Dps=-6.23 )
Scale Factors for Ácyd Absorb Per Second
Crit Str Sta Wdps Vers Haste Mastery
Scale Factors -1.71 -0.39 0.04 0.58 1.89 3.92 18.52
Normalized 4.36 1.00 -0.10 -1.48 -4.83 -10.00 -47.26
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 1.43 1.47 1.48 1.53 1.50 1.46 1.63
Ranking
  • Crit ~= Str ~= Sta ~= Wdps ~= Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=0.39, Stamina=-0.04, CritRating=1.71, HasteRating=-3.92, MasteryRating=-18.52, Versatility=-1.89, Dps=-0.58 )
Scale Factors for Healing + Absorb per second
Str Crit Sta Vers Wdps Haste Mastery
Scale Factors -1.18 -0.33 1.40 6.00 6.81 8.74 16.67
Normalized 1.00 0.28 -1.19 -5.08 -5.77 -7.41 -14.12
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 1.54 1.50 1.54 1.56 1.60 1.53 1.69
Ranking
  • Str ~= Crit > Sta > Vers ~= Wdps > Haste > Mastery
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=1.18, Stamina=-1.40, CritRating=0.33, HasteRating=-8.74, MasteryRating=-16.67, Versatility=-6.00, Dps=-6.81 )
Scale Factors for Ácyd Damage Taken Per Second
Mastery Vers Crit Str Haste Wdps Sta
Scale Factors -16.67 -14.70 -9.89 -6.56 -5.28 -0.88 0.08
Normalized 2.54 2.24 1.51 1.00 0.81 0.13 -0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 1.07 1.07 1.08 1.07 1.08 1.08 1.08
Ranking
  • Mastery > Vers > Crit > Str > Haste > Wdps ~= Sta
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=6.56, Stamina=-0.08, CritRating=9.89, HasteRating=5.28, MasteryRating=16.67, Versatility=14.70, Dps=0.88 )
Scale Factors for Ácyd Damage Taken
Mastery Vers Crit Str Haste Wdps Sta
Scale Factors -4949.53 -4413.07 -2980.54 -1974.94 -1598.84 -287.54 9.00
Normalized 2.51 2.23 1.51 1.00 0.81 0.15 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Mastery > Vers > Crit > Str > Haste > Wdps > Sta
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=1974.94, Stamina=-9.00, CritRating=2980.54, HasteRating=1598.84, MasteryRating=4949.53, Versatility=4413.07, Dps=287.54 )
Scale Factors for Ácyd Healing Taken Per Second
Mastery Str Crit Sta Vers Haste Wdps
Scale Factors -3.09 -1.27 0.43 1.26 2.65 4.02 5.63
Normalized 2.44 1.00 -0.34 -0.99 -2.09 -3.17 -4.44
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Mastery > Str > Crit > Sta > Vers > Haste > Wdps
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=1.27, Stamina=-1.26, CritRating=-0.43, HasteRating=-4.02, MasteryRating=3.09, Versatility=-2.65, Dps=-5.63 )
Scale Factors for Ácyd Fight Length
Str Wdps Sta Haste Crit Mastery Vers
Scale Factors -0.00 -0.00 -0.00 -0.00 -0.00 -0.00 0.00
Normalized 1.00 1.00 0.66 0.66 0.65 0.33 -0.01
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.00 0.00 0.00 0.00 0.00 0.00 0.00
Ranking
  • Str > Wdps > Sta > Haste > Crit > Mastery > Vers
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=0.00, Stamina=0.00, CritRating=0.00, HasteRating=0.00, MasteryRating=0.00, Versatility=-0.00, Dps=0.00 )
Scale Factors for Raid Damage Per Second
Wdps Haste Str Mastery Vers Crit Sta
Scale Factors 71.90 19.57 14.99 14.96 14.74 13.35 -0.04
Normalized 4.80 1.31 1.00 1.00 0.98 0.89 -0.00
Scale Deltas 2310 2310 2310 2310 2310 2310 2310
Error 0.55 0.52 0.52 0.52 0.52 0.52 0.51
Ranking
  • Wdps > Haste > Str ~= Mastery ~= Vers > Crit > Sta
Pawn string ( Pawn: v1: "Ácyd-Blood": Class=Deathknight, Spec=Blood, Strength=14.99, Stamina=-0.04, CritRating=13.35, HasteRating=19.57, MasteryRating=14.96, Versatility=14.74, Dps=71.90 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Ácyd1,270,082
auto_attack_mh 53,8504.2%178.22.00s90,66344,747Direct178.270,171140,42990,66329.2%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage178.16178.160.000.000.002.02610.000016,152,649.1923,075,190.0530.00%44,747.1644,747.16
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.83%126.197718070,171.1650,140104,55770,146.8564,57375,8638,854,96912,649,94330.00%
crit29.17%51.972288140,428.99100,280209,114140,525.01126,441157,5297,297,68010,425,24730.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Blood Boil 19,0631.5%18.616.32s307,684300,626Direct18.6239,039477,617307,68728.8%

Stats Details: Blood Boil

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage18.5718.570.000.000.001.02350.00005,714,903.335,714,903.330.00%300,626.16300,626.16
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.23%13.23326239,038.99166,400364,262239,126.89204,088284,0623,162,2893,162,2890.00%
crit28.77%5.34016477,617.49332,799716,404476,368.570623,7952,552,6142,552,6140.00%

Action Details: Blood Boil

  • id:50842
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:50842
  • name:Blood Boil
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage$?s212744[ to all enemies within {$=}A1 yds.][ and infects all enemies within {$=}A1 yds with Blood Plague. {$@=}spellicon55078 |cFFFFFFFF{$@=}spellname55078|r {$@spelldesc55078=A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}. }]

Action Priority List

    san_drw
    [F]:6.33
  • if_expr:!drw.bp_ticking
    san_drw
    [K]:0.05
    sanlayn
    [M]:6.13
  • if_expr:dot.blood_plague.remains<3
    sanlayn
    [b]:6.07

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown Duration (Category)Death Knight1370053SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Brittle37455716.0%
Blood Draw 5,7420.4%3.0120.02s575,9880Direct3.0443,351883,080575,96530.2%

Stats Details: Blood Draw

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.962.960.000.000.000.00000.00001,704,805.951,704,805.950.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.83%2.0703443,350.99323,807656,378429,862.930648,606916,319916,3190.00%
crit30.17%0.8903883,080.29647,6131,347,276574,663.4901,293,053788,487788,4870.00%

Action Details: Blood Draw

  • id:374606
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:374606
  • name:Blood Draw
  • school:shadow
  • tooltip:
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies, the damage you take is reduced by {$454871s1=10}% and your Death Strike cost is reduced by {$=}{{$454871s2=100}/-10} for {$454871d=8 seconds}. Can only occur every {$374609d=120 seconds}.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Brittle37455716.0%
Blood Plague 48,0323.8%27.511.03s523,6130Periodic118.194,804189,111122,09028.9%94.6%

Stats Details: Blood Plague

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage27.540.00118.12118.1220.470.00002.402614,421,227.8914,421,227.890.00%50,815.290.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.07%83.955111994,803.8432,376146,05494,745.0086,236103,7107,958,6157,958,6150.00%
crit28.93%34.171162189,110.7664,752292,107189,178.35157,363213,6716,462,6136,462,6130.00%

Action Details: Blood Plague

  • id:55078
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.097042
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:2.40
  • base_multiplier:1.00
  • dot_duration:24.00
  • base_tick_time:2.55
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining {$=}w1 health from the target every {$t1=3} sec.
  • description:A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%
Spell Periodic AmountBlood Death Knight13700815PCT15.0%
Spell Tick TimeRapid Decomposition1946621PCT-15.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Coagulopathy391481125.0%Spell Data
Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Percent Tick Time Consumption2741565-30.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Brittle37455716.0%
Bonestorm 0 (25,246)0.0% (2.0%)5.560.36s1,386,9851,300,411

Stats Details: Bonestorm

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.450.0010.860.000.001.06661.00000.000.000.00%453,720.441,300,410.50

Action Details: Bonestorm

  • id:194844
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:2.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:194844
  • name:Bonestorm
  • school:shadow
  • tooltip:Dealing {$196528s1=0} Shadow damage to nearby enemies every {$t3=1} sec, and healing for {$196545s1=2}% of maximum health for each target hit (up to {$=}{{$s1=2}*{$s4=5}}%).
  • description:Consume up to {$s4=5} Bone Shield charges to create a whirl of bone and gore that batters all nearby enemies, dealing {$196528s1=0} Shadow damage every {$t3=1} sec, and healing you for {$196545s1=2}% of your maximum health every time it deals damage (up to {$=}{{$s1=2}*{$s4=5}}%). Deals reduced damage beyond {$196528s2=8} targets. Lasts {$d=2 seconds} per Bone Shield charge spent and rapidly regenerates a Bone Shield every {$t3=1} sec.

Action Priority List

    san_drw
    [D]:1.19
  • if_expr:buff.bone_shield.stack>=5
    sanlayn
    [O]:4.26
  • if_expr:buff.bone_shield.stack>=5&(buff.death_and_decay.remains|active_enemies<=3)
    Bonestorm (_damage) 25,2462.0%53.65.25s141,1000Direct53.6107,898215,520141,10330.9%

Stats Details: Bonestorm Damage

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage53.6253.620.000.000.000.00000.00007,565,788.317,565,788.310.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.15%37.081854107,897.7072,600164,320107,806.6890,574128,0704,000,4864,000,4860.00%
crit30.85%16.54334215,519.72145,199328,640215,585.95173,337263,5973,565,3023,565,3020.00%

Action Details: Bonestorm Damage

  • id:196528
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:196528
  • name:Bonestorm
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194844=Consume up to {$s4=5} Bone Shield charges to create a whirl of bone and gore that batters all nearby enemies, dealing {$196528s1=0} Shadow damage every {$t3=1} sec, and healing you for {$196545s1=2}% of your maximum health every time it deals damage (up to {$=}{{$s1=2}*{$s4=5}}%). Deals reduced damage beyond {$196528s2=8} targets. Lasts {$d=2 seconds} per Bone Shield charge spent and rapidly regenerates a Bone Shield every {$t3=1} sec.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Brittle37455716.0%
Consumption 7,2630.6%7.739.53s283,970266,637Direct7.7220,553441,332283,94928.7%

Stats Details: Consumption

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage7.687.680.000.000.001.06510.00002,180,826.433,115,463.2230.00%266,637.29266,637.29
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.28%5.47010220,553.05144,185388,507220,409.260299,3141,207,3241,724,74729.99%
crit28.72%2.2107441,332.04284,366777,014405,086.150734,878973,5021,390,71627.48%

Action Details: Consumption

  • id:274156
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:274156
  • name:Consumption
  • school:physical
  • tooltip:Your Blood Plague deals damage {$=}w5% more often.
  • description:Strikes all enemies in front of you with a hungering attack that deals $sw1 Physical damage and heals you for {$=}{{$=}e1*100}% of that damage. Deals reduced damage beyond {$s3=8} targets. Causes your Blood Plague damage to occur {$s5=30}% more quickly for {$d=6 seconds}. |cFFFFFFFFGenerates {$s4=2} Runes.|r

Action Priority List

    san_drw
    [J]:0.51
    sanlayn
    [Q]:3.55
  • if_expr:buff.infliction_of_sorrow.up&buff.death_and_decay.up
    sanlayn
    [a]:3.62

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Brittle37455716.0%
Dancing Rune Weapon 0 (249,290)0.0% (19.6%)6.352.30s11,779,38910,891,704

Stats Details: Dancing Rune Weapon

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.350.000.000.000.001.08160.00000.000.000.00%10,891,703.9010,891,703.90

Action Details: Dancing Rune Weapon

  • id:49028
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:49028
  • name:Dancing Rune Weapon
  • school:physical
  • tooltip:
  • description:Summons a rune weapon for {$81256d=8 seconds} that mirrors your melee attacks and bolsters your defenses. While active, you gain {$81256s1=35}% parry chance.

Action Priority List

    high_prio_actions
    [B]:6.35
    auto_attack_mh 41,586 / 12,1041.0%71.24.36s50,94122,541Direct71.239,45878,84150,94029.2%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage71.2471.240.000.000.002.25990.00003,629,175.695,184,531.5230.00%22,541.0422,541.04
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.84%50.47267439,457.6729,61155,14839,432.0235,22944,0781,991,2922,844,70030.00%
crit29.16%20.7764078,841.0459,222106,19978,866.3469,60988,8701,637,8832,339,83130.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Blood Plague 100,702 / 29,2862.3%12.850.17s688,8750Periodic131.951,756102,97666,64629.1%98.2%

Stats Details: Blood Plague

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage12.760.00131.92131.920.110.00002.23418,791,887.128,791,887.120.00%29,831.930.00
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit70.93%93.575413751,756.362282,23651,687.9542,81359,2934,842,6474,842,6470.00%
crit29.07%38.351177102,975.64761164,472102,916.8977,146124,0323,949,2403,949,2400.00%

Action Details: Blood Plague

  • id:55078
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.097042
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:2.40
  • base_multiplier:1.00
  • dot_duration:24.00
  • base_tick_time:2.55
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining {$=}w1 health from the target every {$t1=3} sec.
  • description:A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%
Spell Periodic AmountBlood Death Knight13700815PCT15.0%
Spell Tick TimeRapid Decomposition1946621PCT-15.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Percent Tick Time Consumption2741565-30.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
    Blood Boil 25,103 / 7,3060.6%12.850.17s171,3780Direct12.8132,466265,321171,36829.3%

Stats Details: Blood Boil

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage12.7612.760.000.000.000.00000.00002,187,239.042,187,239.040.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.71%9.02117132,466.1897,620198,095132,362.2497,964167,7591,195,4151,195,4150.00%
crit29.29%3.74011265,321.02195,240396,190261,677.940366,809991,824991,8240.00%

Action Details: Blood Boil

  • id:50842
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:50842
  • name:Blood Boil
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage$?s212744[ to all enemies within {$=}A1 yds.][ and infects all enemies within {$=}A1 yds with Blood Plague. {$@=}spellicon55078 |cFFFFFFFF{$@=}spellname55078|r {$@spelldesc55078=A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}. }]

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Cooldown Duration (Category)Death Knight1370053SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
    Death Strike 351,370 / 102,2858.1%45.812.27s669,4760Direct45.8518,3551,035,252669,49229.2%

Stats Details: Death Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage45.8245.820.000.000.000.00000.000030,673,659.3743,819,469.5730.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.76%32.421454518,355.38168,197974,850517,978.05420,350625,64516,804,66124,006,63530.00%
crit29.24%13.402281,035,251.58336,3951,913,7601,035,516.55750,3261,312,42213,868,99819,812,83530.00%

Action Details: Death Strike

  • id:49998
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:45
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49998
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of {$=}{{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$=}{{$s2=25}}.2% of all damage taken in the last {$s4=5} sec, minimum {$=}{{$s3=7}}.1% of maximum health.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%
Spell Direct AmountBlood Death Knight1370083PCT139.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Heartrend377656220.0%Spell Data
Hemostasis27394718.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Essence of the Blood Queen43392525.0%Spell DataValue-function
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Flat Cost Ossuary2197881-5Spell Data
Damage on Debuff Blood Plague5507845.0%
    Consumption 1,808 / 5260.0%1.0127.33s154,2980Direct1.0119,994240,047154,28728.6%

Stats Details: Consumption

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.021.020.000.000.000.00000.0000158,109.86225,871.0030.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.42%0.7307119,994.3388,817170,53147,123.770170,53187,820125,45811.78%
crit28.58%0.2906240,047.17177,635321,52854,372.360321,52870,289100,4136.80%

Action Details: Consumption

  • id:274156
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:rune
  • energize_amount:2.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:274156
  • name:Consumption
  • school:physical
  • tooltip:Your Blood Plague deals damage {$=}w5% more often.
  • description:Strikes all enemies in front of you with a hungering attack that deals $sw1 Physical damage and heals you for {$=}{{$=}e1*100}% of that damage. Deals reduced damage beyond {$s3=8} targets. Causes your Blood Plague damage to occur {$s5=30}% more quickly for {$d=6 seconds}. |cFFFFFFFFGenerates {$s4=2} Runes.|r

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
    Vampiric Strike 335,949 / 97,7837.7%101.85.55s287,8980Direct101.8222,811445,038287,91029.3%

Stats Details: Vampiric Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage101.84101.840.000.000.000.00000.000029,320,584.4729,320,584.470.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.71%72.0136105222,810.79148,150348,255222,692.10189,630260,18416,044,38716,044,3870.00%
crit29.29%29.831059445,037.98296,300670,641445,189.68371,227522,53013,276,19813,276,1980.00%

Action Details: Vampiric Strike

  • id:433895
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:10
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:433895
  • name:Vampiric Strike
  • school:shadow
  • tooltip:
  • description:A vampiric strike that deals {$?a137007=false}[{$s1=0}][{$s5=0}] Shadow damage and heals you for {$?a137007=false}[{$434422s2=1}][{$434422s3=2}]% of your maximum health. Additionally grants you Essence of the Blood Queen for {$433925d=20 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%
Spell TargetsBlood Death Knight13700816ADD1.000
Spell Direct AmountImproved Heart Strike3747171PCT30.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
Death and Decay 17,7221.4%17.517.15s303,081292,046Periodic189.821,73043,44528,02329.0%0.0%

Stats Details: Death And Decay

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage17.550.000.00189.780.001.03780.00005,318,450.685,318,450.680.00%292,046.05292,046.05
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit71.02%134.786720621,729.5515,90531,06421,722.8719,95423,4962,928,6442,928,6440.00%
crit28.98%55.01229843,445.3531,81162,12843,473.6139,86849,4692,389,8072,389,8070.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:0.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$52212m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][]

Action Details: Death And Decay Damage

  • id:52212
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:52212
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the ground targeted by the Death Knight, causing Shadow damage every sec that targets remain in the area for {$43265d=10 seconds}.

Action Priority List

    san_drw
    [G]:5.45
  • if_expr:(active_enemies<=3&buff.crimson_scourge.remains)|(active_enemies>3&!buff.death_and_decay.remains)
    sanlayn
    [W]:12.09
  • if_expr:(active_enemies<=3&buff.crimson_scourge.remains)|(active_enemies>3&!buff.death_and_decay.remains)

Affected By (Passive)

Type Spell ID # +/% Value
Modify Recharge Time% (Category)Blood Death Knight1370085SET-0.500
Modify Cooldown Charge (Category)Death's Echo3563671SET1.000
Spell Tick TimeRapid Decomposition1946621PCT-15.0%
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%
Spell Direct AmountBlood Death Knight13700814PCT48.2%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Percent Cost Crimson Scourge811411-100.0%Spell Data
Damage on Debuff Blood Plague5507845.0%DISABLED
War32709614.8%DISABLED
Brittle37455716.0%DISABLED
Death Strike 281,65922.2%86.73.37s974,345943,829Direct86.7755,2231,511,666974,31429.0%

Stats Details: Death Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage86.7286.720.000.000.001.03230.000084,500,077.85120,714,276.2230.00%943,829.13943,829.13
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.03%61.603690755,222.72305,2201,978,083754,863.74665,812863,42446,523,50266,462,07930.00%
crit28.97%25.127481,511,666.32610,4394,171,6951,512,250.171,138,1611,955,69237,976,57654,252,19730.00%

Action Details: Death Strike

  • id:49998
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:45
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49998
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of {$=}{{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$=}{{$s2=25}}.2% of all damage taken in the last {$s4=5} sec, minimum {$=}{{$s3=7}}.1% of maximum health.

Action Priority List

    high_prio_actions
    [A]:0.26
  • if_expr:buff.coagulopathy.up&buff.coagulopathy.remains<=gcd
    san_drw
    [E]:16.27
  • if_expr:runic_power.deficit<36
    san_drw
    [I]:6.38
    sanlayn
    [P]:4.12
  • if_expr:runic_power.deficit<20
    sanlayn
    [Y]:59.70

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%
Spell Direct AmountBlood Death Knight1370083PCT139.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Heartrend377656220.0%Spell Data
Hemostasis27394718.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Essence of the Blood Queen43392525.0%Spell DataValue-function
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Flat Cost Blood Draw4548712-10Spell Data
Ossuary2197881-5Spell Data
Luck of the Draw!12186015-10Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Brittle37455716.0%
Death's Caress 2,6920.2%8.037.30s101,10695,160Direct9.069,810140,93989,97528.3%

Stats Details: Deaths Caress

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage7.988.970.000.000.001.06260.0000806,858.57806,858.570.00%95,159.6495,159.64
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.65%6.4311269,810.0248,872110,61569,694.1850,183102,806448,596448,5960.00%
crit28.35%2.54011140,939.3397,743220,929132,878.420220,929358,263358,2630.00%

Action Details: Deaths Caress

  • id:195292
  • school:shadow
  • range:30.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:195292
  • name:Death's Caress
  • school:shadow
  • tooltip:
  • description:Reach out with necrotic tendrils, dealing {$s1=0} Shadow damage and applying Blood Plague to your target and generating {$s3=2} Bone Shield charges. {$@=}spellicon55078 |cFFFFFFFF{$@=}spellname55078|r {$@spelldesc55078=A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}. }

Action Priority List

    sanlayn
    [L]:3.40
  • if_expr:!buff.bone_shield.up|buff.bone_shield.remains<1.5|buff.bone_shield.stack<=1
    sanlayn
    [T]:4.58
  • if_expr:buff.bone_shield.stack<6&!dot.bonestorm.ticking

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Brittle37455716.0%
Heart Strike 42,679 (371,991)3.4% (29.3%)123.12.40s906,731890,547Direct48.2 (329.7)206,093412,048265,60228.9% (28.6%)

Stats Details: Heart Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage123.0948.230.000.000.001.01820.000012,811,155.4518,301,632.3430.00%890,547.38890,547.38
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.10%34.291557206,092.69129,429366,185206,108.79174,203242,4077,067,87010,096,94630.00%
crit28.90%13.94231412,048.37271,802732,369412,377.81340,054531,0005,743,2868,204,68630.00%

Action Details: Heart Strike

  • id:206930
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:15.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:206930
  • name:Heart Strike
  • school:physical
  • tooltip:Movement speed reduced by {$s5=20}%.
  • description:Instantly strike the target and 1 other nearby enemy, causing {$s2=0} Physical damage, and reducing enemies' movement speed by {$s5=20}% for {$d=8 seconds}{$?s316575=true}[ |cFFFFFFFFGenerates {$s3=5} bonus Runic Power][]{$?s221536=true}[, plus {$=}{{$210738s1=20}/10} Runic Power per additional enemy struck][].|r

Action Priority List

    san_drw
    [C]:0.08
  • if_expr:buff.essence_of_the_blood_queen.remains<1.5&buff.essence_of_the_blood_queen.remains
    san_drw
    [H]:50.83
    sanlayn
    [N]:0.12
  • if_expr:(buff.essence_of_the_blood_queen.remains<1.5&buff.essence_of_the_blood_queen.remains&buff.vampiric_strike.remains)
    sanlayn
    [R]:24.51
  • if_expr:(buff.infliction_of_sorrow.up|buff.vampiric_strike.up)&buff.death_and_decay.up
    sanlayn
    [X]:4.49
  • if_expr:buff.vampiric_strike.up
    sanlayn
    [Z]:42.78
  • if_expr:rune>=2
    sanlayn
    [c]:0.28

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%
Spell Direct AmountImproved Heart Strike3747171PCT30.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Brittle37455716.0%
    Vampiric Strike 141,598 (329,312)11.1% (25.9%)74.93.93s1,319,8080Direct74.9 (281.5)439,437878,434567,39429.1% (28.6%)

Stats Details: Vampiric Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage74.8674.860.000.000.000.00000.000042,473,792.2942,473,792.290.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.85%53.042983439,437.20282,256657,309439,167.95384,073487,67223,307,90323,307,9030.00%
crit29.15%21.82642878,433.61564,5131,314,618878,631.73733,8161,024,56819,165,88919,165,8890.00%

Action Details: Vampiric Strike

  • id:433895
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:15.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:433895
  • name:Vampiric Strike
  • school:shadow
  • tooltip:
  • description:A vampiric strike that deals {$?a137007=false}[{$s1=0}][{$s5=0}] Shadow damage and heals you for {$?a137007=false}[{$434422s2=1}][{$434422s3=2}]% of your maximum health. Additionally grants you Essence of the Blood Queen for {$433925d=20 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%
Spell TargetsBlood Death Knight13700816ADD1.000
Spell Direct AmountImproved Heart Strike3747171PCT30.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Brittle37455716.0%
Incite Terror45847843.0%
        Infliction of Sorrow 144,09311.4%80.93.66s534,2460Direct80.9415,557823,084534,23829.1%

Stats Details: Infliction Of Sorrow

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage80.9580.950.000.000.000.00000.000043,244,575.3843,244,575.380.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.88%57.373386415,557.3910,9784,821,498415,707.41222,717593,88623,840,55723,840,5570.00%
crit29.12%23.57647823,084.3131,8849,299,924823,621.35349,6121,893,66319,404,01819,404,0180.00%

Action Details: Infliction Of Sorrow

  • id:434144
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:148181.21
  • base_dd_max:148181.21
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:434144
  • name:Infliction of Sorrow
  • school:shadow
  • tooltip:
  • description:{$@spelldesc434143=When Vampiric Strike damages an enemy affected by your {$?a137008=true}[Blood Plague][Virulent Plague], it extends the duration of the disease by {$s3=3} sec, and deals {$s2=10}% of the remaining damage to the enemy. After Gift of the San'layn ends, {$?s356367=true}[you gain a charge of][the cooldown of your] {$?s152280=false}[Defile][Death and Decay]{$?s356367=true}[][ is reset], and your next {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] consumes the disease to deal {$s1=100}% of their remaining damage to the target.}
        The Blood is Life 13,9971.1%6.250.70s680,2640Direct6.2680,2410680,2410.0%

Stats Details: The Blood Is Life

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.186.180.000.000.000.00000.00004,203,770.914,203,770.910.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%6.1858680,241.25366,1061,300,613678,855.86546,579826,7214,203,7714,203,7710.00%

Action Details: The Blood Is Life

  • id:434246
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:589026.59
  • base_dd_max:589026.59
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:434246
  • name:The Blood is Life
  • school:shadow
  • tooltip:
  • description:{$@spelldesc434260={$?a137008=true}[Dancing Rune Weapon]?s275699[Apocalypse][Dark Transformation] summons a Blood Beast to attack your enemy for {$434237d=10 seconds}. Each time the Blood Beast attacks, it stores a portion of the damage dealt. When the Blood Beast dies, it explodes, dealing {$?a137007=false}[{$s2=15}][{$s1=25}]% of the damage accumulated to nearby enemies and healing the Death Knight for the same amount. Deals reduced damage beyond {$s3=8} targets.}
        auto_attack_mh 36,133 / 7,5540.6%94.42.95s23,97237,411Direct94.418,55937,05323,97229.3%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage94.4594.450.000.000.000.64080.00002,264,081.613,234,399.0730.00%37,411.0937,411.09
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.73%66.80389418,558.7314,12426,30618,546.7016,61020,8011,239,6781,770,96730.00%
crit29.27%27.6595137,053.2127,55650,65637,062.0831,39441,7911,024,4031,463,43230.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
        Corrupted Blood 105,572 / 22,0691.7%25.112.01s263,687263,697Direct25.1204,065407,421263,69029.3%

Stats Details: Corrupted Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage25.0825.080.000.000.001.00000.00006,614,037.456,614,037.450.00%263,696.57263,696.57
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.68%17.73627204,065.10155,873279,513203,928.55175,610227,4653,617,6043,617,6040.00%
crit29.32%7.35020407,420.88311,746559,026407,336.800527,3832,996,4332,996,4330.00%

Action Details: Corrupted Blood

  • id:434574
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:434574
  • name:Corrupted Blood
  • school:shadow
  • tooltip:
  • description:Blood Beast cleaves enemies around it for {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:25.09
Lightning Strike 25,0232.0%51.55.32s145,6760Direct51.5113,065226,272145,67128.8%

Stats Details: Lightning Strike

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage51.5551.550.000.000.000.00000.00007,509,394.507,509,394.500.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.19%36.701275113,064.71108,152128,665113,036.38108,718118,9744,149,4294,149,4290.00%
crit28.81%14.85236226,271.95216,304257,330226,244.27216,304241,4013,359,9663,359,9660.00%

Action Details: Lightning Strike

  • id:1236111
  • school:nature
  • range:50000.0
  • travel_speed:0.0000
  • radius:40.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:147590.58
  • base_dd_max:147590.58
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:1236111
  • name:Lightning Strike
  • school:nature
  • tooltip:
  • description:{$@spelldesc1236108=Your spells and abilities have a chance to turn you into a Lightning Rod striking a random enemy target within {$1236111=}A1 yds for {$=}{{$=}<rolemult>*{$1236137=}w1} Nature damage every $1236110t sec for {$1236110d=15 seconds}.}
Marrowrend 1,3370.1%1.0176.10s409,210444,998Direct1.0309,605619,752409,25032.1%

Stats Details: Marrowrend

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.980.980.000.000.000.91960.0000400,943.07572,775.2530.00%444,997.86444,997.86
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit67.89%0.6704309,604.73117,694553,031170,926.170553,031205,943294,20516.44%
crit32.11%0.3103619,751.94235,3881,046,082180,252.4601,046,082195,000278,5718.70%

Action Details: Marrowrend

  • id:195182
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:195182
  • name:Marrowrend
  • school:physical
  • tooltip:
  • description:Smash the target, dealing {$s2=0} Physical damage and generating {$s3=3} charges of Bone Shield. {$@=}spellicon195181 |cFFFFFFFF{$@=}spellname195181|r {$@spelldesc195181=Surrounds you with a barrier of whirling bones, increasing Armor by {$=}{{$s1=115}*{$=}STR/100}{$?s316746=true}[, and your Haste by {$s4=0}%][]. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.}

Action Priority List

    sanlayn
    [U]:0.98
  • if_expr:buff.bone_shield.stack<6&!dot.bonestorm.ticking

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Ossified Vitriol458745115.0%Spell Data
Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Brittle37455716.0%
Raise Dead 0 (33,615)0.0% (2.6%)3.0120.00s3,355,4770

Stats Details: Raise Dead

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage3.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    high_prio_actions
    [9]:3.00
    auto_attack_mh 41,209 / 22,6751.8%121.82.33s55,78042,335Direct121.843,18186,45655,78129.1%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage121.76121.760.000.000.001.31760.00006,791,606.999,702,286.0030.00%42,335.3542,335.35
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.88%86.314711643,181.4131,28459,73143,181.8939,81347,7623,726,7005,323,85230.00%
crit29.12%35.45126086,456.3164,143119,46386,561.9578,48297,1673,064,9074,378,43430.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
    Gnaw 29 / 160.0%3.0120.00s1,5761,576Direct3.01,2462,4891,57626.6%

Stats Details: Gnaw

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage2.992.990.000.000.001.00000.00004,717.356,739.0730.00%1,576.131,576.13
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit73.45%2.20031,245.731,0351,6571,218.5301,6412,7393,91329.37%
crit26.55%0.79032,489.052,0703,2871,500.8803,2871,9782,82618.08%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.99
    Claw 19,857 / 10,9250.9%65.64.34s49,87749,878Direct65.638,64977,38049,87429.0%

Stats Details: Claw

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage65.5665.560.000.000.001.00000.00003,270,105.814,671,575.0630.00%49,878.0749,878.07
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.01%46.55246538,649.3128,86453,75838,646.3235,73443,2541,799,2642,570,37530.00%
crit28.99%19.0143577,380.0958,541107,51677,455.7369,52687,4991,470,8422,101,20130.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:65.58
Shattering Bone 22,9131.8%40.47.42s169,9860Direct40.4132,492256,000170,00330.4%

Stats Details: Shattering Bone

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage40.4140.410.000.000.000.00000.00006,869,410.446,869,410.440.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit69.63%28.141344132,491.9217,872602,702132,643.8361,593220,6273,728,5473,728,5470.00%
crit30.37%12.27126256,000.0935,6191,173,344256,185.9549,534736,9173,140,8643,140,8640.00%

Action Details: Shattering Bone

  • id:377642
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377642
  • name:Shattering Bone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc377640=When Bone Shield is consumed it shatters dealing {$s3=0} Shadow damage to nearby enemies. This damage is tripled while you are within your Death and Decay.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Brittle37455716.0%
Soul Reaper 8,281 (46,806)0.7% (3.7%)11.59.04s1,223,8521,101,923Direct11.5 (22.9)168,871337,567216,54028.3% (28.4%)

Stats Details: Soul Reaper

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage11.4611.460.000.000.001.11070.00002,482,068.072,482,068.070.00%1,101,922.831,101,922.83
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.73%8.22215168,870.87115,741247,823168,740.33137,409199,6961,388,3461,388,3460.00%
crit28.27%3.24010337,566.72242,207496,562328,866.370453,6551,093,7221,093,7220.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1
  • secondary_cost:0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:2.09
  • base_multiplier:1.00
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    sanlayn
    [S]:11.46
  • if_expr:active_enemies<=2&target.time_to_pct_35<5&target.time_to_die>(dot.soul_reaper.remains+5)

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Razorice5171413.6%
Brittle37455716.0%
    Soul Reaper (_execute) 38,5253.0%0.00.00s00Direct11.5784,3821,568,1761,007,31528.4%

Stats Details: Soul Reaper Execute

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage0.0011.460.000.000.000.00000.000011,544,307.6011,544,307.600.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.56%8.20215784,381.72531,0491,140,727784,089.18629,606933,9966,432,6486,432,6480.00%
crit28.44%3.260111,568,175.671,058,3852,274,1421,527,502.7202,143,6885,111,6595,111,6590.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Damage on Debuff Blood Plague5507845.0%
War32709614.8%
Razorice5171413.6%
Brittle37455716.0%
Thunderlord's Crackling Citrine 37,1062.9%32.69.08s341,2500Direct32.6264,421528,863341,25229.1%

Stats Details: Thunderlords Crackling Citrine

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage32.6132.610.000.000.000.00000.000011,129,381.0411,129,381.040.00%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.95%23.14943264,421.16246,167311,300264,351.16250,154281,4856,118,3156,118,3150.00%
crit29.05%9.48024528,862.66492,334622,601529,091.100602,2565,011,0665,011,0660.00%

Action Details: Thunderlords Crackling Citrine

  • id:462951
  • school:nature
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:309651.83
  • base_dd_max:309651.83
  • base_dd_mult:1.00
  • base_multiplier:0.66

Spelldata

  • id:462951
  • name:Thunderlord's Crackling Citrine
  • school:nature
  • tooltip:
  • description:{$@spelldesc462540=Your spells and abilities have a chance to zap an enemy dealing {$?a462342=false}[{$=}{{$462342=}w1*({$s2=1961}/100)*{$=}<rolemult>}][{$=}{{$462342s3=10779}*({$s2=1961}/100)*{$=}<rolemult>}] Nature damage.}
pet - bloodworm 25562 / 20732
auto_attack_mh 25,5621.6%407.40.70s15,27715,872Direct407.411,84523,69115,27729.0%

Stats Details: Auto Attack Mh

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage407.38407.380.000.000.000.96250.00006,223,418.608,890,589.1130.00%15,872.3815,872.38
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.03%289.3713452011,845.268,66516,54511,839.4010,91712,8163,427,6774,896,67730.00%
crit28.97%118.015022823,691.4717,76733,08923,700.7621,48625,9792,795,7413,993,91230.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Ácyd 1317911
Blood Plague (_heal) 104,2637.9%118.12.52s265,0880Direct118.1204,472413,875265,07928.9%

Stats Details: Blood Plague Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal118.12118.120.000.000.000.00000.000031,312,602.8431,895,082.571.83%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit71.05%83.9352119204,471.980598,090204,370.52165,903246,39517,162,06617,468,2611.78%
crit28.95%34.191363413,874.8201,192,347413,298.73296,089543,03514,150,53714,426,8211.94%

Action Details: Blood Plague Heal

  • id:55078
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:296554.31
  • base_dd_max:296554.31
  • base_dd_mult:2.09
  • base_multiplier:1.00

Spelldata

  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining {$=}w1 health from the target every {$t1=3} sec.
  • description:A shadowy disease that drains {$=}o1 health from the target over {$d=24 seconds}.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%
Spell Periodic AmountBlood Death Knight13700815PCT15.0%
Spell Tick TimeRapid Decomposition1946621PCT-15.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Coagulopathy391481125.0%Spell Data
Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Percent Tick Time Consumption2741565-30.0%Spell Data
Blood Shield 301,11222.9%86.73.37s1,041,3730Direct177.2509,7770509,7770.0%

Stats Details: Blood Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb86.72177.180.000.000.000.00000.000090,313,008.30101,993,879.5111.45%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%177.18131229509,776.9307,665,166509,898.37414,747701,94390,313,008101,993,88011.14%

Action Details: Blood Shield

  • id:77535
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:692639.83
  • base_dd_max:692639.83
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:77535
  • name:Blood Shield
  • school:shadow
  • tooltip:Absorbs {$=}w1 Physical damage{$?a391398=true} [ and Physical damage increased by {$s2=0}%][].
  • description:When you deal damage with Death Strike while in Blood Presence, you gain a percentage of your health gained as a physical absorption shield.
Bonestorm (_heal) 60,8624.6%53.65.25s339,9960Direct53.6339,9690339,9690.0%

Stats Details: Bonestorm Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal53.6253.620.000.000.000.00000.000018,230,611.2119,683,075.127.38%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%53.624060339,969.110477,191339,838.12262,175425,18018,230,61119,683,0757.51%

Action Details: Bonestorm Heal

  • id:196545
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196545
  • name:Bonestorm
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194844=Consume up to {$s4=5} Bone Shield charges to create a whirl of bone and gore that batters all nearby enemies, dealing {$196528s1=0} Shadow damage every {$t3=1} sec, and healing you for {$196545s1=2}% of your maximum health every time it deals damage (up to {$=}{{$s1=2}*{$s4=5}}%). Deals reduced damage beyond {$196528s2=8} targets. Lasts {$d=2 seconds} per Bone Shield charge spent and rapidly regenerates a Bone Shield every {$t3=1} sec.}
Consumption (_heal) 12,0330.9%7.739.53s470,6320Direct7.7470,5680470,5680.0%

Stats Details: Consumption Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal7.687.680.000.000.000.00000.00003,614,342.243,740,524.013.37%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%7.68511470,568.3501,451,614470,604.02195,444764,5003,614,3423,740,5243.35%

Action Details: Consumption Heal

  • id:274156
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:210882.45
  • base_dd_max:210882.45
  • base_dd_mult:2.09
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:274156
  • name:Consumption
  • school:physical
  • tooltip:Your Blood Plague deals damage {$=}w5% more often.
  • description:Strikes all enemies in front of you with a hungering attack that deals $sw1 Physical damage and heals you for {$=}{{$=}e1*100}% of that damage. Deals reduced damage beyond {$s3=8} targets. Causes your Blood Plague damage to occur {$s5=30}% more quickly for {$d=6 seconds}. |cFFFFFFFFGenerates {$s4=2} Runes.|r

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDeath Knight1370052SET1.000
Spell Direct AmountBlood Death Knight1370081PCT109.0%
Spell Periodic AmountBlood Death Knight1370082PCT109.0%

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Sanguine Ground39145916.0%Spell Data
Luck of the Draw!1218601115.0%Spell Data
Periodic Damage Sanguine Ground39145936.0%Spell Data
Luck of the Draw!1218601215.0%Spell Data
Death Strike (_heal) 669,90750.8%86.73.37s2,315,4120Direct86.72,315,54602,315,5460.0%

Stats Details: Death Strike Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal86.7286.720.000.000.000.00000.0000200,804,017.89203,058,288.301.11%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%86.72661142,315,546.34023,245,3382,318,353.231,836,7142,707,735200,804,018203,058,2881.12%

Action Details: Death Strike Heal

  • id:45470
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:45470
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc49998=Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of {$=}{{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$=}{{$s2=25}}.2% of all damage taken in the last {$s4=5} sec, minimum {$=}{{$s3=7}}.1% of maximum health.}

Affected By (Dynamic)

TypeSpellID#ValueSourceNotes
Direct Damage Hemostasis27394718.0%Spell Data
Frost Shield 21,9271.7%178.22.00s36,9140Direct308.621,307021,3070.0%

Stats Details: Frost Shield

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
absorb178.16308.640.000.000.000.00000.00006,576,608.559,166,541.3628.25%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%308.6423339121,307.280152,60821,311.6717,96024,8546,576,6099,166,54128.17%

Action Details: Frost Shield

  • id:207203
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27604.29
  • base_dd_max:27604.29
  • base_dd_mult:1.00
  • base_multiplier:1.00

Spelldata

  • id:207203
  • name:Frost Shield
  • school:frost
  • tooltip:Absorbs {$=}w1 damage.
  • description:{$@spelldesc207200=Your auto attack damage grants you an absorb shield equal to {$s1=40}% of the damage dealt.}
Unholy Strength 65,3225.0%24.411.95s802,7150Direct24.4802,6890802,6890.0%

Stats Details: Unholy Strength

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal24.4224.420.000.000.000.00000.000019,600,477.5520,395,166.293.90%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%24.421149802,688.8401,145,258802,661.90540,6311,036,52619,600,47820,395,1663.86%

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=4}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
Vampiric Strike (_heal) 78,7066.0%74.93.93s315,3420Direct74.9169,130671,554315,31229.1%

Stats Details: Vampiric Strike Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal74.8674.860.000.000.000.00000.000023,606,391.2524,798,917.054.81%0.000.00
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit70.90%53.083081169,130.150238,595169,096.94133,573193,8378,977,6079,389,4324.44%
crit29.10%21.78543671,554.250954,381671,704.98450,600849,39214,628,78515,409,4855.08%

Action Details: Vampiric Strike Heal

  • id:434422
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:434422
  • name:Vampiric Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc433895=A vampiric strike that deals {$?a137007=false}[{$s1=0}][{$s5=0}] Shadow damage and heals you for {$?a137007=false}[{$434422s2=1}][{$434422s3=2}]% of your maximum health. Additionally grants you Essence of the Blood Queen for {$433925d=20 seconds}.}
Simple Action Stats Execute Interval
Ácyd
Crystallized Augment Rune 1.00.00s

Stats Details: Augmentation

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Augmentation

  • id:453250
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Beast (_summon) 6.352.30s

Stats Details: Blood Beast Summon

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage6.350.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Blood Beast Summon

  • id:434237
  • school:physical
  • range:50000.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:434237
  • name:Blood Beast
  • school:physical
  • tooltip:
  • description:Raises a Blood Beast to fight by your side. You can have a maximum of one Blood Beast at a time. Lasts {$d=10 seconds}.
Bloodworm (_summon) 27.710.53s

Stats Details: Bloodworm Summon

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage27.730.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Bloodworm Summon

  • id:196361
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196361
  • name:Bloodworm
  • school:shadow
  • tooltip:
  • description:{$@spelldesc195679=Your auto attacks have a chance to summon a Bloodworm. Bloodworms deal minor damage to your target for {$198494d=15 seconds} and then burst, healing you for {$s3=15}% of your missing health. If you drop below {$s2=50}% health, your Bloodworms will immediately burst and heal you.}
Flask of Alchemical Chaos 1.00.00s

Stats Details: Flask

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Flask

  • id:432021
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Beledar's Bounty 1.00.00s

Stats Details: Food

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.000.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Food

  • id:454149
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Tempered Potion 1.4306.23s

Stats Details: Potion

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage1.440.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Potion

  • id:431932
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [3]:1.44
  • if_expr:buff.dancing_rune_weapon.up
Tombstone 4.867.07s

Stats Details: Tombstone

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.760.000.000.000.001.05160.00000.000.000.00%0.000.00

Action Details: Tombstone

  • id:219809
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_cast_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:0.0

Spelldata

  • id:219809
  • name:Tombstone
  • school:shadow
  • tooltip:Absorbing {$=}w1 damage.
  • description:Consume up to {$s5=5} Bone Shield charges. For each charge consumed, you gain {$s3=6} Runic Power and absorb damage equal to {$s4=6}% of your maximum health for {$d=8 seconds}.

Action Priority List

    sanlayn
    [V]:4.76
  • if_expr:buff.bone_shield.stack>=6&(buff.death_and_decay.remains|active_enemies<=3)&cooldown.dancing_rune_weapon.remains>=25
Vampiric Blood 10.430.53s

Stats Details: Vampiric Blood

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage10.430.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Vampiric Blood

  • id:55233
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_cast_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55233
  • name:Vampiric Blood
  • school:physical
  • tooltip:Maximum health increased by {$s4=30}%. Healing and absorbs received increased by {$s1=30}%.
  • description:Embrace your undeath, increasing your maximum health by {$s4=30}% and increasing all healing and absorbs received by {$s1=30}% for {$d=10 seconds}.

Action Priority List

    default
    [4]:10.43
  • if_expr:!buff.vampiric_blood.up

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Astral Antenna16.10.020.4s17.1s12.7s38.27%0.00%0.0 (0.0)8.6

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_astral_antenna
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:4853.12

Trigger Details

  • interval_min/max:0.0s / 120.0s
  • trigger_min/max:0.0s / 88.5s
  • trigger_pct:99.80%
  • duration_min/max:0.0s / 77.3s
  • uptime_min/max:14.93% / 65.51%

Stack Uptimes

  • astral_antenna_1:29.50%
  • astral_antenna_2:4.60%
  • astral_antenna_3:3.19%
  • astral_antenna_4:0.60%
  • astral_antenna_5:0.30%
  • astral_antenna_6:0.06%
  • astral_antenna_7:0.02%
  • astral_antenna_8:0.01%
  • astral_antenna_9:0.00%
  • astral_antenna_10:0.00%

Spelldata

  • id:1239641
  • name:Astral Antenna
  • tooltip:Critical Strike rating increased by {$=}w1.
  • description:{$@spelldesc1234714=The antenna has a chance to detect and draw ambient arcane energy towards you, granting {$s1=5615} Critical Strike for {$1239641d=10 seconds}. Multiple applications may overlap.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Astral Antenna (_orb)14.00.020.8s20.2s5.4s20.60%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_astral_antenna_orb
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 92.0s
  • trigger_min/max:0.0s / 91.1s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 15.3s
  • uptime_min/max:7.25% / 37.32%

Stack Uptimes

  • astral_antenna_orb_1:18.74%
  • astral_antenna_orb_2:1.76%
  • astral_antenna_orb_3:0.10%
  • astral_antenna_orb_4:0.01%
  • astral_antenna_orb_5:0.00%

Spelldata

  • id:1239640
  • name:Astral Antenna
  • tooltip:The antenna is drawing ambient arcane energy towards you!
  • description:{$@spelldesc1234714=The antenna has a chance to detect and draw ambient arcane energy towards you, granting {$s1=5615} Critical Strike for {$1239641d=10 seconds}. Multiple applications may overlap.}
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blood Draw3.00.0120.0s120.0s7.9s7.87%0.00%0.0 (0.0)2.9

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_blood_draw
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:119.8s / 164.0s
  • trigger_min/max:119.8s / 164.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:5.36% / 9.52%

Stack Uptimes

  • blood_draw_1:7.87%

Spelldata

  • id:454871
  • name:Blood Draw
  • tooltip:Damage taken reduced by {$=}w1% and Death Strike cost reduced by {$=}{{$s2=100}/-10}.
  • description:{$@spelldesc374598=When you fall below {$s1=30}% health you drain {$374606s1=0} health from nearby enemies, the damage you take is reduced by {$454871s1=10}% and your Death Strike cost is reduced by {$=}{{$454871s2=100}/-10} for {$454871d=8 seconds}. Can only occur every {$374609d=120 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Shield75.311.43.9s3.4s1.3s32.55%52.12%11.4 (11.4)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_blood_shield
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:physical
  • high priority:no

Trigger Details

  • interval_min/max:0.8s / 24.4s
  • trigger_min/max:0.8s / 14.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.5s
  • uptime_min/max:22.78% / 44.42%

Stack Uptimes

  • blood_shield_1:32.55%

Spelldata

  • id:77535
  • name:Blood Shield
  • tooltip:Absorbs {$=}w1 Physical damage{$?a391398=true} [ and Physical damage increased by {$s2=0}%][].
  • description:When you deal damage with Death Strike while in Blood Presence, you gain a percentage of your health gained as a physical absorption shield.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust1.00.00.0s0.0s40.0s13.51%0.00%0.0 (0.0)1.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked Ground17.50.017.2s17.2s13.1s76.61%77.57%0.0 (0.0)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_bloodsoaked_ground
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 94.9s
  • trigger_min/max:10.0s / 94.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s
  • uptime_min/max:49.76% / 93.57%

Stack Uptimes

  • bloodsoaked_ground_1:76.61%

Spelldata

  • id:434034
  • name:Blood-Soaked Ground
  • tooltip:Physical damage taken reduced by {$s1=5}%. Chance to gain Vampiric Strike increased by {$434033s2=5}%.
  • description:{$@spelldesc391458=You deal {$391459s1=6}% more damage and receive {$391459s2=5}% more healing while standing in your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Bone Shield1.268.7251.3s4.3s247.6s99.94%100.00%11.8 (16.0)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_bone_shield
  • max_stacks:12
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.27
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 344.6s
  • trigger_min/max:0.0s / 32.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 360.0s
  • uptime_min/max:98.49% / 100.00%

Stack Uptimes

  • bone_shield_1:0.17%
  • bone_shield_2:0.76%
  • bone_shield_3:0.91%
  • bone_shield_4:1.25%
  • bone_shield_5:2.06%
  • bone_shield_6:10.39%
  • bone_shield_7:13.43%
  • bone_shield_8:7.08%
  • bone_shield_9:8.75%
  • bone_shield_10:14.53%
  • bone_shield_11:21.10%
  • bone_shield_12:19.52%

Spelldata

  • id:195181
  • name:Bone Shield
  • tooltip:Armor increased by {$=}{{$=}w1*{$=}STR/100}. {$?a374715=true}[Haste increased by {$=}w4%.][]
  • description:Surrounds you with a barrier of whirling bones, increasing Armor by {$=}{{$s1=115}*{$=}STR/100}{$?s316746=true}[, and your Haste by {$s4=0}%][]. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Bonestorm5.50.060.4s60.4s9.8s17.93%0.00%48.3 (48.3)5.3

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_bonestorm
  • max_stacks:1
  • base duration:2.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:60.0s / 83.0s
  • trigger_min/max:60.0s / 83.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:15.33% / 19.88%

Stack Uptimes

  • bonestorm_1:17.93%

Spelldata

  • id:194844
  • name:Bonestorm
  • tooltip:Dealing {$196528s1=0} Shadow damage to nearby enemies every {$t3=1} sec, and healing for {$196545s1=2}% of maximum health for each target hit (up to {$=}{{$s1=2}*{$s4=5}}%).
  • description:Consume up to {$s4=5} Bone Shield charges to create a whirl of bone and gore that batters all nearby enemies, dealing {$196528s1=0} Shadow damage every {$t3=1} sec, and healing you for {$196545s1=2}% of your maximum health every time it deals damage (up to {$=}{{$s1=2}*{$s4=5}}%). Deals reduced damage beyond {$196528s2=8} targets. Lasts {$d=2 seconds} per Bone Shield charge spent and rapidly regenerates a Bone Shield every {$t3=1} sec.
  • max_stacks:0
  • duration:2.00
  • cooldown:60.00
  • default_chance:0.00%
Charged Bolts7.05.142.2s23.3s20.2s47.32%0.00%44.5 (44.5)6.5

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_charged_bolts
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:tick
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 152.5s
  • trigger_min/max:0.0s / 109.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 117.0s
  • uptime_min/max:21.34% / 79.75%

Stack Uptimes

  • charged_bolts_1:47.32%

Spelldata

  • id:1236110
  • name:Charged Bolts
  • tooltip:Damaging nearby targets for {$=}{{$=}<rolemult>*{$1236137=}w1} Nature damage every $t sec.
  • description:{$@spelldesc1236108=Your spells and abilities have a chance to turn you into a Lightning Rod striking a random enemy target within {$1236111=}A1 yds for {$=}{{$=}<rolemult>*{$1236137=}w1} Nature damage every $1236110t sec for {$1236110d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Coagulopathy1.085.7246.8s3.4s292.1s97.51%96.60%81.7 (81.7)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_coagulopathy
  • max_stacks:5
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:196.5s / 303.7s
  • trigger_min/max:0.8s / 14.0s
  • trigger_pct:100.00%
  • duration_min/max:0.9s / 353.5s
  • uptime_min/max:96.34% / 98.21%

Stack Uptimes

  • coagulopathy_1:0.55%
  • coagulopathy_2:0.63%
  • coagulopathy_3:0.61%
  • coagulopathy_4:1.25%
  • coagulopathy_5:94.45%

Spelldata

  • id:391481
  • name:Coagulopathy
  • tooltip:Blood Plague damage is increased by {$s1=25}%.
  • description:{$@spelldesc391477=Enemies affected by Blood Plague take {$s1=5}% increased damage from you and Death Strike increases the damage of your Blood Plague by {$391481s1=25}% for {$391481d=12 seconds}, stacking up to {$391481u=5} times.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391477
  • name:Coagulopathy
  • tooltip:
  • description:Enemies affected by Blood Plague take {$s1=5}% increased damage from you and Death Strike increases the damage of your Blood Plague by {$391481s1=25}% for {$391481d=12 seconds}, stacking up to {$391481u=5} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Consumption7.70.039.8s39.8s5.9s15.17%0.00%0.0 (0.0)7.5

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_consumption
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:30.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:30.0s / 111.3s
  • trigger_min/max:30.0s / 111.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:11.25% / 19.20%

Stack Uptimes

  • consumption_1:15.17%

Spelldata

  • id:274156
  • name:Consumption
  • tooltip:Your Blood Plague deals damage {$=}w5% more often.
  • description:Strikes all enemies in front of you with a hungering attack that deals $sw1 Physical damage and heals you for {$=}{{$=}e1*100}% of that damage. Deals reduced damage beyond {$s3=8} targets. Causes your Blood Plague damage to occur {$s5=30}% more quickly for {$d=6 seconds}. |cFFFFFFFFGenerates {$s4=2} Runes.|r
  • max_stacks:0
  • duration:6.00
  • cooldown:30.00
  • default_chance:0.00%
Crimson Scourge17.61.517.1s15.7s1.0s5.86%100.00%1.5 (1.5)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_crimson_scourge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:25.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 96.1s
  • trigger_min/max:0.0s / 96.1s
  • trigger_pct:25.58%
  • duration_min/max:0.0s / 10.8s
  • uptime_min/max:1.93% / 13.08%

Stack Uptimes

  • crimson_scourge_1:5.86%

Spelldata

  • id:81141
  • name:Crimson Scourge
  • tooltip:Your next Death and Decay costs no Runes and generates no Runic Power.
  • description:{$@spelldesc81136=Your auto attacks on targets infected with your Blood Plague have a chance to make your next Death and Decay cost no runes and reset its cooldown.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:81136
  • name:Crimson Scourge
  • tooltip:
  • description:Your auto attacks on targets infected with your Blood Plague have a chance to make your next Death and Decay cost no runes and reset its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:25.00%
Dancing Rune Weapon6.36.350.7s23.4s13.7s29.11%45.99%6.3 (6.3)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_dancing_rune_weapon
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:35.0s / 75.8s
  • trigger_min/max:0.0s / 75.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s
  • uptime_min/max:26.16% / 32.70%

Stack Uptimes

  • dancing_rune_weapon_1:29.11%

Spelldata

  • id:81256
  • name:Dancing Rune Weapon
  • tooltip:Parry chance increased by {$s1=35}%.
  • description:{$@spelldesc49028=Summons a rune weapon for {$81256d=8 seconds} that mirrors your melee attacks and bolsters your defenses. While active, you gain {$81256s1=35}% parry chance.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Decay17.55.817.2s12.7s13.1s76.61%77.99%5.8 (5.8)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_death_and_decay
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 94.9s
  • trigger_min/max:0.0s / 94.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s
  • uptime_min/max:49.76% / 93.57%

Stack Uptimes

  • death_and_decay_1:76.61%

Spelldata

  • id:188290
  • name:Death and Decay
  • tooltip:{$?s206930=true}[Heart Strike will hit up to {$=}{{$m3=0}+2} targets.]?s207311[Clawing Shadows will hit {$=}{{$55090s4=8}-1} enemies near the target.]?s55090[Scourge Strike will hit {$=}{{$55090s4=8}-1} enemies near the target.][Dealing Shadow damage to enemies inside Death and Decay.]
  • description:{$@spelldesc43265=Corrupts the targeted ground, causing {$=}{{$52212m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Essence of the Blood Queen1.573.4166.0s3.9s203.0s98.09%99.33%64.8 (64.8)0.5

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_essence_of_the_blood_queen
  • max_stacks:7
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery
  • amount:0.00%

Trigger Details

  • interval_min/max:28.9s / 354.4s
  • trigger_min/max:0.8s / 56.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.4s
  • uptime_min/max:83.44% / 99.30%

Stack Uptimes

  • essence_of_the_blood_queen_1:0.96%
  • essence_of_the_blood_queen_2:0.74%
  • essence_of_the_blood_queen_3:0.57%
  • essence_of_the_blood_queen_4:0.56%
  • essence_of_the_blood_queen_5:0.81%
  • essence_of_the_blood_queen_6:0.85%
  • essence_of_the_blood_queen_7:93.59%

Spelldata

  • id:433925
  • name:Essence of the Blood Queen
  • tooltip:Haste increased by {$=}{{$=}W1}.1%.{$?a434075=true}[ Damage of Death Strike and Death Coil increased by {$=}W2%.][]{$?a1236259=false}[ Mastery increased by {$=}{$mastery*{$=}W3}.1%.][]
  • description:Essence of the Blood Queen empowers you, {$?a434075=true}[increasing your Haste by {$=}{{$s1=10}/10}.1% up to {$=}{{$s1=10}/10*{$u=5}}.1%, and increases the damage of your Death Coil and Death Strike by {$s2=0}% up to {$=}{{$s2=0}*{$=}U}%][increasing your Haste by {$=}{{$s1=10}/10}.1% up to {$=}{{$s1=10}*{$=}U/10}.1%] for {$d=20 seconds}.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Explosive Adrenaline5.50.060.5s60.5s28.6s52.12%0.00%0.0 (0.0)5.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_explosive_adrenaline
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2780.66

Trigger Details

  • interval_min/max:60.0s / 61.4s
  • trigger_min/max:60.0s / 61.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:47.79% / 55.32%

Stack Uptimes

  • explosive_adrenaline_1:52.12%

Spelldata

  • id:1218713
  • name:Explosive Adrenaline
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc1218714=Repurpose a Seaforium charge to give your heart a kick, causing your first ability every {$s2=60} sec to trigger Explosive Adrenaline, granting {$s1=3524} Critical Strike for {$1218713d=15 seconds}. While exploding, Critical Strikes cause you to blow up again, extending this duration by 1 sec, up to 15 times.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Alchemical Chaos (Crit)2.10.6111.9s77.0s35.2s24.92%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_flask_of_alchemical_chaos_crit
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:crit_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.1s / 351.7s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 82.19%

Stack Uptimes

  • flask_of_alchemical_chaos_crit_1:24.92%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Haste)2.10.6111.4s76.6s35.3s25.22%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_flask_of_alchemical_chaos_haste
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:haste_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 346.9s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 80.39%

Stack Uptimes

  • flask_of_alchemical_chaos_haste_1:25.22%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Mastery)2.10.6112.1s76.8s35.3s24.85%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_flask_of_alchemical_chaos_mastery
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:mastery_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 354.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 180.0s
  • uptime_min/max:0.00% / 77.44%

Stack Uptimes

  • flask_of_alchemical_chaos_mastery_1:24.85%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos (Vers)2.10.6111.9s76.9s35.3s25.00%0.00%2.9 (2.9)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_flask_of_alchemical_chaos_vers
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Stat Details

  • stat:versatility_rating
  • amount:3470.00

Trigger Details

  • interval_min/max:30.0s / 356.6s
  • trigger_min/max:30.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 210.0s
  • uptime_min/max:0.00% / 78.06%

Stack Uptimes

  • flask_of_alchemical_chaos_vers_1:25.00%

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Frost Shield129.948.32.3s1.7s1.2s50.96%100.00%48.3 (48.3)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_frost_shield
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.0s / 21.8s
  • trigger_min/max:0.0s / 2.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.5s
  • uptime_min/max:40.08% / 61.18%

Stack Uptimes

  • frost_shield_1:50.96%

Spelldata

  • id:207203
  • name:Frost Shield
  • tooltip:Absorbs {$=}w1 damage.
  • description:{$@spelldesc207200=Your auto attack damage grants you an absorb shield equal to {$s1=40}% of the damage dealt.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Gift of the San'layn6.36.350.7s23.4s13.7s29.11%0.00%6.3 (6.3)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_gift_of_the_sanlayn
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:35.0s / 75.8s
  • trigger_min/max:0.0s / 75.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s
  • uptime_min/max:26.16% / 32.70%

Stack Uptimes

  • gift_of_the_sanlayn_1:29.11%

Spelldata

  • id:434153
  • name:Gift of the San'layn
  • tooltip:The effectiveness of Essence of the Blood Queen is increased by {$?a137007=false}[{$=}w1][{$=}w4]%. {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] has been replaced with Vampiric Strike.
  • description:{$@spelldesc434152=While {$?a137008=true}[Dancing Rune Weapon][Dark Transformation] is active you gain Gift of the San'layn. Gift of the San'layn increases the effectiveness of your Essence of the Blood Queen by {$?a137007=false}[{$434153s1=100}][{$434153s4=200}]%, and Vampiric Strike replaces your {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] for the duration. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Heartrend11.50.824.1s22.5s2.2s8.61%13.20%0.8 (0.8)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_heartrend
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:10.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 218.1s
  • trigger_min/max:0.8s / 218.1s
  • trigger_pct:10.00%
  • duration_min/max:0.0s / 11.9s
  • uptime_min/max:1.40% / 20.97%

Stack Uptimes

  • heartrend_1:8.61%

Spelldata

  • id:377656
  • name:Heartrend
  • tooltip:Your next Death Strike deals an additional {$s2=0}% damage.
  • description:{$@spelldesc377655=Heart Strike has a chance to increase the damage of your next Death Strike by {$s1=20}%.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hemostasis16.71.818.2s16.3s3.4s19.27%19.14%0.0 (0.0)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_hemostasis
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 56.5s
  • trigger_min/max:0.8s / 56.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.9s
  • uptime_min/max:11.87% / 28.24%

Stack Uptimes

  • hemostasis_1:17.21%
  • hemostasis_2:1.90%
  • hemostasis_3:0.16%

Spelldata

  • id:273947
  • name:Hemostasis
  • tooltip:Damage and healing done by your next Death Strike increased by {$s1=8}%.
  • description:{$@spelldesc273946=Each enemy hit by Blood Boil increases the damage and healing done by your next Death Strike by {$273947s1=8}%, stacking up to {$273947u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:273946
  • name:Hemostasis
  • tooltip:
  • description:Each enemy hit by Blood Boil increases the damage and healing done by your next Death Strike by {$273947s1=8}%, stacking up to {$273947u=5} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Icebound Fortitude7.70.635.5s32.5s4.2s10.79%9.14%25.6 (25.6)7.5

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_icebound_fortitude
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:4.0s / 139.0s
  • trigger_min/max:0.0s / 139.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.2s
  • uptime_min/max:3.08% / 27.32%

Stack Uptimes

  • icebound_fortitude_1:10.79%

Spelldata

  • id:48792
  • name:Icebound Fortitude
  • tooltip:Damage taken reduced by {$=}w3%. Immune to Stun effects.
  • description:Your blood freezes, granting immunity to Stun effects and reducing all damage you take by {$s3=30}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:100.00%
Icy Talons1.5123.2124.8s2.4s196.6s99.23%0.00%120.2 (120.2)0.5

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.7s / 350.9s
  • trigger_min/max:0.5s / 13.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 358.1s
  • uptime_min/max:97.38% / 99.48%

Stack Uptimes

  • icy_talons_1:0.79%
  • icy_talons_2:0.77%
  • icy_talons_3:97.67%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased by {$=}w1%{$?a436687=false}[, and Runic Power spending abilities deal Shadowfrost damage.][.]
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=6}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=6}% for {$194879d=10 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Infliction of Sorrow6.30.050.4s50.4s1.6s3.35%0.00%0.0 (0.0)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_infliction_of_sorrow
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:32.4s / 75.8s
  • trigger_min/max:32.4s / 75.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.5s
  • uptime_min/max:0.64% / 9.44%

Stack Uptimes

  • infliction_of_sorrow_1:3.35%

Spelldata

  • id:460049
  • name:Infliction of Sorrow
  • tooltip:{$?a137007=false}[Scourge Strike][Heart Strike] consumes your {$?a137007=false}[Virulent Plague][Blood Plague] to deal {$=}w1% of their remaining damage to the target.
  • description:{$@spelldesc434143=When Vampiric Strike damages an enemy affected by your {$?a137008=true}[Blood Plague][Virulent Plague], it extends the duration of the disease by {$s3=3} sec, and deals {$s2=10}% of the remaining damage to the enemy. After Gift of the San'layn ends, {$?s356367=true}[you gain a charge of][the cooldown of your] {$?s152280=false}[Defile][Death and Decay]{$?s356367=true}[][ is reset], and your next {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] consumes the disease to deal {$s1=100}% of their remaining damage to the target.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Luck of the Draw!6.32.044.4s32.5s13.6s28.45%28.12%2.0 (2.0)6.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_luck_of_the_draw
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 151.0s
  • trigger_min/max:0.0s / 139.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.6s
  • uptime_min/max:8.85% / 66.71%

Stack Uptimes

  • luck_of_the_draw_1:28.45%

Spelldata

  • id:1218601
  • name:Luck of the Draw!
  • tooltip:Damage increased by {$s1=15}%.{$?a1215993=false}[ Death Strike costs {$=}{-{$=}S5/10} less Runic Power and strikes {$m4=2} additional nearby {$=}Ltarget:targets;.][]
  • description:{$@spelldesc1215992=Each time you take damage you have a chance to cast Icebound Fortitude for {$=}{{$s1=4000}/1000} sec and gain |cFFFFFFFFLuck of the Draw!|r which increases your damage dealt by {$1218601s1=15}% for {$1218601d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Maybe Stop Blowing Up5.50.060.5s60.5s54.5s99.24%0.00%0.0 (0.0)4.5

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_maybe_stop_blowing_up
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 61.4s
  • trigger_min/max:60.0s / 61.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 60.0s
  • uptime_min/max:98.53% / 99.94%

Stack Uptimes

  • maybe_stop_blowing_up_1:99.24%

Spelldata

  • id:1218715
  • name:Maybe Stop Blowing Up
  • tooltip:You must wait before blowing up again.
  • description:{$@spelldesc1218714=Repurpose a Seaforium charge to give your heart a kick, causing your first ability every {$s2=60} sec to trigger Explosive Adrenaline, granting {$s1=3524} Critical Strike for {$1218713d=15 seconds}. While exploding, Critical Strikes cause you to blow up again, extending this duration by 1 sec, up to 15 times.}
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Ossified Vitriol11.129.328.4s7.4s16.8s62.09%99.03%26.7 (33.9)9.5

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_ossified_vitriol
  • max_stacks:5
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 67.9s
  • trigger_min/max:0.0s / 51.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.9s
  • uptime_min/max:46.11% / 70.44%

Stack Uptimes

  • ossified_vitriol_1:6.25%
  • ossified_vitriol_2:3.04%
  • ossified_vitriol_3:1.23%
  • ossified_vitriol_4:0.52%
  • ossified_vitriol_5:51.05%

Spelldata

  • id:458745
  • name:Ossified Vitriol
  • tooltip:Marrowrend damage is increased by {$s1=15}%.
  • description:{$@spelldesc458744=When you lose a Bone Shield charge the damage of your next Marrowrend is increased by 15%, stacking up to 75%.}
  • max_stacks:5
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Ossuary5.648.858.3s5.4s51.6s96.85%84.84%48.8 (48.8)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_ossuary
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 303.2s
  • trigger_min/max:0.0s / 54.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 312.8s
  • uptime_min/max:86.66% / 99.05%

Stack Uptimes

  • ossuary_1:96.85%

Spelldata

  • id:219788
  • name:Ossuary
  • tooltip:Death Strike cost reduced by {$=}{{$m1=-50}/-10} Runic Power.
  • description:{$@spelldesc219786=While you have at least {$s1=5} Bone Shield charges, the cost of Death Strike is reduced by {$=}{{$219788m1=-50}/-10} Runic Power. Additionally, your maximum Runic Power is increased by {$=}{{$m2=100}/10}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Perseverance of the Ebon Blade17.50.017.2s17.2s5.9s34.74%0.00%0.0 (0.0)17.2

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_perseverance_of_the_ebon_blade
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 94.9s
  • trigger_min/max:10.0s / 94.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:22.46% / 44.26%

Stack Uptimes

  • perseverance_of_the_ebon_blade_1:34.74%

Spelldata

  • id:374748
  • name:Perseverance of the Ebon Blade
  • tooltip:Versatility increased by {$=}w1%
  • description:{$@spelldesc374747=When Crimson Scourge is consumed, you gain {$374748s1=6}% Versatility for {$374748d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Rune Mastery13.111.222.8s12.0s11.3s49.25%0.00%11.2 (11.2)12.6

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 177.0s
  • trigger_min/max:0.8s / 175.0s
  • trigger_pct:15.01%
  • duration_min/max:0.0s / 65.5s
  • uptime_min/max:20.04% / 75.98%

Stack Uptimes

  • rune_mastery_1:49.25%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Sanguine Ground17.50.017.2s17.2s13.1s76.61%80.50%0.0 (0.0)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_sanguine_ground
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 94.9s
  • trigger_min/max:10.0s / 94.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s
  • uptime_min/max:49.76% / 93.57%

Stack Uptimes

  • sanguine_ground_1:76.61%

Spelldata

  • id:391459
  • name:Sanguine Ground
  • tooltip:Damage dealt increased by {$s1=6}%. Healing received increased by {$s2=5}%.
  • description:{$@spelldesc391458=You deal {$391459s1=6}% more damage and receive {$391459s2=5}% more healing while standing in your Death and Decay.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Tempered Potion1.40.0306.2s306.2s27.4s12.91%0.00%0.0 (0.0)1.2

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_tempered_potion
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:2617.40
  • stat:mastery_rating
  • amount:2617.40
  • stat:haste_rating
  • amount:2617.40
  • stat:crit_rating
  • amount:2617.40

Trigger Details

  • interval_min/max:302.2s / 325.8s
  • trigger_min/max:302.2s / 325.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.44% / 17.97%

Stack Uptimes

  • tempered_potion_1:12.91%

Spelldata

  • id:431932
  • name:Tempered Potion
  • tooltip:Benefitting from the effects of any Tempered Flasks that are not active on you. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Haste increased by {$=}w2.][]{$?=}{$=}W3>0[ Versatility increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][]
  • description:Gain the effects of all inactive Tempered Flasks, increasing their associated secondary stats by {$s1=3991} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Tombstone4.80.067.2s67.2s4.8s7.53%100.00%0.0 (0.0)2.2

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_tombstone
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:60.0s / 107.6s
  • trigger_min/max:60.0s / 107.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s
  • uptime_min/max:1.14% / 12.18%

Stack Uptimes

  • tombstone_1:7.53%

Spelldata

  • id:219809
  • name:Tombstone
  • tooltip:Absorbing {$=}w1 damage.
  • description:Consume up to {$s5=5} Bone Shield charges. For each charge consumed, you gain {$s3=6} Runic Power and absorb damage equal to {$s4=6}% of your maximum health for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Unholy Strength8.515.935.7s12.0s26.0s73.95%0.00%15.9 (15.9)7.8

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:18.00%

Trigger Details

  • interval_min/max:15.0s / 211.3s
  • trigger_min/max:0.0s / 52.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 208.8s
  • uptime_min/max:51.22% / 93.75%

Stack Uptimes

  • unholy_strength_1:73.95%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=4}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Vampiric Blood10.40.030.2s30.7s9.8s34.23%30.16%0.0 (0.0)10.1

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_vampiric_blood
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:22.0s / 42.2s
  • trigger_min/max:22.0s / 42.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s
  • uptime_min/max:31.44% / 37.48%

Stack Uptimes

  • vampiric_blood_1:34.23%

Spelldata

  • id:55233
  • name:Vampiric Blood
  • tooltip:Maximum health increased by {$s4=30}%. Healing and absorbs received increased by {$s1=30}%.
  • description:Embrace your undeath, increasing your maximum health by {$s4=30}% and increasing all healing and absorbs received by {$s1=30}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Vampiric Strike30.40.89.9s9.3s3.9s39.23%0.00%0.8 (0.8)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_vampiric_strike
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 65.5s
  • trigger_min/max:0.8s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 21.0s
  • uptime_min/max:32.22% / 48.03%

Stack Uptimes

  • vampiric_strike_1:39.23%

Spelldata

  • id:433899
  • name:Vampiric Strike
  • tooltip:
  • description:{$@spelldesc433901=Your Death Coil{$?a137007=false}[, Epidemic][] and Death Strike have a {$s1=25}% chance to make your next {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] become Vampiric Strike. Vampiric Strike heals you for {$?a137008=true}[{$434422s2=1}][{$434422s3=2}]% of your maximum health and grants you Essence of the Blood Queen, increasing your Haste by {$=}{{$433925s1=10}/10}.1%, up to {$=}{{$433925s1=10}*{$433925u=5}/10}.1% for {$433925d=20 seconds}. }
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Visceral Strength15.12.420.0s17.2s13.5s68.16%0.00%2.4 (2.4)14.4

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_visceral_strength
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:12.00%

Trigger Details

  • interval_min/max:12.0s / 94.9s
  • trigger_min/max:10.0s / 94.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 77.7s
  • uptime_min/max:44.12% / 86.07%

Stack Uptimes

  • visceral_strength_1:68.16%

Spelldata

  • id:461130
  • name:Visceral Strength
  • tooltip:Your Strength is increased by {$=}w1%.
  • description:{$@spelldesc434157=When {$?a137008=true}[Crimson Scourge][Sudden Doom] is consumed, you gain {$?a137008=true}[{$461130s1=12}][{$434159s1=8}]% Strength for {$?a137008=true}[{$461130d=12 seconds}][{$434159d=5 seconds}].{$?a137007=false}[ When Scourge Strike consumes Virulent Plague, your next Outbreak costs no Runes and casts Death Coil or Epidemic at {$s1=100}% effectiveness, whichever you most recently cast.]?a137008[ When Blood Boil hits {$s2=2} or more targets, it generates {$s3=1} charge of Bone Shield.][]}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Beledar's Bounty

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_beledars_bounty
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:470.00

Spelldata

  • id:461957
  • name:Well Fed
  • tooltip:Mastery increased by {$=}w9.
  • description:Increases Mastery by {$s1=0} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Crystallization

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_crystallization
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:733.25

Spelldata

  • id:453250
  • name:Crystallization
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=733} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Fathomdweller's Runed Citrine

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_fathomdwellers_runed_citrine
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:1983.23

Spelldata

  • id:462535
  • name:Fathomdweller's Runed Citrine
  • tooltip:
  • description:Grants {$?a462535=false}[{$=}w1]?a462342[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=80}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=80}/100)*({$462342s5=5663}/3)}] Mastery. In addition, all other Singing Citrine effects are increased based on your total Mastery.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Alchemical Chaos

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_flask_of_alchemical_chaos
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:30.00

Spelldata

  • id:432021
  • name:Flask of Alchemical Chaos
  • tooltip:Your stats are being randomized every {$t5=30} sec. {$?=}{$=}W1>0[ Critical strike increased by {$=}w1.][]{$?=}{$=}W2>0[ Versatility increased by {$=}w2.][]{$?=}{$=}W3>0[ Haste increased by {$=}w3.][]{$?=}{$=}W4>0[ Mastery increased by {$=}w4.][] {$?=}{$=}W1<0[ Critical strike reduced by {$=}w1.][]{$?=}{$=}W2<0[ Versatility reduced by {$=}w2.][]{$?=}{$=}W3<0[ Haste reduced by {$=}w3.][]{$?=}{$=}W4<0[ Mastery reduced by {$=}w4.][]
  • description:Drink to increase a random secondary stat by {$s5=5290} at the cost of {$s6=442} of two other secondary stats. These effects are randomized again every {$t5=30} sec. {$@spelldesc431970=Lasts {$d=3600 seconds} and through death. Consuming an identical flask will add another {$d=3600 seconds}.}
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%
Windsinger's Runed Citrine (Crit)

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_windsingers_runed_citrine_Crit
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:2640.76

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (Haste)

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_windsingers_runed_citrine_Haste
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:2640.76

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Windsinger's Runed Citrine (Mastery)

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_windsingers_runed_citrine_Mastery
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2478.98
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:2640.76

Spelldata

  • id:462534
  • name:Windsinger's Runed Citrine
  • tooltip:
  • description:Grants {$?a462342=false}[{$=}{({$462342=}w2/{$462342s3=10779})*({$s2=100}/100)*({$462342s5=5663}/3)}][{$=}{({$s2=100}/100)*({$462342s5=5663}/3)}] of your highest secondary stat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Blood Beast6.35.08.050.7s35.0s75.8s
Bloodworms27.713.051.010.5s0.8s38.2s
Rune ready141.2108.0177.02.2s0.0s10.0s
Skyfury (Main Hand)29.711.058.09.8s0.8s111.4s
Vampiric Strike Proc24.911.044.011.2s0.8s148.4s
Vampiric Strike Proc Wasted0.80.06.0101.6s0.8s291.9s
parry_haste22.97.043.012.6s2.0s190.0s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap0.22%0.00%1.45%0.9s0.0s2.3s
ghoul - Energy Cap1.83%1.64%2.46%1.0s1.0s1.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Death's Caress25.9070.000145.659246.714180.162307.470
Vampiric Blood0.7310.0001.2537.6341.99712.230
Bonestorm0.5030.00022.9942.7480.86124.493
Soul Reaper19.7290.000232.973231.325174.676282.594
Blood Boil10.7550.00051.099206.633134.342285.271
Death and Decay0.8990.0009.33117.2604.91455.264
Tombstone9.2580.00047.63544.07115.164101.692
Consumption10.4510.00081.34881.78730.633143.351
Raise Dead0.0000.0000.2070.0000.0000.207
Dancing Rune Weapon0.3720.0001.3922.3650.0005.689

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=189797)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.1041.471 / 0.9674.19413.097
Total Seconds per Iteration (n=10023)
Minimum 5th percentile Mean / Median 95th percentile Maximum
8.16414.81027.850 / 26.79144.38070.425

Player Effects

TypeSpellID#ValueSourceNotes
Auto Attack SpeedIcy Talons19487916.0%Spell Data
Attribute MultiplierRune Mastery37458516.0%Spell DataStrength
Veteran of the Third War48263120.0%Spell DataPassive, Stamina
Blood Fortification374721130.0%Spell DataPassive, Stamina
Matching ArmorPlate Specialization8653715.0%Spell DataPassive, Stamina
VersatilityPerseverance of the Ebon Blade37474816.0%Spell Data
Player MultiplierBlood Shield77535225.0%Spell DataPhysical
Pet MultiplierBlood Death Knight1370081276.0%Spell DataPassive, Pet
Blood Death Knight1370081376.0%Spell DataPassive, Guardian
Luck of the Draw!1218601615.0%Spell DataPet
Attack Power MultiplierMastery: Blood Shield7751321.00000Spell DataMastery, Passive
ExpertiseBlood Death Knight13700883.0%Spell DataPassive
Crit AvoidanceRunic Protection4547882-3.0%Spell DataPassive
Blood Death Knight1370086-6.0%Spell DataPassive
ParryDancing Rune Weapon81256135.0%Spell Data
Armor MultiplierRunic Protection45478816.0%Spell DataPassive
HasteUnholy Momentum37426512.0%Spell DataPassive
Bone Shield195181410.0%Spell DataNo-stacks
Essence of the Blood Queen433925110.0%Spell DataValue-function
Parry Rating from CritRiposte1617971100.0%Spell DataPassive
Healing ReceivedVampiric Blood55233130.0%Spell Data
Sanguine Ground39145925.0%Spell Data
Absorb Received MultiplierGloom Ward391571115.0%Spell DataPassive
Vampiric Blood55233330.0%Spell Data
Target MultiplierIncite Terror45847811.0%Shadow
Target Pet MultiplierBrittle37455726.0%Pet
Brittle37455736.0%Guardian
War32709624.8%Pet
War32709634.8%Guardian
Incite Terror45847821.0%Pet
Incite Terror45847831.0%Guardian

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Ácyd
ConsumptionRune15.3615.3610.88%1.000.000.00%
HeartbreakerRunic Power123.09246.189.09%2.000.000.00%
Rune RegenerationRune125.87125.8789.12%1.000.000.00%
Runic AttenuationRunic Power84.20252.069.31%2.990.540.21%
TombstoneRunic Power4.76138.705.12%29.163.992.80%
Blood Plague (_heal)Health118.1231,311,760.7210.54%265,078.68583,455.471.83%
Bonestorm (_heal)Health53.6118,226,217.656.13%339,969.111,453,244.437.38%
Consumption (_heal)Health7.683,614,028.741.22%470,568.35126,452.653.38%
Death Strike (_heal)Health86.73200,820,220.6767.58%2,315,546.342,261,261.301.11%
Death's CaressRunic Power8.9889.803.32%10.000.010.01%
Heart StrikeRunic Power48.24723.5526.73%15.000.000.00%
MarrowrendRunic Power0.9819.590.72%20.000.000.00%
Soul ReaperRunic Power11.46114.604.23%10.000.000.00%
Unholy StrengthHealth24.4219,601,128.176.60%802,688.84795,839.703.90%
Vampiric StrikeRunic Power74.861,122.8441.47%15.000.000.00%
Vampiric Strike (_heal)Health74.8623,602,994.437.94%315,312.281,193,142.944.81%
pet - ghoul
Energy RegenEnergy245.282,400.09100.00%9.7978.863.18%
pet - dancing_rune_weapon
ConsumptionRune0.510.000.00%0.001.02100.00%
pet - everlasting_bond
ConsumptionRune0.510.000.00%0.001.02100.00%
Usage Type Count Total Tot% Avg RPE APR
Ácyd
Death StrikeRunic Power86.732,668.41100.00%30.7730.7731,666.85
Death's CaressRune8.988.986.17%1.001.1389,844.17
Heart StrikeRune48.2448.2433.15%1.000.392,313,834.62
MarrowrendRune0.981.961.35%2.002.00204,615.70
Soul ReaperRune11.4611.467.88%1.001.001,223,894.93
Vampiric StrikeRune74.8674.8651.45%1.001.001,319,872.13
pet - ghoul
ClawEnergy65.582,623.03100.00%40.0040.011,246.69
pet - dancing_rune_weapon
Death StrikeRunic Power45.821,832.67100.00%40.0040.0016,737.10
Vampiric StrikeRune101.83101.83100.00%1.001.00287,930.42
Change Start Gain/s Loss/s Overflow End (Avg) Min Max
Health13,445,780.01,320,914.231,545,034.4710,587,959.0-27,504,191.5-123,250,088.613,445,780.0
Runic Power10.09.028.894.539.00.0125.0
Rune5.00.470.480.01.70.05.0

Statistics & Data Analysis

Fight Length
Ácyd Fight Length
Count 9999
Mean 300.04
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Ácyd Damage Per Second
Count 9999
Mean 1270081.55
Minimum 1099410.89
Maximum 1468758.38
Spread ( max - min ) 369347.49
Range [ ( max - min ) / 2 * 100% ] 14.54%
Standard Deviation 42817.4033
5th Percentile 1201632.24
95th Percentile 1342444.55
( 95th Percentile - 5th Percentile ) 140812.31
Mean Distribution
Standard Deviation 428.1954
95.00% Confidence Interval ( 1269242.30 - 1270920.80 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4366
0.1 Scale Factor Error with Delta=300 15650360
0.05 Scale Factor Error with Delta=300 62601439
0.01 Scale Factor Error with Delta=300 1565035956
Priority Target DPS
Ácyd Priority Target Damage Per Second
Count 9999
Mean 1270081.55
Minimum 1099410.89
Maximum 1468758.38
Spread ( max - min ) 369347.49
Range [ ( max - min ) / 2 * 100% ] 14.54%
Standard Deviation 42817.4033
5th Percentile 1201632.24
95th Percentile 1342444.55
( 95th Percentile - 5th Percentile ) 140812.31
Mean Distribution
Standard Deviation 428.1954
95.00% Confidence Interval ( 1269242.30 - 1270920.80 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4366
0.1 Scale Factor Error with Delta=300 15650360
0.05 Scale Factor Error with Delta=300 62601439
0.01 Scale Factor Error with Delta=300 1565035956
DPS(e)
Ácyd Damage Per Second (Effective)
Count 9999
Mean 1270081.55
Minimum 1099410.89
Maximum 1468758.38
Spread ( max - min ) 369347.49
Range [ ( max - min ) / 2 * 100% ] 14.54%
Damage
Ácyd Damage
Count 9999
Mean 281034386.96
Minimum 202723910.86
Maximum 366957267.80
Spread ( max - min ) 164233356.94
Range [ ( max - min ) / 2 * 100% ] 29.22%
DTPS
Ácyd Damage Taken Per Second
Count 9999
Mean 1547692.18
Minimum 1250183.30
Maximum 1888235.41
Spread ( max - min ) 638052.10
Range [ ( max - min ) / 2 * 100% ] 20.61%
Standard Deviation 89364.7152
5th Percentile 1400509.89
95th Percentile 1696114.68
( 95th Percentile - 5th Percentile ) 295604.79
Mean Distribution
Standard Deviation 893.6918
95.00% Confidence Interval ( 1545940.58 - 1549443.78 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 129
0.1% Error 12808
0.1 Scale Factor Error with Delta=300 68173536
0.05 Scale Factor Error with Delta=300 272694144
0.01 Scale Factor Error with Delta=300 6817353590
HPS
Ácyd Healing Per Second
Count 9999
Mean 991092.13
Minimum 836421.17
Maximum 1117782.80
Spread ( max - min ) 281361.63
Range [ ( max - min ) / 2 * 100% ] 14.19%
Standard Deviation 36774.7039
5th Percentile 929708.82
95th Percentile 1051846.15
( 95th Percentile - 5th Percentile ) 122137.33
Mean Distribution
Standard Deviation 367.7654
95.00% Confidence Interval ( 990371.32 - 991812.93 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5289
0.1 Scale Factor Error with Delta=300 11544684
0.05 Scale Factor Error with Delta=300 46178735
0.01 Scale Factor Error with Delta=300 1154468365
HPS(e)
Ácyd Healing Per Second (Effective)
Count 9999
Mean 991092.13
Minimum 836421.17
Maximum 1117782.80
Spread ( max - min ) 281361.63
Range [ ( max - min ) / 2 * 100% ] 14.19%
Heal
Ácyd Heal
Count 9999
Mean 297168442.98
Minimum 203180085.49
Maximum 378945788.87
Spread ( max - min ) 175765703.38
Range [ ( max - min ) / 2 * 100% ] 29.57%
HTPS
Ácyd Healing Taken Per Second
Count 9999
Mean 1321428.72
Minimum 1132791.93
Maximum 1457000.62
Spread ( max - min ) 324208.69
Range [ ( max - min ) / 2 * 100% ] 12.27%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
1 0.00 deaths_caress
Default action list Executed every time the actor is available.
# count action,conditions
2 1.00 auto_attack
0.00 use_item,name=tome_of_lights_devotion,if=buff.inner_resilience.up,use_off_gcd=1
0.00 use_item,name=unyielding_netherprism,if=cooldown.dancing_rune_weapon.remains<1|target.time_to_die<=20,use_off_gcd=1
0.00 use_items
0.00 use_item,name=bestinslots,use_off_gcd=1
0.00 blood_fury,if=buff.dancing_rune_weapon.up
0.00 berserking,if=buff.dancing_rune_weapon.up
0.00 ancestral_call,if=buff.dancing_rune_weapon.up
0.00 fireblood,if=buff.dancing_rune_weapon.up
3 1.44 potion,if=buff.dancing_rune_weapon.up
4 10.43 vampiric_blood,if=!buff.vampiric_blood.up
5 0.00 call_action_list,name=high_prio_actions
6 0.00 run_action_list,name=deathbringer,if=hero_tree.deathbringer
7 0.00 run_action_list,name=san_drw,if=hero_tree.sanlayn&buff.dancing_rune_weapon.up
8 0.00 run_action_list,name=sanlayn,if=hero_tree.sanlayn
actions.high_prio_actions
# count action,conditions
9 3.00 raise_dead,use_off_gcd=1
0.00 blood_tap,if=(rune<=2&rune.time_to_3>gcd&charges_fractional>=1.8)
0.00 blood_tap,if=(rune<=1&rune.time_to_3>gcd)
A 0.26 death_strike,if=buff.coagulopathy.up&buff.coagulopathy.remains<=gcd
B 6.35 dancing_rune_weapon
actions.san_drw
# count action,conditions
C 0.08 heart_strike,if=buff.essence_of_the_blood_queen.remains<1.5&buff.essence_of_the_blood_queen.remains
D 1.19 bonestorm,if=buff.bone_shield.stack>=5
E 16.27 death_strike,if=runic_power.deficit<36
F 6.33 blood_boil,if=!drw.bp_ticking
G 5.45 any_dnd,if=(active_enemies<=3&buff.crimson_scourge.remains)|(active_enemies>3&!buff.death_and_decay.remains)
H 50.83 heart_strike
I 6.38 death_strike
J 0.51 consumption
K 0.05 blood_boil
actions.sanlayn
# count action,conditions
0.00 blood_boil,if=(!buff.bone_shield.up|buff.bone_shield.remains<1.5|buff.bone_shield.stack<=1)&active_enemies>=2
L 3.40 deaths_caress,if=!buff.bone_shield.up|buff.bone_shield.remains<1.5|buff.bone_shield.stack<=1
M 6.13 blood_boil,if=dot.blood_plague.remains<3
N 0.12 heart_strike,if=(buff.essence_of_the_blood_queen.remains<1.5&buff.essence_of_the_blood_queen.remains&buff.vampiric_strike.remains)
O 4.26 bonestorm,if=buff.bone_shield.stack>=5&(buff.death_and_decay.remains|active_enemies<=3)
P 4.12 death_strike,if=runic_power.deficit<20
Q 3.55 consumption,if=buff.infliction_of_sorrow.up&buff.death_and_decay.up
R 24.51 heart_strike,if=(buff.infliction_of_sorrow.up|buff.vampiric_strike.up)&buff.death_and_decay.up
S 11.46 soul_reaper,if=active_enemies<=2&target.time_to_pct_35<5&target.time_to_die>(dot.soul_reaper.remains+5)
0.00 blood_boil,if=buff.bone_shield.stack<6&!dot.bonestorm.ticking&active_enemies>=2
T 4.58 deaths_caress,if=buff.bone_shield.stack<6&!dot.bonestorm.ticking
U 0.98 marrowrend,if=buff.bone_shield.stack<6&!dot.bonestorm.ticking
V 4.76 tombstone,if=buff.bone_shield.stack>=6&(buff.death_and_decay.remains|active_enemies<=3)&cooldown.dancing_rune_weapon.remains>=25
W 12.09 any_dnd,if=(active_enemies<=3&buff.crimson_scourge.remains)|(active_enemies>3&!buff.death_and_decay.remains)
0.00 blooddrinker,if=active_enemies<=2&buff.coagulopathy.remains>3
X 4.49 heart_strike,if=buff.vampiric_strike.up
Y 59.70 death_strike
Z 42.78 heart_strike,if=rune>=2
a 3.62 consumption
b 6.07 blood_boil
c 0.28 heart_strike

Sample Sequence

1249B3DFGHHHHHEHEHEHHEIQRMVTPWYYRYYRTY4RZYZZYRWZYbZYZZYbZZBFHHIHHIHI4JGHHHRMOPYYZZYRZWYZZYVTYZY4ZbBFHHGHHEHHEHIHQRMYYZWYZYRZYL4ZYRYR9ZYOZYZZYbZYZWZYaZZYZZBCFGHH4EHEHEHHERMVPWYRYYRZYRLaZ4YZWYZZYOZTYZZYRSWBFHHHHEHIHI4HIJHSWRMYRSYRYVSTWYYRSYYYZZSWY4RYZ9SYOBFHGHHHEHEHHEHQRMSPWYYZS4YZZYZSYZYVTSYZYWSaZYZSYRY4RZ

Sample Sequence Table

Time # Name [List] Target Resources Buffs
Pre1deaths_caress
[precombat]
Fluffy_Pillow 0.0/125 0% RP
13445780.0/13445780 100% HP
6.0/6 100% rune
flask_of_alchemical_chaos_vers
0:00.0002auto_attack
[default]
Fluffy_Pillow 10.0/125 8% RP
13445780.0/13445780 100% HP
5.0/6 83% rune
rune_mastery, bone_shield(2), flask_of_alchemical_chaos_vers
0:00.0004vampiric_blood
[default]
Ácyd 10.0/125 8% RP
13445780.0/13445780 100% HP
5.0/6 83% rune
bloodlust, rune_mastery, bone_shield(2), explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:00.0009raise_dead
[high_prio_actions]
Ácyd 10.0/125 8% RP
17479514.0/17479514 100% HP
5.0/6 83% rune
bloodlust, rune_mastery, bone_shield(2), vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:00.000Bdancing_rune_weapon
[high_prio_actions]
Ácyd 10.0/125 8% RP
17479514.0/17479514 100% HP
5.0/6 83% rune
bloodlust, rune_mastery, bone_shield(2), vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:00.9333potion
[default]
Fluffy_Pillow 10.0/125 8% RP
17479514.0/17479514 100% HP
5.0/6 83% rune
bloodlust, rune_mastery, bone_shield(7), vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:00.933Dbonestorm
[san_drw]
Fluffy_Pillow 10.0/125 8% RP
17479514.0/17479514 100% HP
5.0/6 83% rune
bloodlust, rune_mastery, bone_shield(7), vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:01.830Fblood_boil
[san_drw]
Fluffy_Pillow 10.0/125 8% RP
17479514.0/17479514 100% HP
5.0/6 83% rune
bloodlust, rune_mastery, bone_shield(2), bonestorm, ossified_vitriol(5), vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:02.730Gdeath_and_decay
[san_drw]
Fluffy_Pillow 13.0/125 10% RP
17479514.0/17479514 100% HP
5.0/6 83% rune
bloodlust, rune_mastery, icy_talons, bone_shield(3), bonestorm, ossified_vitriol(5), crimson_scourge, hemostasis, vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:03.628Hheart_strike
[san_drw]
Fluffy_Pillow 13.0/125 10% RP
17479514.0/17479514 100% HP
5.0/6 83% rune
bloodlust, rune_mastery, icy_talons(2), death_and_decay, visceral_strength, bloodsoaked_ground, bone_shield(4), bonestorm, ossified_vitriol(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:04.527Hheart_strike
[san_drw]
Fluffy_Pillow 33.0/125 26% RP
6167039.7/17479514 35% HP
4.0/6 67% rune
bloodlust, blood_draw, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen, visceral_strength, bloodsoaked_ground, bone_shield(5), bonestorm, ossuary, ossified_vitriol(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:05.400Hheart_strike
[san_drw]
Fluffy_Pillow 50.0/125 40% RP
9646111.9/17479514 55% HP
3.0/6 50% rune
bloodlust, blood_draw, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(2), visceral_strength, bloodsoaked_ground, bone_shield(6), bonestorm, ossuary, ossified_vitriol(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:06.248Hheart_strike
[san_drw]
Fluffy_Pillow 70.0/125 56% RP
11610377.1/17479514 66% HP
3.0/6 50% rune
bloodlust, blood_draw, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(3), visceral_strength, bloodsoaked_ground, bone_shield(7), bonestorm, ossuary, ossified_vitriol(5), heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:07.073Hheart_strike
[san_drw]
Fluffy_Pillow 87.0/125 70% RP
12347558.4/17479514 71% HP
2.0/6 33% rune
bloodlust, blood_draw, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(4), visceral_strength, bloodsoaked_ground, bone_shield(8), bonestorm, ossuary, ossified_vitriol(5), heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:07.875Edeath_strike
[san_drw]
Fluffy_Pillow 104.0/125 83% RP
12586153.8/17479514 72% HP
1.0/6 17% rune
bloodlust, blood_draw, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(5), visceral_strength, bloodsoaked_ground, bone_shield(8), bonestorm, ossuary, ossified_vitriol(5), heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:08.655Hheart_strike
[san_drw]
Fluffy_Pillow 79.0/125 63% RP
15686890.6/17479514 90% HP
1.0/6 17% rune
bloodlust, blood_draw, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(5), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), bonestorm, ossuary, ossified_vitriol(5), coagulopathy, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:09.434Edeath_strike
[san_drw]
Fluffy_Pillow 96.0/125 77% RP
16061050.9/17479514 92% HP
1.0/6 17% rune
bloodlust, blood_draw, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(6), visceral_strength, bloodsoaked_ground, bone_shield(10), bonestorm, ossuary, coagulopathy, sanguine_ground, vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:10.197Hheart_strike
[san_drw]
Fluffy_Pillow 74.0/125 59% RP
13445780.0/13445780 100% HP
2.0/6 33% rune
bloodlust, blood_draw, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(6), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), bonestorm, ossuary, coagulopathy(2), sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:10.961Edeath_strike
[san_drw]
Fluffy_Pillow 91.0/125 73% RP
13445780.0/13445780 100% HP
1.0/6 17% rune
bloodlust, blood_draw, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, coagulopathy(2), sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:11.717Hheart_strike
[san_drw]
Fluffy_Pillow 66.0/125 53% RP
13445780.0/13445780 100% HP
2.0/6 33% rune
bloodlust, blood_draw, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, coagulopathy(3), sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:12.472Hheart_strike
[san_drw]
Fluffy_Pillow 83.0/125 66% RP
7115849.3/13445780 53% HP
1.0/6 17% rune
bloodlust, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(3), heartrend, sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:13.227Edeath_strike
[san_drw]
Fluffy_Pillow 100.0/125 80% RP
7011360.7/13445780 52% HP
0.0/6 0% rune
bloodlust, icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(3), heartrend, sanguine_ground, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:13.981Ideath_strike
[san_drw]
Fluffy_Pillow 75.0/125 60% RP
9408310.0/13445780 70% HP
0.0/6 0% rune
bloodlust, icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(4), sanguine_ground, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:14.737Qconsumption
[sanlayn]
Fluffy_Pillow 50.0/125 40% RP
10914656.3/13445780 81% HP
1.0/6 17% rune
bloodlust, icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), infliction_of_sorrow, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), sanguine_ground, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:15.577Rheart_strike
[sanlayn]
Fluffy_Pillow 53.0/125 42% RP
13410420.2/13445780 100% HP
4.0/6 67% rune
bloodlust, icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), infliction_of_sorrow, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol, coagulopathy(5), consumption, sanguine_ground, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:16.418Mblood_boil
[sanlayn]
Fluffy_Pillow 70.0/125 56% RP
9925432.6/13445780 74% HP
4.0/6 67% rune
bloodlust, icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(2), coagulopathy(5), consumption, sanguine_ground, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:17.259Vtombstone
[sanlayn]
Ácyd 73.0/125 58% RP
8673994.0/13445780 65% HP
4.0/6 67% rune
bloodlust, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(10), ossuary, ossified_vitriol(2), coagulopathy(5), consumption, crimson_scourge, hemostasis, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:18.103Tdeaths_caress
[sanlayn]
Fluffy_Pillow 103.0/125 82% RP
5522060.8/13445780 41% HP
4.0/6 67% rune
bloodlust, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, hemostasis, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:18.944Pdeath_strike
[sanlayn]
Fluffy_Pillow 113.0/125 90% RP
5677562.8/13445780 42% HP
3.0/6 50% rune
bloodlust, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, hemostasis, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:19.782Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 88.0/125 70% RP
8482450.9/13445780 63% HP
4.0/6 67% rune
bloodlust, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), blood_shield, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:20.623Ydeath_strike
[sanlayn]
Fluffy_Pillow 88.0/125 70% RP
4368060.9/13445780 32% HP
4.0/6 67% rune
bloodlust, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:21.463Ydeath_strike
[sanlayn]
Fluffy_Pillow 63.0/125 50% RP
6255044.8/13445780 47% HP
5.0/6 83% rune
bloodlust, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:22.303Rheart_strike
[sanlayn]
Fluffy_Pillow 41.0/125 33% RP
1902970.4/13445780 14% HP
5.0/6 83% rune
bloodlust, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:23.144Ydeath_strike
[sanlayn]
Fluffy_Pillow 58.0/125 46% RP
1284871.3/13445780 10% HP
4.0/6 67% rune
bloodlust, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), heartrend, perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:23.982Ydeath_strike
[sanlayn]
Fluffy_Pillow 36.0/125 29% RP
3692209.6/13445780 27% HP
5.0/6 83% rune
bloodlust, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:24.823Rheart_strike
[sanlayn]
Fluffy_Pillow 11.0/125 9% RP
1074577.3/13445780 8% HP
5.0/6 83% rune
bloodlust, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:25.665Tdeaths_caress
[sanlayn]
Fluffy_Pillow 31.0/125 25% RP
1607936.1/13445780 12% HP
4.0/6 67% rune
bloodlust, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:26.506Ydeath_strike
[sanlayn]
Fluffy_Pillow 41.0/125 33% RP
-4357104.2/13445780 -32% HP
3.0/6 50% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:27.3454vampiric_blood
[default]
Ácyd 9.0/125 7% RP
-47628.2/13445780 -0% HP
3.0/6 50% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:27.345Rheart_strike
[sanlayn]
Fluffy_Pillow 9.0/125 7% RP
-61916.7/17479514 -0% HP
3.0/6 50% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:28.185Zheart_strike
[sanlayn]
Fluffy_Pillow 26.0/125 21% RP
-5251369.1/17479514 -30% HP
3.0/6 50% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:29.026Ydeath_strike
[sanlayn]
Fluffy_Pillow 43.0/125 34% RP
-6420601.1/17479514 -37% HP
2.0/6 33% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:29.867Zheart_strike
[sanlayn]
Fluffy_Pillow 8.0/125 6% RP
-3223584.7/17479514 -18% HP
2.0/6 33% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion
0:30.706Zheart_strike
[sanlayn]
Fluffy_Pillow 28.0/125 22% RP
-1176084.7/17479514 -7% HP
2.0/6 33% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, tempered_potion, frost_shield
0:31.547Ydeath_strike
[sanlayn]
Fluffy_Pillow 45.0/125 36% RP
-1448007.7/17479514 -8% HP
2.0/6 33% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:32.416Rheart_strike
[sanlayn]
Fluffy_Pillow 13.0/125 10% RP
722174.8/17479514 4% HP
2.0/6 33% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:33.287Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 30.0/125 24% RP
321801.8/17479514 2% HP
1.0/6 17% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:34.160Zheart_strike
[sanlayn]
Fluffy_Pillow 33.0/125 26% RP
321801.8/17479514 2% HP
2.0/6 33% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:35.031Ydeath_strike
[sanlayn]
Fluffy_Pillow 50.0/125 40% RP
1441733.1/17479514 8% HP
1.0/6 17% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:35.902bblood_boil
[sanlayn]
Fluffy_Pillow 18.0/125 14% RP
4668783.6/17479514 27% HP
1.0/6 17% rune
bloodlust, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:36.772Zheart_strike
[sanlayn]
Fluffy_Pillow 18.0/125 14% RP
4668783.6/17479514 27% HP
2.0/6 33% rune
bloodlust, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:37.641Ydeath_strike
[sanlayn]
Fluffy_Pillow 38.0/125 30% RP
3324056.3/13445780 25% HP
2.0/6 33% rune
bloodlust, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:38.512Zheart_strike
[sanlayn]
Fluffy_Pillow 3.0/125 2% RP
4760863.4/13445780 35% HP
2.0/6 33% rune
bloodlust, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:39.383Zheart_strike
[sanlayn]
Fluffy_Pillow 23.0/125 18% RP
4961812.4/13445780 37% HP
2.0/6 33% rune
bloodlust, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:40.254Ydeath_strike
[sanlayn]
Fluffy_Pillow 40.0/125 32% RP
6710096.0/13445780 50% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:41.385bblood_boil
[sanlayn]
Fluffy_Pillow 8.0/125 6% RP
7232041.4/13445780 54% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:42.516Zheart_strike
[sanlayn]
Fluffy_Pillow 8.0/125 6% RP
7395517.0/13445780 55% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), hemostasis, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:43.647Zheart_strike
[sanlayn]
Fluffy_Pillow 28.0/125 22% RP
6827707.5/13445780 51% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), hemostasis, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:44.778Bdancing_rune_weapon
[high_prio_actions]
Ácyd 45.0/125 36% RP
7000991.1/13445780 52% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), hemostasis, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:46.130Fblood_boil
[san_drw]
Fluffy_Pillow 45.0/125 36% RP
7368082.4/13445780 55% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, hemostasis, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:47.131Hheart_strike
[san_drw]
Fluffy_Pillow 45.0/125 36% RP
6156832.3/13445780 46% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, hemostasis(2), sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:48.131Hheart_strike
[san_drw]
Fluffy_Pillow 65.0/125 52% RP
6893734.6/13445780 51% HP
1.0/6 17% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, hemostasis(2), astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:49.132Ideath_strike
[san_drw]
Fluffy_Pillow 82.0/125 66% RP
5749813.4/13445780 43% HP
0.0/6 0% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, heartrend, hemostasis(2), astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:50.133Hheart_strike
[san_drw]
Fluffy_Pillow 47.0/125 38% RP
8876291.0/13445780 66% HP
1.0/6 17% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, blood_shield, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:51.133Hheart_strike
[san_drw]
Fluffy_Pillow 64.0/125 51% RP
8885185.4/13445780 66% HP
1.0/6 17% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:52.134Ideath_strike
[san_drw]
Fluffy_Pillow 84.0/125 67% RP
9019643.2/13445780 67% HP
0.0/6 0% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
0:53.135Hheart_strike
[san_drw]
Fluffy_Pillow 49.0/125 39% RP
10594659.8/13445780 79% HP
1.0/6 17% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
0:54.136Ideath_strike
[san_drw]
Fluffy_Pillow 69.0/125 55% RP
10729117.6/13445780 80% HP
0.0/6 0% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
0:55.0854vampiric_blood
[default]
Ácyd 34.0/125 27% RP
12662578.2/13445780 94% HP
0.0/6 0% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
0:55.085Jconsumption
[san_drw]
Fluffy_Pillow 34.0/125 27% RP
16461351.6/17479514 94% HP
0.0/6 0% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, vampiric_blood, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
0:56.036Gdeath_and_decay
[san_drw]
Fluffy_Pillow 34.0/125 27% RP
16819332.6/17479514 96% HP
3.0/6 50% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(11), ossuary, coagulopathy(5), consumption, crimson_scourge, dancing_rune_weapon, vampiric_blood, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
0:56.988Hheart_strike
[san_drw]
Fluffy_Pillow 34.0/125 27% RP
16819332.6/17479514 96% HP
4.0/6 67% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
0:57.938Hheart_strike
[san_drw]
Fluffy_Pillow 54.0/125 43% RP
17188494.6/17479514 98% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
0:58.888Hheart_strike
[san_drw]
Fluffy_Pillow 71.0/125 57% RP
17427090.0/17479514 100% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, dancing_rune_weapon, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
0:59.837Rheart_strike
[sanlayn]
Fluffy_Pillow 91.0/125 73% RP
17248513.2/17479514 99% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), infliction_of_sorrow, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, astral_antenna, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:00.911Mblood_boil
[sanlayn]
Fluffy_Pillow 108.0/125 86% RP
17479514.0/17479514 100% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), consumption, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, astral_antenna, astral_antenna_orb, flask_of_alchemical_chaos_haste, frost_shield
1:01.986Obonestorm
[sanlayn]
Fluffy_Pillow 111.0/125 89% RP
16293696.0/17479514 93% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, astral_antenna, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:03.061Pdeath_strike
[sanlayn]
Fluffy_Pillow 111.0/125 89% RP
-3750623.2/17479514 -21% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), heartrend, hemostasis, sanguine_ground, vampiric_blood, astral_antenna, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:04.134Ydeath_strike
[sanlayn]
Fluffy_Pillow 79.0/125 63% RP
7230864.7/17479514 41% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(7), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:05.207Ydeath_strike
[sanlayn]
Fluffy_Pillow 44.0/125 35% RP
9328294.9/13445780 69% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(8), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:06.280Zheart_strike
[sanlayn]
Fluffy_Pillow 9.0/125 7% RP
7271555.8/13445780 54% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:07.354Zheart_strike
[sanlayn]
Fluffy_Pillow 29.0/125 23% RP
7553917.1/13445780 56% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:08.427Ydeath_strike
[sanlayn]
Fluffy_Pillow 46.0/125 37% RP
270274.8/13445780 2% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:09.501Rheart_strike
[sanlayn]
Fluffy_Pillow 14.0/125 11% RP
4062668.7/13445780 30% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(11), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:10.574Zheart_strike
[sanlayn]
Fluffy_Pillow 31.0/125 25% RP
-333077.7/13445780 -2% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(11), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:11.650Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 48.0/125 38% RP
-64162.1/13445780 -0% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(12), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, heartrend, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:12.725Ydeath_strike
[sanlayn]
Fluffy_Pillow 48.0/125 38% RP
-7598749.0/13445780 -57% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), heartrend, perseverance_of_the_ebon_blade, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:13.799Zheart_strike
[sanlayn]
Fluffy_Pillow 16.0/125 13% RP
-2931159.2/13445780 -22% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:14.873Zheart_strike
[sanlayn]
Fluffy_Pillow 33.0/125 26% RP
-8799381.4/13445780 -65% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:15.948Ydeath_strike
[sanlayn]
Fluffy_Pillow 53.0/125 42% RP
-7093391.8/13445780 -53% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:17.023Vtombstone
[sanlayn]
Ácyd 18.0/125 14% RP
-5599988.5/13445780 -42% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:18.333Tdeaths_caress
[sanlayn]
Fluffy_Pillow 48.0/125 38% RP
-9853672.5/13445780 -73% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(5), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:19.408Ydeath_strike
[sanlayn]
Fluffy_Pillow 61.0/125 49% RP
-9853672.5/13445780 -73% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:20.484Zheart_strike
[sanlayn]
Fluffy_Pillow 26.0/125 21% RP
-14581654.0/13445780 -108% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:21.559Ydeath_strike
[sanlayn]
Fluffy_Pillow 43.0/125 34% RP
-14457548.2/13445780 -108% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:22.6344vampiric_blood
[default]
Ácyd 8.0/125 6% RP
-19514317.9/13445780 -145% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:22.634Zheart_strike
[sanlayn]
Fluffy_Pillow 8.0/125 6% RP
-25368613.2/17479514 -145% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:23.709bblood_boil
[sanlayn]
Fluffy_Pillow 25.0/125 20% RP
-25197595.1/17479514 -144% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:24.840Bdancing_rune_weapon
[high_prio_actions]
Ácyd 25.0/125 20% RP
-25298076.6/17479514 -145% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, sanguine_ground, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:26.130Fblood_boil
[san_drw]
Fluffy_Pillow 25.0/125 20% RP
-31999864.3/17479514 -183% HP
3.0/6 50% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:27.130Hheart_strike
[san_drw]
Fluffy_Pillow 25.0/125 20% RP
-30909142.6/17479514 -177% HP
3.0/6 50% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis(2), vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:28.131Hheart_strike
[san_drw]
Fluffy_Pillow 45.0/125 36% RP
-31953407.9/17479514 -183% HP
3.0/6 50% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis(2), vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:29.131Gdeath_and_decay
[san_drw]
Fluffy_Pillow 62.0/125 50% RP
-31423887.8/17479514 -180% HP
2.0/6 33% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, dancing_rune_weapon, hemostasis(2), vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:30.132Hheart_strike
[san_drw]
Fluffy_Pillow 62.0/125 50% RP
-37238158.6/17479514 -213% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis(2), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:31.132Hheart_strike
[san_drw]
Fluffy_Pillow 82.0/125 66% RP
-36804824.1/17479514 -211% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis(2), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:32.132Edeath_strike
[san_drw]
Fluffy_Pillow 99.0/125 79% RP
-37759317.1/17479514 -216% HP
2.0/6 33% rune
death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis(2), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:33.133Hheart_strike
[san_drw]
Fluffy_Pillow 64.0/125 51% RP
-24687504.7/13445780 -184% HP
2.0/6 33% rune
icy_talons, death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:34.132Hheart_strike
[san_drw]
Fluffy_Pillow 81.0/125 65% RP
-24389136.9/13445780 -181% HP
1.0/6 17% rune
rune_mastery, icy_talons, death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:35.134Edeath_strike
[san_drw]
Fluffy_Pillow 101.0/125 81% RP
-22249414.2/13445780 -165% HP
1.0/6 17% rune
rune_mastery, icy_talons, death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:36.134Hheart_strike
[san_drw]
Fluffy_Pillow 66.0/125 53% RP
-20786658.0/13445780 -155% HP
1.0/6 17% rune
rune_mastery, icy_talons(2), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:37.136Ideath_strike
[san_drw]
Fluffy_Pillow 83.0/125 66% RP
-20645477.3/13445780 -154% HP
0.0/6 0% rune
rune_mastery, icy_talons(2), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:38.139Hheart_strike
[san_drw]
Fluffy_Pillow 48.0/125 38% RP
-20245513.2/13445780 -151% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), dancing_rune_weapon, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:39.139Qconsumption
[sanlayn]
Fluffy_Pillow 65.0/125 52% RP
-19946498.6/13445780 -148% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), infliction_of_sorrow, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:40.269Rheart_strike
[sanlayn]
Fluffy_Pillow 65.0/125 52% RP
-19281071.6/13445780 -143% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), infliction_of_sorrow, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), consumption, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:41.399Mblood_boil
[sanlayn]
Fluffy_Pillow 85.0/125 68% RP
-19281071.6/13445780 -143% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), consumption, sanguine_ground, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:42.529Ydeath_strike
[sanlayn]
Fluffy_Pillow 85.0/125 68% RP
-20533131.5/13445780 -153% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), consumption, hemostasis, sanguine_ground, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:43.659Ydeath_strike
[sanlayn]
Fluffy_Pillow 50.0/125 40% RP
-18428907.7/13445780 -137% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), blood_shield, bone_shield(9), ossuary, coagulopathy(5), consumption, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:44.790Zheart_strike
[sanlayn]
Fluffy_Pillow 15.0/125 12% RP
-17097299.8/13445780 -127% HP
3.0/6 50% rune
icebound_fortitude, rune_mastery, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(9), ossuary, coagulopathy(5), consumption, luck_of_the_draw, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:45.921Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 35.0/125 28% RP
-14811741.4/13445780 -110% HP
3.0/6 50% rune
icebound_fortitude, rune_mastery, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(9), ossuary, coagulopathy(5), crimson_scourge, luck_of_the_draw, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:47.052Ydeath_strike
[sanlayn]
Fluffy_Pillow 35.0/125 28% RP
-15457106.6/13445780 -115% HP
4.0/6 67% rune
icebound_fortitude, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:48.182Zheart_strike
[sanlayn]
Fluffy_Pillow 10.0/125 8% RP
-14958381.9/13445780 -111% HP
4.0/6 67% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:49.312Ydeath_strike
[sanlayn]
Fluffy_Pillow 30.0/125 24% RP
-14766770.6/13445780 -110% HP
4.0/6 67% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:50.444Rheart_strike
[sanlayn]
Fluffy_Pillow 5.0/125 4% RP
-12620104.4/13445780 -94% HP
4.0/6 67% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:51.573Zheart_strike
[sanlayn]
Fluffy_Pillow 22.0/125 18% RP
-12055381.6/13445780 -90% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
1:52.703Ydeath_strike
[sanlayn]
Fluffy_Pillow 39.0/125 31% RP
-12537551.2/13445780 -93% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
1:53.834Ldeaths_caress
[sanlayn]
Fluffy_Pillow 14.0/125 11% RP
-11419000.6/13445780 -85% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:54.9084vampiric_blood
[default]
Ácyd 24.0/125 19% RP
-11788133.5/13445780 -88% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:54.908Zheart_strike
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
-15324573.5/17479514 -88% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:55.983Ydeath_strike
[sanlayn]
Fluffy_Pillow 44.0/125 35% RP
-13277073.5/17479514 -76% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
1:57.057Rheart_strike
[sanlayn]
Fluffy_Pillow 19.0/125 15% RP
-11913522.0/17479514 -68% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:58.133Ydeath_strike
[sanlayn]
Fluffy_Pillow 39.0/125 31% RP
-12868307.8/17479514 -74% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
1:59.209Rheart_strike
[sanlayn]
Fluffy_Pillow 4.0/125 3% RP
-10977958.0/17479514 -63% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:00.0009raise_dead
[high_prio_actions]
Ácyd 24.0/125 19% RP
-7370653.4/17479514 -42% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), blood_shield, bone_shield(11), ossuary, coagulopathy(5), vampiric_blood, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
2:00.284Zheart_strike
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
-8151733.9/17479514 -47% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(11), ossuary, coagulopathy(5), vampiric_blood, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:01.360Ydeath_strike
[sanlayn]
Fluffy_Pillow 41.0/125 33% RP
-8151733.9/17479514 -47% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(11), ossuary, coagulopathy(5), vampiric_blood, flask_of_alchemical_chaos_haste
2:02.436Obonestorm
[sanlayn]
Fluffy_Pillow 6.0/125 5% RP
-30647935.7/17479514 -175% HP
1.0/6 17% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(10), ossuary, ossified_vitriol, coagulopathy(5), vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:03.510Zheart_strike
[sanlayn]
Fluffy_Pillow 6.0/125 5% RP
-30193468.4/17479514 -173% HP
2.0/6 33% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(6), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:04.584Ydeath_strike
[sanlayn]
Fluffy_Pillow 26.0/125 21% RP
-38802750.0/17479514 -222% HP
1.0/6 17% rune
blood_draw, rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(7), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), vampiric_blood, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:05.658Zheart_strike
[sanlayn]
Fluffy_Pillow 1.0/125 1% RP
-18168642.7/13445780 -135% HP
2.0/6 33% rune
blood_draw, rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), blood_shield, bone_shield(8), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:06.732Zheart_strike
[sanlayn]
Fluffy_Pillow 21.0/125 17% RP
-23367708.5/13445780 -174% HP
2.0/6 33% rune
blood_draw, rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(8), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:07.805Ydeath_strike
[sanlayn]
Fluffy_Pillow 38.0/125 30% RP
-22992418.9/13445780 -171% HP
1.0/6 17% rune
blood_draw, rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(9), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:08.879bblood_boil
[sanlayn]
Fluffy_Pillow 16.0/125 13% RP
-28205649.9/13445780 -210% HP
1.0/6 17% rune
blood_draw, rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(10), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
2:09.954Zheart_strike
[sanlayn]
Fluffy_Pillow 16.0/125 13% RP
-29149782.9/13445780 -217% HP
2.0/6 33% rune
blood_draw, rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(11), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:11.029Ydeath_strike
[sanlayn]
Fluffy_Pillow 33.0/125 26% RP
-35074882.3/13445780 -261% HP
1.0/6 17% rune
blood_draw, rune_mastery, icy_talons(3), essence_of_the_blood_queen(7), bone_shield(11), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), hemostasis, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
2:12.105Zheart_strike
[sanlayn]
Fluffy_Pillow 8.0/125 6% RP
-29511164.8/13445780 -219% HP
2.0/6 33% rune
icy_talons(3), essence_of_the_blood_queen(7), blood_shield, bone_shield(12), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
2:13.181Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 25.0/125 20% RP
-28528972.9/13445780 -212% HP
1.0/6 17% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:14.256Zheart_strike
[sanlayn]
Fluffy_Pillow 25.0/125 20% RP
-34982131.2/13445780 -260% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:15.330Ydeath_strike
[sanlayn]
Fluffy_Pillow 42.0/125 34% RP
-34452422.7/13445780 -256% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:16.404aconsumption
[sanlayn]
Fluffy_Pillow 7.0/125 6% RP
-37438507.3/13445780 -278% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:17.478Zheart_strike
[sanlayn]
Fluffy_Pillow 10.0/125 8% RP
-38150468.9/13445780 -284% HP
4.0/6 67% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:18.551Zheart_strike
[sanlayn]
Fluffy_Pillow 27.0/125 22% RP
-44754696.9/13445780 -333% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:19.627Ydeath_strike
[sanlayn]
Fluffy_Pillow 47.0/125 38% RP
-45799988.4/13445780 -341% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, heartrend, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:20.699Zheart_strike
[sanlayn]
Fluffy_Pillow 12.0/125 10% RP
-44649400.1/13445780 -332% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, sanguine_ground, charged_bolts, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:21.774Zheart_strike
[sanlayn]
Fluffy_Pillow 32.0/125 26% RP
-45630814.4/13445780 -339% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, sanguine_ground, charged_bolts, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
2:22.850Bdancing_rune_weapon
[high_prio_actions]
Ácyd 49.0/125 39% RP
-52263357.5/13445780 -389% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), heartrend, sanguine_ground, charged_bolts, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:23.924Cheart_strike
[san_drw]
Fluffy_Pillow 52.0/125 42% RP
-53541530.2/13445780 -398% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, dancing_rune_weapon, heartrend, sanguine_ground, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:24.925Fblood_boil
[san_drw]
Fluffy_Pillow 69.0/125 55% RP
-53400349.5/13445780 -397% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, dancing_rune_weapon, heartrend, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:25.926Gdeath_and_decay
[san_drw]
Fluffy_Pillow 69.0/125 55% RP
-52801372.9/13445780 -393% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, dancing_rune_weapon, heartrend, hemostasis, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:26.928Hheart_strike
[san_drw]
Fluffy_Pillow 72.0/125 58% RP
-58687176.4/13445780 -436% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:27.929Hheart_strike
[san_drw]
Fluffy_Pillow 89.0/125 71% RP
-59160868.1/13445780 -440% HP
3.0/6 50% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:28.9294vampiric_blood
[default]
Ácyd 106.0/125 85% RP
-58596145.4/13445780 -436% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:28.929Edeath_strike
[san_drw]
Fluffy_Pillow 106.0/125 85% RP
-76174989.0/17479514 -436% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:29.929Hheart_strike
[san_drw]
Fluffy_Pillow 81.0/125 65% RP
-72083295.9/17479514 -412% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:30.930Edeath_strike
[san_drw]
Fluffy_Pillow 101.0/125 81% RP
-68591722.0/17479514 -392% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:31.929Hheart_strike
[san_drw]
Fluffy_Pillow 76.0/125 61% RP
-66097259.0/17479514 -378% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:32.929Edeath_strike
[san_drw]
Fluffy_Pillow 93.0/125 74% RP
-65394790.3/17479514 -374% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:33.929Hheart_strike
[san_drw]
Fluffy_Pillow 68.0/125 54% RP
-63253551.9/17479514 -362% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:34.928Hheart_strike
[san_drw]
Fluffy_Pillow 88.0/125 70% RP
-63014956.5/17479514 -361% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, heartrend, sanguine_ground, vampiric_blood, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:35.929Edeath_strike
[san_drw]
Fluffy_Pillow 105.0/125 84% RP
-61730769.2/17479514 -353% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), dancing_rune_weapon, heartrend, sanguine_ground, vampiric_blood, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:36.928Rheart_strike
[sanlayn]
Fluffy_Pillow 83.0/125 66% RP
-59840419.3/17479514 -342% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), infliction_of_sorrow, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:38.058Mblood_boil
[sanlayn]
Fluffy_Pillow 100.0/125 80% RP
-60356862.4/17479514 -345% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:39.187Vtombstone
[sanlayn]
Ácyd 100.0/125 80% RP
-47668005.1/13445780 -355% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(11), ossuary, coagulopathy(5), crimson_scourge, hemostasis, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:40.318Pdeath_strike
[sanlayn]
Fluffy_Pillow 125.0/125 100% RP
-46168005.1/13445780 -343% HP
2.0/6 33% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, hemostasis, tombstone, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:41.447Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 90.0/125 72% RP
-44683179.1/13445780 -332% HP
2.0/6 33% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, tombstone, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:42.577Ydeath_strike
[sanlayn]
Fluffy_Pillow 90.0/125 72% RP
-44683179.1/13445780 -332% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:43.710Rheart_strike
[sanlayn]
Fluffy_Pillow 58.0/125 46% RP
-42668621.1/13445780 -317% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:44.840Ydeath_strike
[sanlayn]
Fluffy_Pillow 75.0/125 60% RP
-42527440.4/13445780 -316% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:45.972Ydeath_strike
[sanlayn]
Fluffy_Pillow 40.0/125 32% RP
-39444076.3/13445780 -293% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:47.104Rheart_strike
[sanlayn]
Fluffy_Pillow 5.0/125 4% RP
-38263265.0/13445780 -285% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:48.234Zheart_strike
[sanlayn]
Fluffy_Pillow 22.0/125 18% RP
-38122084.3/13445780 -284% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:49.367Ydeath_strike
[sanlayn]
Fluffy_Pillow 39.0/125 31% RP
-39055877.2/13445780 -290% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:50.499Rheart_strike
[sanlayn]
Fluffy_Pillow 7.0/125 6% RP
-36362326.6/13445780 -270% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:51.628Ldeaths_caress
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
-36490296.2/13445780 -271% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
2:52.759aconsumption
[sanlayn]
Fluffy_Pillow 34.0/125 27% RP
-35812628.9/13445780 -266% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), sanguine_ground, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
2:53.888Zheart_strike
[sanlayn]
Fluffy_Pillow 34.0/125 27% RP
-36595829.8/13445780 -272% HP
4.0/6 67% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), consumption, sanguine_ground, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:54.9644vampiric_blood
[default]
Ácyd 54.0/125 43% RP
-36595829.8/13445780 -272% HP
4.0/6 67% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), consumption, sanguine_ground, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
2:54.964Ydeath_strike
[sanlayn]
Fluffy_Pillow 54.0/125 43% RP
-47574578.7/17479514 -272% HP
4.0/6 67% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), consumption, sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
2:56.039Zheart_strike
[sanlayn]
Fluffy_Pillow 19.0/125 15% RP
-44191094.8/17479514 -253% HP
4.0/6 67% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(8), ossuary, coagulopathy(5), consumption, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:57.114Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 39.0/125 31% RP
-45345646.3/17479514 -259% HP
4.0/6 67% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(8), ossuary, coagulopathy(5), consumption, crimson_scourge, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:58.189Ydeath_strike
[sanlayn]
Fluffy_Pillow 39.0/125 31% RP
-45345646.3/17479514 -259% HP
4.0/6 67% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
2:59.264Zheart_strike
[sanlayn]
Fluffy_Pillow 4.0/125 3% RP
-42692617.7/17479514 -244% HP
4.0/6 67% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:00.338Zheart_strike
[sanlayn]
Fluffy_Pillow 21.0/125 17% RP
-40645117.7/17479514 -233% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:01.412Ydeath_strike
[sanlayn]
Fluffy_Pillow 41.0/125 33% RP
-41640845.7/17479514 -238% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, charged_bolts, flask_of_alchemical_chaos_haste, frost_shield
3:02.485Obonestorm
[sanlayn]
Fluffy_Pillow 6.0/125 5% RP
-59361422.4/17479514 -340% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), ossuary, ossified_vitriol, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
3:03.560Zheart_strike
[sanlayn]
Fluffy_Pillow 9.0/125 7% RP
-59730582.0/17479514 -342% HP
4.0/6 67% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(3), bonestorm, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:04.635Tdeaths_caress
[sanlayn]
Fluffy_Pillow 26.0/125 21% RP
-66185144.2/17479514 -379% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(4), bonestorm, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
3:05.709Ydeath_strike
[sanlayn]
Fluffy_Pillow 36.0/125 29% RP
-50188044.4/13445780 -373% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:06.783Zheart_strike
[sanlayn]
Fluffy_Pillow 1.0/125 1% RP
-43532950.8/13445780 -324% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(7), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
3:07.858Zheart_strike
[sanlayn]
Fluffy_Pillow 18.0/125 14% RP
-44526247.0/13445780 -331% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(8), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:08.933Ydeath_strike
[sanlayn]
Fluffy_Pillow 35.0/125 28% RP
-50976660.5/13445780 -379% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
3:10.007Rheart_strike
[sanlayn]
Fluffy_Pillow 3.0/125 2% RP
-45890853.9/13445780 -341% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(10), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:11.082Ssoul_reaper
[sanlayn]
Fluffy_Pillow 20.0/125 16% RP
-45208507.8/13445780 -336% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, blood_shield, bone_shield(11), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:12.158Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 30.0/125 24% RP
-53602234.5/13445780 -399% HP
1.0/6 17% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(11), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
3:13.232Bdancing_rune_weapon
[high_prio_actions]
Ácyd 30.0/125 24% RP
-53319873.1/13445780 -397% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
3:14.307Fblood_boil
[san_drw]
Fluffy_Pillow 30.0/125 24% RP
-60785776.1/13445780 -452% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
3:15.258Hheart_strike
[san_drw]
Fluffy_Pillow 30.0/125 24% RP
-59210776.1/13445780 -440% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
3:16.209Hheart_strike
[san_drw]
Fluffy_Pillow 50.0/125 40% RP
-59433940.9/13445780 -442% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
3:17.160Hheart_strike
[san_drw]
Fluffy_Pillow 67.0/125 54% RP
-58615092.9/13445780 -436% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:18.113Hheart_strike
[san_drw]
Fluffy_Pillow 84.0/125 67% RP
-65708319.6/13445780 -489% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste
3:19.063Edeath_strike
[san_drw]
Fluffy_Pillow 104.0/125 83% RP
-64971539.0/13445780 -483% HP
0.0/6 0% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:20.014Hheart_strike
[san_drw]
Fluffy_Pillow 69.0/125 55% RP
-60316383.2/13445780 -449% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:20.964Ideath_strike
[san_drw]
Fluffy_Pillow 86.0/125 69% RP
-60026303.1/13445780 -446% HP
0.0/6 0% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, sanguine_ground, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:21.915Hheart_strike
[san_drw]
Fluffy_Pillow 51.0/125 41% RP
-58623209.1/13445780 -436% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:22.865Ideath_strike
[san_drw]
Fluffy_Pillow 71.0/125 57% RP
-65817179.9/13445780 -490% HP
0.0/6 0% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_haste, frost_shield
3:23.8144vampiric_blood
[default]
Ácyd 36.0/125 29% RP
-63481836.0/13445780 -472% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:23.814Hheart_strike
[san_drw]
Fluffy_Pillow 36.0/125 29% RP
-82526386.8/17479514 -472% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, vampiric_blood, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:24.811Ideath_strike
[san_drw]
Fluffy_Pillow 56.0/125 45% RP
-82491244.2/17479514 -472% HP
0.0/6 0% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, heartrend, sanguine_ground, vampiric_blood, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:25.807Jconsumption
[san_drw]
Fluffy_Pillow 21.0/125 17% RP
-78553394.3/17479514 -449% HP
0.0/6 0% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, vampiric_blood, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:26.802Hheart_strike
[san_drw]
Fluffy_Pillow 24.0/125 19% RP
-85186172.0/17479514 -487% HP
3.0/6 50% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, dancing_rune_weapon, vampiric_blood, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:27.798Ssoul_reaper
[sanlayn]
Fluffy_Pillow 41.0/125 33% RP
-84612524.8/17479514 -484% HP
2.0/6 33% rune
icebound_fortitude, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), infliction_of_sorrow, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, heartrend, vampiric_blood, luck_of_the_draw, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:28.924Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 51.0/125 41% RP
-90739519.0/17479514 -519% HP
2.0/6 33% rune
icebound_fortitude, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), infliction_of_sorrow, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, heartrend, vampiric_blood, luck_of_the_draw, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:30.051Rheart_strike
[sanlayn]
Fluffy_Pillow 51.0/125 41% RP
-89298797.8/17479514 -511% HP
2.0/6 33% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), infliction_of_sorrow, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:31.177Mblood_boil
[sanlayn]
Fluffy_Pillow 71.0/125 57% RP
-89298797.8/17479514 -511% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:32.305Ydeath_strike
[sanlayn]
Fluffy_Pillow 71.0/125 57% RP
-90489824.3/17479514 -518% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), heartrend, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:33.432Rheart_strike
[sanlayn]
Fluffy_Pillow 49.0/125 39% RP
-86410272.1/17479514 -494% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:34.558Ssoul_reaper
[sanlayn]
Fluffy_Pillow 66.0/125 53% RP
-65735300.5/13445780 -489% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:35.683Ydeath_strike
[sanlayn]
Fluffy_Pillow 76.0/125 61% RP
-64002338.5/13445780 -476% HP
2.0/6 33% rune
icebound_fortitude, rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:36.808Rheart_strike
[sanlayn]
Fluffy_Pillow 51.0/125 41% RP
-62974878.2/13445780 -468% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:37.935Ydeath_strike
[sanlayn]
Fluffy_Pillow 71.0/125 57% RP
-62833697.5/13445780 -467% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), heartrend, sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:39.061Vtombstone
[sanlayn]
Ácyd 46.0/125 37% RP
-62122230.0/13445780 -462% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:40.313Ssoul_reaper
[sanlayn]
Fluffy_Pillow 76.0/125 61% RP
-60547230.0/13445780 -450% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(4), ossified_vitriol(5), coagulopathy(5), sanguine_ground, tombstone, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:41.684Tdeaths_caress
[sanlayn]
Fluffy_Pillow 86.0/125 69% RP
-60398208.7/13445780 -449% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(4), ossified_vitriol(5), coagulopathy(5), sanguine_ground, tombstone, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:42.810Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 99.0/125 79% RP
-60398208.7/13445780 -449% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, sanguine_ground, tombstone, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:43.937Ydeath_strike
[sanlayn]
Fluffy_Pillow 99.0/125 79% RP
-59797652.8/13445780 -445% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:45.063Ydeath_strike
[sanlayn]
Fluffy_Pillow 74.0/125 59% RP
-56364174.2/13445780 -419% HP
2.0/6 33% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:46.190Rheart_strike
[sanlayn]
Fluffy_Pillow 49.0/125 39% RP
-54840027.6/13445780 -408% HP
3.0/6 50% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, tombstone, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:47.316Ssoul_reaper
[sanlayn]
Fluffy_Pillow 69.0/125 55% RP
-54021179.6/13445780 -402% HP
2.0/6 33% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:48.442Ydeath_strike
[sanlayn]
Fluffy_Pillow 79.0/125 63% RP
-54860882.6/13445780 -408% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:49.568Ydeath_strike
[sanlayn]
Fluffy_Pillow 54.0/125 43% RP
-53680071.2/13445780 -399% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:50.696Ydeath_strike
[sanlayn]
Fluffy_Pillow 29.0/125 23% RP
-50751842.0/13445780 -377% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:51.822Zheart_strike
[sanlayn]
Fluffy_Pillow 7.0/125 6% RP
-49308060.2/13445780 -367% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
3:52.949Zheart_strike
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
-49992449.5/13445780 -372% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), heartrend, sanguine_ground, luck_of_the_draw, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:54.076Ssoul_reaper
[sanlayn]
Fluffy_Pillow 44.0/125 35% RP
-51076927.8/13445780 -380% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), crimson_scourge, heartrend, sanguine_ground, luck_of_the_draw, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:55.206Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 54.0/125 43% RP
-49501927.8/13445780 -368% HP
1.0/6 17% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), crimson_scourge, heartrend, sanguine_ground, luck_of_the_draw, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:56.337Ydeath_strike
[sanlayn]
Fluffy_Pillow 54.0/125 43% RP
-49968751.6/13445780 -372% HP
2.0/6 33% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), heartrend, perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:57.4684vampiric_blood
[default]
Ácyd 29.0/125 23% RP
-48787940.3/13445780 -363% HP
2.0/6 33% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, luck_of_the_draw, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:57.468Rheart_strike
[sanlayn]
Fluffy_Pillow 29.0/125 23% RP
-63424322.4/17479514 -363% HP
2.0/6 33% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:58.600Ydeath_strike
[sanlayn]
Fluffy_Pillow 49.0/125 39% RP
-63159422.8/17479514 -361% HP
2.0/6 33% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
3:59.730Zheart_strike
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
-61163852.5/17479514 -350% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:00.0009raise_dead
[high_prio_actions]
Ácyd 41.0/125 33% RP
-59116352.5/17479514 -338% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:00.861Ssoul_reaper
[sanlayn]
Fluffy_Pillow 44.0/125 35% RP
-59798439.1/17479514 -342% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
4:01.992Ydeath_strike
[sanlayn]
Fluffy_Pillow 54.0/125 43% RP
-59574489.0/17479514 -341% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, flask_of_alchemical_chaos_crit, frost_shield
4:03.120Obonestorm
[sanlayn]
Fluffy_Pillow 32.0/125 26% RP
-80369921.3/17479514 -460% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(5), ossuary, ossified_vitriol, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
4:04.252Bdancing_rune_weapon
[high_prio_actions]
Ácyd 32.0/125 26% RP
-90942723.8/17479514 -520% HP
2.0/6 33% rune
blood_draw, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield, bonestorm, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:05.382Fblood_boil
[san_drw]
Fluffy_Pillow 32.0/125 26% RP
-88418033.1/17479514 -506% HP
3.0/6 50% rune
blood_draw, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(7), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
4:06.381Hheart_strike
[san_drw]
Fluffy_Pillow 32.0/125 26% RP
-88790216.8/17479514 -508% HP
3.0/6 50% rune
blood_draw, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(8), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:07.382Gdeath_and_decay
[san_drw]
Fluffy_Pillow 52.0/125 42% RP
-88074430.7/17479514 -504% HP
2.0/6 33% rune
blood_draw, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, bloodsoaked_ground, bone_shield(9), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, dancing_rune_weapon, hemostasis, sanguine_ground, vampiric_blood, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
4:08.381Hheart_strike
[san_drw]
Fluffy_Pillow 52.0/125 42% RP
-75631611.5/13445780 -562% HP
3.0/6 50% rune
blood_draw, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(9), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, astral_antenna_orb, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:09.381Hheart_strike
[san_drw]
Fluffy_Pillow 69.0/125 55% RP
-74930321.3/13445780 -557% HP
2.0/6 33% rune
blood_draw, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(10), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
4:10.382Hheart_strike
[san_drw]
Fluffy_Pillow 86.0/125 69% RP
-72931779.2/13445780 -542% HP
2.0/6 33% rune
blood_draw, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
4:11.381Edeath_strike
[san_drw]
Fluffy_Pillow 106.0/125 85% RP
-72706675.4/13445780 -541% HP
1.0/6 17% rune
blood_draw, icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(12), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, hemostasis, perseverance_of_the_ebon_blade, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:12.381Hheart_strike
[san_drw]
Fluffy_Pillow 81.0/125 65% RP
-68329068.4/13445780 -508% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), bonestorm, ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, perseverance_of_the_ebon_blade, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:13.383Edeath_strike
[san_drw]
Fluffy_Pillow 98.0/125 78% RP
-67905526.4/13445780 -505% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(12), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit, frost_shield
4:14.381Hheart_strike
[san_drw]
Fluffy_Pillow 63.0/125 50% RP
-72160840.1/13445780 -537% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:15.383Hheart_strike
[san_drw]
Fluffy_Pillow 80.0/125 64% RP
-71013977.0/13445780 -528% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:16.383Edeath_strike
[san_drw]
Fluffy_Pillow 97.0/125 78% RP
-70588994.9/13445780 -525% HP
0.0/6 0% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:17.383Hheart_strike
[san_drw]
Fluffy_Pillow 65.0/125 52% RP
-68688296.6/13445780 -511% HP
1.0/6 17% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), gift_of_the_sanlayn, vampiric_strike, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), dancing_rune_weapon, sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:18.385Qconsumption
[sanlayn]
Fluffy_Pillow 82.0/125 66% RP
-68123573.8/13445780 -507% HP
0.0/6 0% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), infliction_of_sorrow, visceral_strength, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, astral_antenna, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:19.515Rheart_strike
[sanlayn]
Fluffy_Pillow 82.0/125 66% RP
-68868870.7/13445780 -512% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), infliction_of_sorrow, bloodsoaked_ground, bone_shield(11), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:20.647Mblood_boil
[sanlayn]
Fluffy_Pillow 99.0/125 79% RP
-73729730.5/13445780 -548% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, sanguine_ground, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:21.779Ssoul_reaper
[sanlayn]
Fluffy_Pillow 102.0/125 82% RP
-74979462.3/13445780 -558% HP
3.0/6 50% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, hemostasis, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:22.909Pdeath_strike
[sanlayn]
Fluffy_Pillow 112.0/125 90% RP
-82296347.9/13445780 -612% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, hemostasis, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_crit
4:24.042Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 77.0/125 62% RP
-76679745.2/13445780 -570% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), blood_shield, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), consumption, crimson_scourge, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:25.173Ydeath_strike
[sanlayn]
Fluffy_Pillow 77.0/125 62% RP
-74941339.0/13445780 -557% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(10), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:26.303Ydeath_strike
[sanlayn]
Fluffy_Pillow 42.0/125 34% RP
-78560072.4/13445780 -584% HP
4.0/6 67% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:27.433Zheart_strike
[sanlayn]
Fluffy_Pillow 7.0/125 6% RP
-77043908.6/13445780 -573% HP
4.0/6 67% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:28.562Ssoul_reaper
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
-82993605.9/13445780 -617% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), heartrend, perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:29.6924vampiric_blood
[default]
Ácyd 37.0/125 30% RP
-84159631.1/13445780 -626% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), heartrend, perseverance_of_the_ebon_blade, sanguine_ground, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:29.692Ydeath_strike
[sanlayn]
Fluffy_Pillow 37.0/125 30% RP
-109407520.4/17479514 -626% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), heartrend, perseverance_of_the_ebon_blade, sanguine_ground, vampiric_blood, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:30.823Zheart_strike
[sanlayn]
Fluffy_Pillow 5.0/125 4% RP
-104075802.2/17479514 -595% HP
3.0/6 50% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:31.955Zheart_strike
[sanlayn]
Fluffy_Pillow 22.0/125 18% RP
-103854759.5/17479514 -594% HP
3.0/6 50% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, explosive_adrenaline, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:33.085Ydeath_strike
[sanlayn]
Fluffy_Pillow 42.0/125 34% RP
-104646584.7/17479514 -599% HP
2.0/6 33% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, ossified_vitriol(5), coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:34.217Zheart_strike
[sanlayn]
Fluffy_Pillow 17.0/125 14% RP
-102448969.8/17479514 -586% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:35.346Ssoul_reaper
[sanlayn]
Fluffy_Pillow 34.0/125 27% RP
-101059030.7/17479514 -578% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), visceral_strength, bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:36.477Ydeath_strike
[sanlayn]
Fluffy_Pillow 44.0/125 35% RP
-100882205.8/17479514 -577% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:37.608Zheart_strike
[sanlayn]
Fluffy_Pillow 19.0/125 15% RP
-99611485.4/17479514 -570% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(7), bloodsoaked_ground, bone_shield(9), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, charged_bolts, astral_antenna_orb, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:38.739Ydeath_strike
[sanlayn]
Fluffy_Pillow 36.0/125 29% RP
-99611485.4/17479514 -570% HP
1.0/6 17% rune
icy_talons(3), essence_of_the_blood_queen(7), bone_shield(9), ossuary, coagulopathy(5), vampiric_blood, luck_of_the_draw, charged_bolts, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:39.869Vtombstone
[sanlayn]
Ácyd 14.0/125 11% RP
-73769009.1/13445780 -549% HP
2.0/6 33% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(9), ossuary, coagulopathy(5), luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:40.999Tdeaths_caress
[sanlayn]
Fluffy_Pillow 44.0/125 35% RP
-72269009.1/13445780 -537% HP
2.0/6 33% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(4), ossified_vitriol(5), coagulopathy(5), tombstone, luck_of_the_draw, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:42.128Ssoul_reaper
[sanlayn]
Fluffy_Pillow 54.0/125 43% RP
-71484298.7/13445780 -532% HP
1.0/6 17% rune
icy_talons(3), unholy_strength, essence_of_the_blood_queen(7), bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), tombstone, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:43.259Ydeath_strike
[sanlayn]
Fluffy_Pillow 64.0/125 51% RP
-71484298.7/13445780 -532% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), unholy_strength, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), tombstone, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:44.469Zheart_strike
[sanlayn]
Fluffy_Pillow 29.0/125 23% RP
-69455801.2/13445780 -517% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), unholy_strength, blood_shield, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), tombstone, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:45.677Ydeath_strike
[sanlayn]
Fluffy_Pillow 46.0/125 37% RP
-67955801.2/13445780 -505% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), unholy_strength, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), tombstone, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:46.885Wdeath_and_decay
[sanlayn]
Fluffy_Pillow 11.0/125 9% RP
-66587939.2/13445780 -495% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), unholy_strength, blood_shield, bone_shield(6), ossuary, ossified_vitriol(5), coagulopathy(5), crimson_scourge, tombstone, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:48.094Ssoul_reaper
[sanlayn]
Fluffy_Pillow 11.0/125 9% RP
-66587939.2/13445780 -495% HP
2.0/6 33% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, astral_antenna, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers
4:49.336aconsumption
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
-67630109.7/13445780 -503% HP
1.0/6 17% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), perseverance_of_the_ebon_blade, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:50.547Zheart_strike
[sanlayn]
Fluffy_Pillow 24.0/125 19% RP
-65707378.1/13445780 -489% HP
4.0/6 67% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), consumption, perseverance_of_the_ebon_blade, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:51.755Ydeath_strike
[sanlayn]
Fluffy_Pillow 41.0/125 33% RP
-66709997.0/13445780 -496% HP
3.0/6 50% rune
rune_mastery, icy_talons(3), death_and_decay, unholy_strength, visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), consumption, heartrend, perseverance_of_the_ebon_blade, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:52.964Zheart_strike
[sanlayn]
Fluffy_Pillow 6.0/125 5% RP
-65478166.5/13445780 -487% HP
4.0/6 67% rune
icy_talons(3), death_and_decay, unholy_strength, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), consumption, sanguine_ground, maybe_stop_blowing_up, flask_of_alchemical_chaos_vers, frost_shield
4:54.172Ssoul_reaper
[sanlayn]
Fluffy_Pillow 23.0/125 18% RP
-65775674.0/13445780 -489% HP
3.0/6 50% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), consumption, sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
4:55.384Ydeath_strike
[sanlayn]
Fluffy_Pillow 33.0/125 26% RP
-64892872.8/13445780 -483% HP
3.0/6 50% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
4:56.594Rheart_strike
[sanlayn]
Fluffy_Pillow 11.0/125 9% RP
-63774322.2/13445780 -474% HP
3.0/6 50% rune
icebound_fortitude, icy_talons(3), death_and_decay, unholy_strength, vampiric_strike, visceral_strength, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery, frost_shield
4:57.801Ydeath_strike
[sanlayn]
Fluffy_Pillow 28.0/125 22% RP
-63580387.6/13445780 -473% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen, visceral_strength, bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
4:58.9994vampiric_blood
[default]
Ácyd 3.0/125 2% RP
-62461837.0/13445780 -465% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen, vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
4:58.999Rheart_strike
[sanlayn]
Fluffy_Pillow 3.0/125 2% RP
-81200388.1/17479514 -465% HP
3.0/6 50% rune
icy_talons(3), death_and_decay, unholy_strength, essence_of_the_blood_queen, vampiric_strike, bloodsoaked_ground, blood_shield, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery
5:00.197Zheart_strike
[sanlayn]
Fluffy_Pillow 23.0/125 18% RP
-79311374.7/17479514 -454% HP
2.0/6 33% rune
icy_talons(3), death_and_decay, essence_of_the_blood_queen(2), bloodsoaked_ground, bone_shield(6), ossuary, coagulopathy(5), sanguine_ground, vampiric_blood, luck_of_the_draw, maybe_stop_blowing_up, flask_of_alchemical_chaos_mastery

Stats

Level Bonus (80) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength176470649916425846611 (42598)
Agility14647014647146470
Stamina864520672289640276304437
Intellect95290981495290
Spirit00000
Health13445780128055200
Runic Power1251250
Rune660
Spell Power981495290
Crit18.83%19.25%9975
Haste23.12%12.83%7009
Versatility7.79%5.17%4034
Mitigation Versatility3.90%2.59%4034
Attack Power8289674900469
Mastery41.21%31.43%5402
Armor634896348959895
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry23.12%23.29%9975
Tank-Block0.00%0.00%0
Tank-Crit-9.00%-9.00%0

Gear

Source Slot Average Item Level: 657.00
Local Head Cauldron Champion's Crown
ilevel: 645, stats: { 7,644 Armor, +26,195 Sta, +1,468 Haste, +610 Vers, +4,013 StrInt }
Local Neck Long-Lost Choker
ilevel: 636, stats: { +13,070 Sta, +2,658 Crit, +3,345 Vers }
Local Shoulders Cauldron Champion's Screamplate
ilevel: 645, stats: { 7,007 Armor, +19,646 Sta, +490 Haste, +1,069 Mastery, +3,009 StrInt }
Local Chest Cauldron Champion's Ribcage
ilevel: 629, stats: { 9,241 Armor, +21,159 Sta, +604 Crit, +1,328 Haste, +3,457 StrInt }
Local Waist Durable Information Securing Container
ilevel: 691, stats: { 7,799 Armor, +35,257 Sta, +4,620 StrAgiInt }
item effects: { equip: Durable Information Securing Container, equip: Durable Information Securing Container, use: , equip: Durable Information Securing Container }
Local Legs Cauldron Champion's Tattered Cuisses
ilevel: 649, stats: { 9,146 Armor, +27,597 Sta, +1,439 Crit, +676 Mastery, +4,165 StrInt }
Local Feet Sterilized Expulsion Boots
ilevel: 668, stats: { 7,395 Armor, +26,420 Sta, +515 Crit, +1,202 Mastery, +3,729 StrInt }
Local Wrists Discarded Nutrient Shackles
ilevel: 671, stats: { 6,037 Armor, +20,593 Sta, +850 Crit, +453 Haste, +2,876 StrInt }
Local Hands Cauldron Champion's Fistguards
ilevel: 642, stats: { 5,626 Armor, +18,896 Sta, +525 Crit, +1,013 Mastery, +2,927 StrInt }
Local Finger1 Cyrce's Circlet
ilevel: 658, stats: { +17,449 Sta }, singing citrines: { Thunderlord's Crackling Citrine, Fathomdweller's Runed Citrine, Windsinger's Runed Citrine }
item effects: { equip: Cyrce's Circlet }
Local Finger2 Seal of Cosmic Embrace
ilevel: 626, stats: { +11,419 Sta, +3,188 Crit, +2,391 Haste }
Local Trinket1 Astral Antenna
ilevel: 671, stats: { +4,860 StrAgiInt }
item effects: { equip: Astral Antenna }
Local Trinket2 Improvised Seaforium Pacemaker
ilevel: 649, stats: { +3,959 StrAgi }
item effects: { equip: Improvised Seaforium Pacemaker, equip: Never Stop Blowing Up }
Local Back Reshii Wraps
ilevel: 730, stats: { +40,541 Sta, +4,983 StrAgiInt }
item effects: { equip: Ethereal Energy }
Local Main Hand Arathi Templar's Claymore
ilevel: 645, weapon: { 8,154 - 13,592, 3.6 }, stats: { +4,013 Str, +26,195 Sta, +742 Haste, +1,336 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Ironclaw Sharpened Weapon
Local Tabard Radiant Recruit's Tabard
ilevel: 1

Profile

deathknight="Ácyd"
source=blizzard
origin="https://worldofwarcraft.com/en-gb/character/antonidas/%C3%A1cyd"
spec=blood
level=80
race=human
role=tank
position=front
talents=CoPAclESCN5uIs3wGGVadXqL3xwgZYGzMGLzYmZmmZMjZGGDAAAAMzMzMzMzMbmZGDAAgZmZmBAAAMwAzY0YZDktBsBYmBbA

# Default consumables
potion=tempered_potion_3
flask=flask_of_alchemical_chaos_3
food=beledars_bounty
augmentation=crystallized
temporary_enchant=main_hand:ironclaw_whetstone_3

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats
actions.precombat+=/deaths_caress

# Executed every time the actor is available.
actions=auto_attack
actions+=/use_item,name=tome_of_lights_devotion,if=buff.inner_resilience.up,use_off_gcd=1
actions+=/use_item,name=unyielding_netherprism,if=cooldown.dancing_rune_weapon.remains<1|target.time_to_die<=20,use_off_gcd=1
actions+=/use_items
actions+=/use_item,name=bestinslots,use_off_gcd=1
actions+=/blood_fury,if=buff.dancing_rune_weapon.up
actions+=/berserking,if=buff.dancing_rune_weapon.up
actions+=/ancestral_call,if=buff.dancing_rune_weapon.up
actions+=/fireblood,if=buff.dancing_rune_weapon.up
actions+=/potion,if=buff.dancing_rune_weapon.up
actions+=/vampiric_blood,if=!buff.vampiric_blood.up
actions+=/call_action_list,name=high_prio_actions
actions+=/run_action_list,name=deathbringer,if=hero_tree.deathbringer
actions+=/run_action_list,name=san_drw,if=hero_tree.sanlayn&buff.dancing_rune_weapon.up
actions+=/run_action_list,name=sanlayn,if=hero_tree.sanlayn

actions.deathbringer=rune_tap,if=rune>4
actions.deathbringer+=/bonestorm,if=buff.bone_shield.stack>=5&buff.death_and_decay.remains
actions.deathbringer+=/death_strike,if=(runic_power.deficit<20|(runic_power.deficit<26&buff.dancing_rune_weapon.up))
actions.deathbringer+=/soul_reaper,if=active_enemies<=2&buff.reaper_of_souls.up&target.time_to_die>(dot.soul_reaper.remains+5)
actions.deathbringer+=/soul_reaper,if=active_enemies<=2&target.time_to_pct_35<5&target.time_to_die>(dot.soul_reaper.remains+5)
actions.deathbringer+=/reapers_mark
actions.deathbringer+=/blood_boil,if=buff.dancing_rune_weapon.up&!drw.bp_ticking
actions.deathbringer+=/death_and_decay,if=!buff.death_and_decay.up
actions.deathbringer+=/marrowrend,if=buff.exterminate.up|(buff.bone_shield.stack<5&!dot.bonestorm.ticking)
actions.deathbringer+=/death_strike
actions.deathbringer+=/tombstone,if=buff.bone_shield.stack>=8&buff.death_and_decay.remains&cooldown.dancing_rune_weapon.remains>=25
actions.deathbringer+=/blooddrinker,if=!buff.dancing_rune_weapon.up&active_enemies<=2&buff.coagulopathy.remains>3
actions.deathbringer+=/consumption
actions.deathbringer+=/blood_boil
actions.deathbringer+=/heart_strike,if=buff.coagulopathy.stack<5
actions.deathbringer+=/heart_strike
actions.deathbringer+=/soul_reaper,if=buff.reaper_of_souls.up
actions.deathbringer+=/arcane_torrent,if=runic_power.deficit>20

actions.high_prio_actions=raise_dead,use_off_gcd=1
actions.high_prio_actions+=/blood_tap,if=(rune<=2&rune.time_to_3>gcd&charges_fractional>=1.8)
actions.high_prio_actions+=/blood_tap,if=(rune<=1&rune.time_to_3>gcd)
actions.high_prio_actions+=/death_strike,if=buff.coagulopathy.up&buff.coagulopathy.remains<=gcd
actions.high_prio_actions+=/dancing_rune_weapon

actions.san_drw=heart_strike,if=buff.essence_of_the_blood_queen.remains<1.5&buff.essence_of_the_blood_queen.remains
actions.san_drw+=/bonestorm,if=buff.bone_shield.stack>=5
actions.san_drw+=/death_strike,if=runic_power.deficit<36
actions.san_drw+=/blood_boil,if=!drw.bp_ticking
actions.san_drw+=/any_dnd,if=(active_enemies<=3&buff.crimson_scourge.remains)|(active_enemies>3&!buff.death_and_decay.remains)
actions.san_drw+=/heart_strike
actions.san_drw+=/death_strike
actions.san_drw+=/consumption
actions.san_drw+=/blood_boil

actions.sanlayn=blood_boil,if=(!buff.bone_shield.up|buff.bone_shield.remains<1.5|buff.bone_shield.stack<=1)&active_enemies>=2
actions.sanlayn+=/deaths_caress,if=!buff.bone_shield.up|buff.bone_shield.remains<1.5|buff.bone_shield.stack<=1
actions.sanlayn+=/blood_boil,if=dot.blood_plague.remains<3
actions.sanlayn+=/heart_strike,if=(buff.essence_of_the_blood_queen.remains<1.5&buff.essence_of_the_blood_queen.remains&buff.vampiric_strike.remains)
actions.sanlayn+=/bonestorm,if=buff.bone_shield.stack>=5&(buff.death_and_decay.remains|active_enemies<=3)
actions.sanlayn+=/death_strike,if=runic_power.deficit<20
actions.sanlayn+=/consumption,if=buff.infliction_of_sorrow.up&buff.death_and_decay.up
actions.sanlayn+=/heart_strike,if=(buff.infliction_of_sorrow.up|buff.vampiric_strike.up)&buff.death_and_decay.up
actions.sanlayn+=/soul_reaper,if=active_enemies<=2&target.time_to_pct_35<5&target.time_to_die>(dot.soul_reaper.remains+5)
actions.sanlayn+=/blood_boil,if=buff.bone_shield.stack<6&!dot.bonestorm.ticking&active_enemies>=2
actions.sanlayn+=/deaths_caress,if=buff.bone_shield.stack<6&!dot.bonestorm.ticking
actions.sanlayn+=/marrowrend,if=buff.bone_shield.stack<6&!dot.bonestorm.ticking
actions.sanlayn+=/tombstone,if=buff.bone_shield.stack>=6&(buff.death_and_decay.remains|active_enemies<=3)&cooldown.dancing_rune_weapon.remains>=25
actions.sanlayn+=/any_dnd,if=(active_enemies<=3&buff.crimson_scourge.remains)|(active_enemies>3&!buff.death_and_decay.remains)
actions.sanlayn+=/blooddrinker,if=active_enemies<=2&buff.coagulopathy.remains>3
actions.sanlayn+=/heart_strike,if=buff.vampiric_strike.up
actions.sanlayn+=/death_strike
actions.sanlayn+=/heart_strike,if=rune>=2
actions.sanlayn+=/consumption
actions.sanlayn+=/blood_boil
actions.sanlayn+=/heart_strike

head=cauldron_champions_crown,id=229253,bonus_id=10353/11960/6652/12176/12178/11976/1494/10255
neck=longlost_choker,id=211063,bonus_id=11977/6652/10394/10393/13250/1541/10255
shoulders=cauldron_champions_screamplate,id=229251,bonus_id=10353/11962/6652/12179/11976/1494/10255
back=reshii_wraps,id=235499,bonus_id=12401/9893
chest=cauldron_champions_ribcage,id=229256,bonus_id=11971/6652/12178/11958/1478
tabard=radiant_recruits_tabard,id=233288
wrists=discarded_nutrient_shackles,id=237545,bonus_id=6652/12921/12239/10353/12283/1481/10255
hands=cauldron_champions_fistguards,id=229254,bonus_id=6652/12179/11959/11975/1491/10255
waist=durable_information_securing_container,id=245966,bonus_id=12530/1479
legs=cauldron_champions_tattered_cuisses,id=229252,bonus_id=6652/12178/11961/11981/1498/10255
feet=sterilized_expulsion_boots,id=237551,bonus_id=6652/12239/10353/12282/1478/10255
finger1=cyrces_circlet,id=228411,bonus_id=12028/1511,gem_id=228634/228639/228640/0
finger2=seal_of_cosmic_embrace,id=237472,bonus_id=11970/11215/6652/10395/10878/1488/10255
trinket1=astral_antenna,id=242395,bonus_id=6652/10353/12283/1481/10255
trinket2=improvised_seaforium_pacemaker,id=232541,bonus_id=11985/10390/6652/10383/1485/10255
main_hand=arathi_templars_claymore,id=241033,bonus_id=6652/11980/1507/10255,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=657.00
# gear_strength=46611
# gear_stamina=304437
# gear_attack_power=469
# gear_crit_rating=9779
# gear_haste_rating=6872
# gear_mastery_rating=5296
# gear_versatility_rating=3955
# gear_armor=59895
# set_bonus=thewarwithin_season_2_2pc=1
# set_bonus=thewarwithin_season_2_4pc=1

Simulation & Raid Information

Iterations: 10023
Threads: 24
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 104322037
Max Event Queue: 131
Sim Seconds: 3007254
CPU Seconds: 99.0320
Physical Seconds: 12.6037
Speed Up: 30367

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Ácyd Ácyd augmentation 453250 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
Ácyd Ácyd auto_attack_mh 0 16152649 53836 35.63 70171 140429 178.2 178.2 29.2% 0.0% 0.0% 0.0% 2.00sec 23075190 300.04sec
Ácyd Ácyd blood_beast_summon 434237 0 0 0.00 0 0 6.3 0.0 0.0% 0.0% 0.0% 0.0% 52.30sec 0 300.04sec
Ácyd Ácyd blood_boil 50842 5714903 19047 3.71 239039 477617 18.6 18.6 28.8% 0.0% 0.0% 0.0% 16.32sec 5714903 300.04sec
Ácyd Ácyd blood_draw 374606 1704806 5682 0.59 443351 883080 3.0 3.0 30.2% 0.0% 0.0% 0.0% 120.02sec 1704806 300.04sec
Ácyd Ácyd blood_plague ticks -55078 14421228 48071 23.62 94804 189111 27.5 118.1 28.9% 0.0% 0.0% 0.0% 11.03sec 14421228 300.04sec
Ácyd Ácyd blood_plague_heal 55078 31312603 104363 23.62 204472 413875 118.1 118.1 28.9% 0.0% 0.0% 0.0% 2.52sec 31895083 300.04sec
Ácyd Ácyd blood_shield 77535 90313008 301008 35.43 509777 0 86.7 177.2 0.0% 0.0% 0.0% 0.0% 3.37sec 101993880 300.04sec
Ácyd Ácyd bloodworm_summon 196361 0 0 0.00 0 0 27.7 0.0 0.0% 0.0% 0.0% 0.0% 10.53sec 0 300.04sec
Ácyd Ácyd bonestorm 194844 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.36sec 0 300.04sec
Ácyd Ácyd bonestorm_damage 196528 7565788 25216 10.72 107898 215520 53.6 53.6 30.9% 0.0% 0.0% 0.0% 5.25sec 7565788 300.04sec
Ácyd Ácyd bonestorm_heal 196545 18230611 60762 10.72 339969 0 53.6 53.6 0.0% 0.0% 0.0% 0.0% 5.25sec 19683075 300.04sec
Ácyd Ácyd consumption 274156 2180826 7269 1.54 220553 441332 7.7 7.7 28.7% 0.0% 0.0% 0.0% 39.53sec 3115463 300.04sec
Ácyd Ácyd consumption_heal 274156 3614342 12046 1.54 470568 0 7.7 7.7 0.0% 0.0% 0.0% 0.0% 39.53sec 3740524 300.04sec
Ácyd Ácyd dancing_rune_weapon 49028 0 0 0.00 0 0 6.3 0.0 0.0% 0.0% 0.0% 0.0% 52.30sec 0 300.04sec
Ácyd Ácyd_dancing_rune_weapon auto_attack_mh 0 3629176 41613 49.01 39458 78841 71.2 71.2 29.2% 0.0% 0.0% 0.0% 4.36sec 5184532 87.21sec
Ácyd Ácyd_dancing_rune_weapon blood_plague ticks -55078 8791887 29306 26.38 51756 102976 12.8 131.9 29.1% 0.0% 0.0% 0.0% 50.17sec 8791887 87.21sec
Ácyd Ácyd_dancing_rune_weapon blood_boil 50842 2187239 25080 8.78 132466 265321 12.8 12.8 29.3% 0.0% 0.0% 0.0% 50.17sec 2187239 87.21sec
Ácyd Ácyd_dancing_rune_weapon death_strike 49998 30673659 351713 31.52 518355 1035252 45.8 45.8 29.2% 0.0% 0.0% 0.0% 12.27sec 43819470 87.21sec
Ácyd Ácyd_dancing_rune_weapon consumption 274156 158110 1813 0.70 119994 240047 1.0 1.0 28.6% 0.0% 0.0% 0.0% 127.33sec 225871 87.21sec
Ácyd Ácyd_dancing_rune_weapon vampiric_strike 433895 29320584 336199 70.07 222811 445038 101.8 101.8 29.3% 0.0% 0.0% 0.0% 5.55sec 29320584 87.21sec
Ácyd Ácyd death_and_decay ticks -43265 5318451 17728 0.00 21730 43445 17.5 0.0 29.0% 0.0% 0.0% 0.0% 17.15sec 5318451 300.04sec
Ácyd Ácyd death_strike 49998 84500078 281634 17.34 755223 1511666 86.7 86.7 29.0% 0.0% 0.0% 0.0% 3.37sec 120714276 300.04sec
Ácyd Ácyd death_strike_heal 45470 200804018 669268 17.34 2315546 0 86.7 86.7 0.0% 0.0% 0.0% 0.0% 3.37sec 203058288 300.04sec
Ácyd Ácyd deaths_caress 195292 806859 2689 1.79 69810 140939 8.0 9.0 28.3% 0.0% 0.0% 0.0% 37.30sec 806859 300.04sec
Ácyd Ácyd flask 432021 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
Ácyd Ácyd food 454149 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
Ácyd Ácyd frost_shield 207203 6576609 21919 61.72 21307 0 178.2 308.6 0.0% 0.0% 0.0% 0.0% 2.00sec 9166541 300.04sec
Ácyd Ácyd heart_strike 206930 12811155 42699 9.65 206093 412048 123.1 48.2 28.9% 0.0% 0.0% 0.0% 2.40sec 18301632 300.04sec
Ácyd Ácyd vampiric_strike 433895 42473792 141563 14.97 439437 878434 74.9 74.9 29.1% 0.0% 0.0% 0.0% 3.93sec 42473792 300.04sec
Ácyd Ácyd infliction_of_sorrow 434144 43244575 144132 16.19 415557 823084 80.9 80.9 29.1% 0.0% 0.0% 0.0% 3.66sec 43244575 300.04sec
Ácyd Ácyd the_blood_is_life 434246 4203771 14011 1.24 680241 0 6.2 6.2 0.0% 0.0% 0.0% 0.0% 50.70sec 4203771 300.04sec
Ácyd Ácyd_blood_beast auto_attack_mh 0 2264082 36154 90.49 18559 37053 94.4 94.4 29.3% 0.0% 0.0% 0.0% 2.95sec 3234399 62.62sec
Ácyd Ácyd_blood_beast corrupted_blood 434574 6614037 105618 24.03 204065 407421 25.1 25.1 29.3% 0.0% 0.0% 0.0% 12.01sec 6614037 62.62sec
Ácyd Ácyd lightning_strike 1236111 7509394 25028 10.31 113065 226272 51.5 51.5 28.8% 0.0% 0.0% 0.0% 5.32sec 7509394 300.04sec
Ácyd Ácyd marrowrend 195182 400943 1336 0.20 309605 619752 1.0 1.0 32.1% 0.0% 0.0% 0.0% 176.10sec 572775 300.04sec
Ácyd Ácyd potion 431932 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 306.23sec 0 300.04sec
Ácyd Ácyd raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.00sec 0 300.04sec
Ácyd Ácyd_ghoul auto_attack_mh 0 6791607 41157 44.27 43181 86456 121.8 121.8 29.1% 0.0% 0.0% 0.0% 2.33sec 9702286 165.02sec
Ácyd Ácyd_ghoul gnaw 91800 4717 29 1.09 1246 2489 3.0 3.0 26.6% 0.0% 0.0% 0.0% 120.00sec 6739 165.02sec
Ácyd Ácyd_ghoul claw 91776 3270106 19817 23.84 38649 77380 65.6 65.6 29.0% 0.0% 0.0% 0.0% 4.34sec 4671575 165.02sec
Ácyd Ácyd shattering_bone 377642 6869410 22895 8.08 132492 256000 40.4 40.4 30.4% 0.0% 0.0% 0.0% 7.42sec 6869410 300.04sec
Ácyd Ácyd soul_reaper 343294 2482068 8273 2.29 168871 337567 11.5 11.5 28.3% 0.0% 0.0% 0.0% 9.04sec 2482068 300.04sec
Ácyd Ácyd soul_reaper_execute 343295 11544308 38476 2.29 784382 1568176 0.0 11.5 28.4% 0.0% 0.0% 0.0% 0.00sec 11544308 300.04sec
Ácyd Ácyd thunderlords_crackling_citrine 462951 11129381 37094 6.52 264421 528863 32.6 32.6 29.1% 0.0% 0.0% 0.0% 9.08sec 11129381 300.04sec
Ácyd Ácyd tombstone 219809 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 67.07sec 0 300.04sec
Ácyd Ácyd unholy_strength 53365 19600478 65327 4.88 802689 0 24.4 24.4 0.0% 0.0% 0.0% 0.0% 11.95sec 20395166 300.04sec
Ácyd Ácyd vampiric_blood 55233 0 0 0.00 0 0 10.4 0.0 0.0% 0.0% 0.0% 0.0% 30.53sec 0 300.04sec
Ácyd Ácyd vampiric_strike_heal 434422 23606391 78679 14.97 169130 671554 74.9 74.9 29.1% 0.0% 0.0% 0.0% 3.93sec 24798917 300.04sec
Ácyd Ácyd_bloodworm auto_attack_mh 0 6223419 79416 311.91 11845 23691 407.4 407.4 29.0% 0.0% 0.0% 0.0% 0.70sec 8890589 78.37sec

Fluffy_Pillow : 1,547,692 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1,547,692.21,547,692.20.0 / 0.000%0.0 / 0.0%1.2
Resource Out In Waiting APM Active
Health1,241,419.20.046.46%3.4100.0%

Scale Factors for other metrics

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Fluffy_Pillow1,547,692
melee_main_hand_Ácyd 922,70559.6%77.53.75s3,566,4241,783,218Direct77.55,736,92303,566,7350.0%37.8%

Stats Details: Melee Main Hand Ácyd

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage77.5177.510.000.000.002.00000.0000276,429,087.98674,587,557.1959.02%1,783,217.891,783,217.89
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit62.17%48.1829675,736,923.47010,521,8645,734,280.914,933,7646,358,536276,429,088674,587,55759.04%
parry37.83%29.3313470.00000.0000000.00%

Action Details: Melee Main Hand Ácyd

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:13720000.00
  • base_dd_max:14280000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
melee_nuke_Ácyd 248,91716.1%5.559.57s13,612,2936,791,419Direct5.513,612,551013,612,5510.0%0.0%

Stats Details: Melee Nuke Ácyd

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.475.470.000.000.002.00450.000074,406,791.64153,045,998.8851.38%6,791,419.466,791,419.46
Direct ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualRawMitigated
hit100.00%5.474613,612,551.146,290,31021,035,24113,612,645.349,655,50216,146,90974,406,792153,045,99951.38%

Action Details: Melee Nuke Ácyd

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27440000.00
  • base_dd_max:28560000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Action Priority List

    default
    [2]:5.50
spell_dot_Ácyd 376,07024.3%5.361.01s21,106,23221,011,949Periodic144.8778,3610778,3610.0%0.0%96.5%

Stats Details: Spell Dot Ácyd

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage5.340.00144.82144.820.001.00452.0000112,729,106.21202,747,974.8044.40%382,126.0921,011,948.97
Tick ResultsCountSimulationIteration AverageAmount
PercentMeanMinMaxMeanMinMaxMeanMinMaxActualTotalMitigated
hit100.00%144.82115174778,361.1201,345,445779,360.01622,617934,743112,729,106202,747,97544.33%

Action Details: Spell Dot Ácyd

  • id:0
  • school:physical
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:1.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • rolling_periodic:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1400000.00
  • base_td_mult:1.00
  • base_multiplier:1.00
  • dot_duration:60.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Action Priority List

    default
    [3]:5.36
Simple Action Stats Execute Interval
Fluffy_Pillow
pause_action 4.560.01s

Stats Details: Pause Action

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
damage4.500.000.000.000.0030.00450.00000.000.000.00%0.000.00

Action Details: Pause Action

  • id:0
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:30.00
  • base_crit:0.00
  • target:Ácyd
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [4]:5.00
  • if_expr:time>=30
    default
    [4]:5.00
  • if_expr:time>=30
tank_heal 60.55.00s

Stats Details: Tank Heal

TypeExecutesDirect ResultsTicksTick ResultsRefreshesExecute Time per ExecutionTick Time per TickActual AmountRaw AmountMitigatedAmount per Total TimeAmount per Total Execute Time
heal60.510.000.000.000.000.00000.00000.000.000.00%0.000.00

Action Details: Tank Heal

  • id:0
  • school:holy
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0
  • secondary_cost:0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1500000.00
  • base_dd_max:1500000.00
  • base_dd_mult:1.00
  • base_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle14.73.019.4s16.0s5.5s26.95%0.00%3.0 (3.0)14.4

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.9s / 166.6s
  • trigger_min/max:1.8s / 166.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.6s
  • uptime_min/max:8.95% / 48.22%

Stack Uptimes

  • brittle_1:26.95%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Incite Terror1.0122.1200.4s2.4s294.7s99.00%0.00%118.1 (118.1)0.0

Buff Details

  • buff initial source:Ácyd
  • cooldown name:buff_incite_terror
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.5s / 353.4s
  • trigger_min/max:0.8s / 30.6s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 357.4s
  • uptime_min/max:94.52% / 99.30%

Stack Uptimes

  • incite_terror_1:0.31%
  • incite_terror_2:0.35%
  • incite_terror_3:0.29%
  • incite_terror_4:0.32%
  • incite_terror_5:97.72%

Spelldata

  • id:458478
  • name:Incite Terror
  • tooltip:Taking {$=}w1% increased Shadow damage from {$@=}auracaster.
  • description:{$@spelldesc434151=Vampiric Strike and {$?a137008=true}[Heart Strike]?s207311[Clawing Shadows][Scourge Strike] cause your targets to take {$458478s1=1}% increased Shadow damage, up to {$=}{{$458478s1=1}*{$458478=}U}% for {$458478d=15 seconds}. Vampiric Strike benefits from Incite Terror at {$s2=400}% effectiveness.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=3}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=3}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:257284
  • name:Hunter's Mark
  • tooltip:Can always be seen and tracked by the Hunter. Damage taken increased by $428402s4% while above {$s3=80}% health.
  • description:Apply Hunter's Mark to the target, causing the target to always be seen and tracked by the Hunter. Hunter's Mark increases all damage dealt to targets above {$s3=80}% health by {$428402s1=5}%. Only one Hunter's Mark damage increase can be applied to a target at a time. Hunter's Mark can only be applied to one target at a time. When applying Hunter's Mark in combat, the ability goes on cooldown for {$=}{{$s5=20000}/1000} sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Skyfury

Buff Details

  • buff initial source:
  • cooldown name:buff_skyfury
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:20.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:462854
  • name:Skyfury
  • tooltip:Mastery increased by $w1% and auto attacks have a $h% chance to instantly strike again.
  • description:Harness the fury of the Windlord to grant a target ally $s1% Mastery and empower their auto attacks to have a $h% chance to instantly strike again for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
delayed_aa_cast5.04.06.060.0s60.0s60.0s

Resources

Change Start Gain/s Loss/s Overflow End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 9999
Mean 300.04
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Fluffy_Pillow Damage Per Second
Count 9999
Mean 1547692.18
Minimum 1250183.30
Maximum 1888235.41
Spread ( max - min ) 638052.10
Range [ ( max - min ) / 2 * 100% ] 20.61%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 1547692.18
Minimum 1250183.30
Maximum 1888235.41
Spread ( max - min ) 638052.10
Range [ ( max - min ) / 2 * 100% ] 20.61%
Damage
Fluffy_Pillow Damage
Count 9999
Mean 463564985.83
Minimum 305197871.33
Maximum 611667726.42
Spread ( max - min ) 306469855.10
Range [ ( max - min ) / 2 * 100% ] 33.06%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 1270081.55
Minimum 1099410.89
Maximum 1468758.38
Spread ( max - min ) 369347.49
Range [ ( max - min ) / 2 * 100% ] 14.54%
Standard Deviation 42817.4033
5th Percentile 1201632.24
95th Percentile 1342444.55
( 95th Percentile - 5th Percentile ) 140812.31
Mean Distribution
Standard Deviation 428.1954
95.00% Confidence Interval ( 1269242.30 - 1270920.80 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4366
0.1 Scale Factor Error with Delta=300 15650360
0.05 Scale Factor Error with Delta=300 62601439
0.01 Scale Factor Error with Delta=300 1565035956
HPS
Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=14000000,range=280000,attack_speed=2,aoe_tanks=1
2 5.50 melee_nuke,damage=28000000,range=560000,attack_speed=2,cooldown=30,aoe_tanks=1
3 5.36 spell_dot,damage=1400000,range=28000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
4 5.00 pause_action,duration=30,cooldown=30,if=time>=30

Stats

Level Bonus (83) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength00000
Agility00000
Stamina00000
Intellect00000
Spirit00000
Health03139537420
Melee Crit5.00%5.00%0
Spell Crit0.00%0.00%0
Haste0.00%0.00%0
Versatility0.00%0.00%0
Mitigation Versatility0.00%0.00%0
Mastery0.00%0.00%0
Armor428574285742857
Run Speed700
Tank-Miss3.00%3.00%0
Tank-Dodge3.00%3.00%0
Tank-Parry3.00%3.00%0
Tank-Block3.00%3.00%0
Tank-Crit0.00%0.00%0

Gear

Source Slot Average Item Level: 0.00

Profile

tank_dummy="Fluffy_Pillow"
source=default
spec=unknown
level=83
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=14000000,range=280000,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=28000000,range=560000,attack_speed=2,cooldown=30,aoe_tanks=1
actions+=/spell_dot,damage=1400000,range=28000,tick_time=2,cooldown=60,aoe_tanks=1,dot_duration=60,bleed=1
actions+=/pause_action,duration=30,cooldown=30,if=time>=30


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.